From 32102073dfa76caf6e42c6710d7165376e57d99f Mon Sep 17 00:00:00 2001 From: "Horst.Hunger" Date: Thu, 11 Nov 2010 11:25:03 +0100 Subject: [PATCH 001/202] 2. review update for bug#52501 fixing a syntax error, a not actual result file and replaced directory info by place holder. --- mysql-test/suite/sys_vars/r/general_log_file_basic.result | 2 +- mysql-test/suite/sys_vars/r/log_output_func.result | 2 +- mysql-test/suite/sys_vars/r/slow_query_log_file_basic.result | 2 +- mysql-test/suite/sys_vars/t/div_precision_increment_func.test | 2 +- mysql-test/suite/sys_vars/t/general_log_file_basic.test | 1 + mysql-test/suite/sys_vars/t/log_output_func.test | 1 + mysql-test/suite/sys_vars/t/slow_query_log_file_basic.test | 1 + 7 files changed, 7 insertions(+), 4 deletions(-) diff --git a/mysql-test/suite/sys_vars/r/general_log_file_basic.result b/mysql-test/suite/sys_vars/r/general_log_file_basic.result index 5c0b93cf4ab..31fdd07d06e 100644 --- a/mysql-test/suite/sys_vars/r/general_log_file_basic.result +++ b/mysql-test/suite/sys_vars/r/general_log_file_basic.result @@ -16,4 +16,4 @@ FROM INFORMATION_SCHEMA.GLOBAL_VARIABLES WHERE VARIABLE_NAME='general_log_file'; @@global.general_log_file = VARIABLE_VALUE 1 -SET @@global.general_log_file= 'test.log'; +SET @@global.general_log_file= 'start_value'; diff --git a/mysql-test/suite/sys_vars/r/log_output_func.result b/mysql-test/suite/sys_vars/r/log_output_func.result index 00a8e824f78..24703f4317b 100644 --- a/mysql-test/suite/sys_vars/r/log_output_func.result +++ b/mysql-test/suite/sys_vars/r/log_output_func.result @@ -52,7 +52,7 @@ count(*) DROP TABLE t1; connection default; SET @@global.general_log= 'OFF'; -SET @@global.general_log_file= '/home/horst/bzr/5.1-52501/mysql-test/var/mysqld.1/mysqld.log'; +SET @@global.general_log_file= 'start_general_log_file'; SET @@global.log_output= @start_value; SET @@global.general_log= @start_general_log; SET @@global.general_log= 'ON'; diff --git a/mysql-test/suite/sys_vars/r/slow_query_log_file_basic.result b/mysql-test/suite/sys_vars/r/slow_query_log_file_basic.result index 3cd62187d0b..ce4fd8094bf 100644 --- a/mysql-test/suite/sys_vars/r/slow_query_log_file_basic.result +++ b/mysql-test/suite/sys_vars/r/slow_query_log_file_basic.result @@ -14,4 +14,4 @@ FROM INFORMATION_SCHEMA.GLOBAL_VARIABLES WHERE VARIABLE_NAME='slow_query_log_file'; @@global.slow_query_log_file = VARIABLE_VALUE 1 -SET @@global.slow_query_log_file= 'slowtest.log'; +SET @@global.slow_query_log_file= 'start_value'; diff --git a/mysql-test/suite/sys_vars/t/div_precision_increment_func.test b/mysql-test/suite/sys_vars/t/div_precision_increment_func.test index aebca88abf9..ba7bc65eb48 100644 --- a/mysql-test/suite/sys_vars/t/div_precision_increment_func.test +++ b/mysql-test/suite/sys_vars/t/div_precision_increment_func.test @@ -19,7 +19,7 @@ # # ################################################################################ -let $save_div_precision_increment = `SELECT @@global.div_precision_increment` +let $save_div_precision_increment = `SELECT @@global.div_precision_increment`; #SET @save_div_precision_increment = @@global.div_precision_increment; diff --git a/mysql-test/suite/sys_vars/t/general_log_file_basic.test b/mysql-test/suite/sys_vars/t/general_log_file_basic.test index 35905bad987..f02c59736e3 100644 --- a/mysql-test/suite/sys_vars/t/general_log_file_basic.test +++ b/mysql-test/suite/sys_vars/t/general_log_file_basic.test @@ -70,6 +70,7 @@ FROM INFORMATION_SCHEMA.GLOBAL_VARIABLES WHERE VARIABLE_NAME='general_log_file'; #SET @@global.general_log_file= @start_value; +--replace_result $start_value start_value eval SET @@global.general_log_file= '$start_value'; ##################################################### diff --git a/mysql-test/suite/sys_vars/t/log_output_func.test b/mysql-test/suite/sys_vars/t/log_output_func.test index 8a2fbe0728b..6b7c01a7dab 100644 --- a/mysql-test/suite/sys_vars/t/log_output_func.test +++ b/mysql-test/suite/sys_vars/t/log_output_func.test @@ -115,6 +115,7 @@ file_exists $MYSQLTEST_VARDIR/run/mytest.log ; connection default; SET @@global.general_log= 'OFF'; #SET @@global.general_log_file= @start_general_log_file; +--replace_result $start_general_log_file start_general_log_file eval SET @@global.general_log_file= '$start_general_log_file'; SET @@global.log_output= @start_value; SET @@global.general_log= @start_general_log; diff --git a/mysql-test/suite/sys_vars/t/slow_query_log_file_basic.test b/mysql-test/suite/sys_vars/t/slow_query_log_file_basic.test index 810588b8f4e..4eb747d888b 100644 --- a/mysql-test/suite/sys_vars/t/slow_query_log_file_basic.test +++ b/mysql-test/suite/sys_vars/t/slow_query_log_file_basic.test @@ -68,6 +68,7 @@ FROM INFORMATION_SCHEMA.GLOBAL_VARIABLES WHERE VARIABLE_NAME='slow_query_log_file'; #SET @@global.slow_query_log_file= @start_value; +--replace_result $start_value start_value eval SET @@global.slow_query_log_file= '$start_value'; #SELECT @start_value; ##################################################### From 7fb17e42cf2f6f309f43907f2db84389d8d895e8 Mon Sep 17 00:00:00 2001 From: =?UTF-8?q?Marko=20M=C3=A4kel=C3=A4?= Date: Mon, 10 Jan 2011 15:34:45 +0200 Subject: [PATCH 002/202] Bug#59181 InnoDB compilation failure on the Sun Studio compiler Define UNIV_PREFETCH_R(add) as sun_prefetch_read_many((void*) addr), because apparently some versions of the Sun library omit the const qualifier. --- storage/innodb_plugin/include/univ.i | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) diff --git a/storage/innodb_plugin/include/univ.i b/storage/innodb_plugin/include/univ.i index bbff8ddf1e3..4425950748b 100644 --- a/storage/innodb_plugin/include/univ.i +++ b/storage/innodb_plugin/include/univ.i @@ -412,7 +412,7 @@ it is read or written. */ /* Use sun_prefetch when compile with Sun Studio */ # define UNIV_EXPECT(expr,value) (expr) # define UNIV_LIKELY_NULL(expr) (expr) -# define UNIV_PREFETCH_R(addr) sun_prefetch_read_many(addr) +# define UNIV_PREFETCH_R(addr) sun_prefetch_read_many((void*) addr) # define UNIV_PREFETCH_RW(addr) sun_prefetch_write_many(addr) #else /* Dummy versions of the macros */ From c574a9c414f817975f75a08744b2f0bea1232ff3 Mon Sep 17 00:00:00 2001 From: Mattias Jonsson Date: Mon, 10 Jan 2011 16:20:28 +0100 Subject: [PATCH 003/202] Bug#57924: crash when creating partitioned table with multiple columns in the partition key ndb crash if duplicate columns in the partitioning key. Backport from mysql-5.1-telco-7.0, see bug#53354. Changed from case sensitive field name comparision to non case sensitive too. mysql-test/r/partition_error.result: updated result mysql-test/t/partition_error.test: Added test for the error in non-ndb partitioned table. sql/sql_partition.cc: Added check for duplicated field names in the partitioning key. --- mysql-test/r/partition_error.result | 13 +++++++++++++ mysql-test/suite/ndb/r/ndb_basic.result | 2 ++ mysql-test/suite/ndb/t/ndb_basic.test | 7 +++++++ mysql-test/t/partition_error.test | 14 ++++++++++++++ sql/sql_partition.cc | 22 ++++++++++++++++++++++ 5 files changed, 58 insertions(+) diff --git a/mysql-test/r/partition_error.result b/mysql-test/r/partition_error.result index ea74f476ceb..91eb18b3dad 100644 --- a/mysql-test/r/partition_error.result +++ b/mysql-test/r/partition_error.result @@ -1,5 +1,18 @@ drop table if exists t1; # +# Bug#57924: crash when creating partitioned table with +# multiple columns in the partition key +# +CREATE TABLE t1 (a INT, b INT, PRIMARY KEY (a,b)) +PARTITION BY KEY(a, b, a); +ERROR HY000: Field in list of fields for partition function not found in table +CREATE TABLE t1 (a INT, b INT, PRIMARY KEY (a,b)) +PARTITION BY KEY(A, b); +DROP TABLE t1; +CREATE TABLE t1 (a INT, b INT, PRIMARY KEY (a,b)) +PARTITION BY KEY(a, b, A); +ERROR HY000: Field in list of fields for partition function not found in table +# # Bug#49161: Out of memory; restart server and try again (needed 2 bytes) # CREATE TABLE t1 (a INT) PARTITION BY HASH (a); diff --git a/mysql-test/suite/ndb/r/ndb_basic.result b/mysql-test/suite/ndb/r/ndb_basic.result index 9f4f8c0755c..ee50352220e 100644 --- a/mysql-test/suite/ndb/r/ndb_basic.result +++ b/mysql-test/suite/ndb/r/ndb_basic.result @@ -585,6 +585,8 @@ c127 int, c128 int, primary key using hash(c1)) engine=ndb partition by key(c1); drop table t1; +create table `t1` (`a` int, b int, primary key (a,b)) engine=ndb partition by key(`a`,`b`,`a`); +ERROR HY000: Field in list of fields for partition function not found in table create table t1 ( a1234567890123456789012345678901234567890 int primary key, a12345678901234567890123456789a1234567890 int, diff --git a/mysql-test/suite/ndb/t/ndb_basic.test b/mysql-test/suite/ndb/t/ndb_basic.test index 2fc140288ca..5d6221d1784 100644 --- a/mysql-test/suite/ndb/t/ndb_basic.test +++ b/mysql-test/suite/ndb/t/ndb_basic.test @@ -547,6 +547,13 @@ c128 int, primary key using hash(c1)) engine=ndb partition by key(c1); drop table t1; +# +# test bug#53354 - crash when creating partitioned table with multiple columns in the partition key +# + +--error ER_FIELD_NOT_FOUND_PART_ERROR +create table `t1` (`a` int, b int, primary key (a,b)) engine=ndb partition by key(`a`,`b`,`a`); + # # test max size of attribute name and truncation # diff --git a/mysql-test/t/partition_error.test b/mysql-test/t/partition_error.test index d3f10628254..aa26fa29db9 100644 --- a/mysql-test/t/partition_error.test +++ b/mysql-test/t/partition_error.test @@ -10,6 +10,20 @@ drop table if exists t1; let $MYSQLD_DATADIR= `SELECT @@datadir`; +--echo # +--echo # Bug#57924: crash when creating partitioned table with +--echo # multiple columns in the partition key +--echo # +--error ER_FIELD_NOT_FOUND_PART_ERROR +CREATE TABLE t1 (a INT, b INT, PRIMARY KEY (a,b)) +PARTITION BY KEY(a, b, a); +CREATE TABLE t1 (a INT, b INT, PRIMARY KEY (a,b)) +PARTITION BY KEY(A, b); +DROP TABLE t1; +--error ER_FIELD_NOT_FOUND_PART_ERROR +CREATE TABLE t1 (a INT, b INT, PRIMARY KEY (a,b)) +PARTITION BY KEY(a, b, A); + --echo # --echo # Bug#49161: Out of memory; restart server and try again (needed 2 bytes) --echo # diff --git a/sql/sql_partition.cc b/sql/sql_partition.cc index 44ed9e759c6..8cd43a4f60e 100644 --- a/sql/sql_partition.cc +++ b/sql/sql_partition.cc @@ -761,6 +761,9 @@ static bool handle_list_of_fields(List_iterator it, bool result; char *field_name; bool is_list_empty= TRUE; + int fields_handled = 0; + char* field_name_array[MAX_KEY]; + DBUG_ENTER("handle_list_of_fields"); while ((field_name= it++)) @@ -776,6 +779,25 @@ static bool handle_list_of_fields(List_iterator it, result= TRUE; goto end; } + + /* + Check for duplicate fields in the list. + Assuming that there are not many fields in the partition key list. + If there were, it would be better to replace the for-loop + with a more efficient algorithm. + */ + + field_name_array[fields_handled] = field_name; + for (int i = 0; i < fields_handled; ++i) + { + if (my_strcasecmp(system_charset_info, + field_name_array[i], field_name) == 0) + { + my_error(ER_FIELD_NOT_FOUND_PART_ERROR, MYF(0)); + DBUG_RETURN(TRUE); + } + } + fields_handled++; } if (is_list_empty) { From 38c5e2cae8338d8941182dacb988b2aa8027cca4 Mon Sep 17 00:00:00 2001 From: Mattias Jonsson Date: Mon, 10 Jan 2011 23:42:37 +0100 Subject: [PATCH 004/202] Bug#47902: partition_recover_myisam fails with --ps-protocol The problem was that the warnings was never written out when running with --ps-protocol. This was because the warnings only appeared during the prepare phase, not the execute phase. Solved by not clearing the warnings from the prepare phase if there was no other warnings. If there are warnings from the execute phase, it is very likely to be the same as from the prepare phase. My tests show that if not clearing the warnings from the prepare phase when there are warnings from the execute phase, there will be duplicated warnings in the result. client/mysqltest.cc: Only reset the prepare warnings if there are warnings from the execute phase. Otherwise these warnings will never be returned. --- client/mysqltest.cc | 8 ++++++-- 1 file changed, 6 insertions(+), 2 deletions(-) diff --git a/client/mysqltest.cc b/client/mysqltest.cc index a12c56c9657..cdfce036ec7 100644 --- a/client/mysqltest.cc +++ b/client/mysqltest.cc @@ -7241,8 +7241,12 @@ void run_query_stmt(MYSQL *mysql, struct st_command *command, mysql_free_result(res); /* Free normal result set with meta data */ - /* Clear prepare warnings */ - dynstr_set(&ds_prepare_warnings, NULL); + /* + Clear prepare warnings if there are execute warnings, + since they are probably duplicated. + */ + if (ds_execute_warnings.length || mysql->warning_count) + dynstr_set(&ds_prepare_warnings, NULL); } else { From 8645caf79d7e0c5b46fd539b1d29f43e53bc0eac Mon Sep 17 00:00:00 2001 From: Bjorn Munch Date: Tue, 11 Jan 2011 10:51:31 +0100 Subject: [PATCH 005/202] Bug #59002 Please make mtr print correct file and line number when tests fail This patchs adds printing of a file stack (with line numbers) It does not fix the problem of a failure in the non-first iteration of a loop --- client/mysqltest.cc | 27 ++++++++++++++++++--------- 1 file changed, 18 insertions(+), 9 deletions(-) diff --git a/client/mysqltest.cc b/client/mysqltest.cc index a12c56c9657..38f8516f7da 100644 --- a/client/mysqltest.cc +++ b/client/mysqltest.cc @@ -1238,6 +1238,17 @@ static void cleanup_and_exit(int exit_code) exit(exit_code); } +void print_file_stack() +{ + for (struct st_test_file* err_file= cur_file; + err_file != file_stack; + err_file--) + { + fprintf(stderr, "included from %s at line %d:\n", + err_file->file_name, err_file->lineno); + } +} + void die(const char *fmt, ...) { static int dying= 0; @@ -1257,8 +1268,12 @@ void die(const char *fmt, ...) /* Print the error message */ fprintf(stderr, "mysqltest: "); if (cur_file && cur_file != file_stack) - fprintf(stderr, "In included file \"%s\": ", + { + fprintf(stderr, "In included file \"%s\": \n", cur_file->file_name); + print_file_stack(); + } + if (start_lineno > 0) fprintf(stderr, "At line %u: ", start_lineno); if (fmt) @@ -1288,20 +1303,14 @@ void die(const char *fmt, ...) void abort_not_supported_test(const char *fmt, ...) { va_list args; - struct st_test_file* err_file= cur_file; DBUG_ENTER("abort_not_supported_test"); /* Print include filestack */ fprintf(stderr, "The test '%s' is not supported by this installation\n", file_stack->file_name); fprintf(stderr, "Detected in file %s at line %d\n", - err_file->file_name, err_file->lineno); - while (err_file != file_stack) - { - err_file--; - fprintf(stderr, "included from %s at line %d\n", - err_file->file_name, err_file->lineno); - } + cur_file->file_name, cur_file->lineno); + print_file_stack(); /* Print error message */ va_start(args, fmt); From f3bc9f699cb37bbecc24efbb46d2fdba01dcbb42 Mon Sep 17 00:00:00 2001 From: Bjorn Munch Date: Tue, 11 Jan 2011 10:53:22 +0100 Subject: [PATCH 006/202] Bug #58896 MTR should recognise combinations as experimental without needing wildcards Added a pattern match to cover combinations Added to readme file --- mysql-test/collections/README.experimental | 6 +++++- mysql-test/collections/default.experimental | 2 +- mysql-test/lib/mtr_report.pm | 3 ++- 3 files changed, 8 insertions(+), 3 deletions(-) diff --git a/mysql-test/collections/README.experimental b/mysql-test/collections/README.experimental index 2f5ee7b00ab..924e062b76a 100644 --- a/mysql-test/collections/README.experimental +++ b/mysql-test/collections/README.experimental @@ -15,9 +15,13 @@ The syntax is as follows: and any subsequent characters are ignored. 4) The full test case name including the suite and execution mode - must be specified, for example: + may be specified, for example: main.alias 'row' # bug#00000 +4b) Now, combinations will also be covered if only the test name is + specified, for example: + rpl.rpl_ps # Covers 'row', 'mix' and 'stmt' + 5) As an exception to item 4, the last character of the test case specification may be an asterisk (*). In that case, all test cases that start with the same characters up to the last letter before the asterisk diff --git a/mysql-test/collections/default.experimental b/mysql-test/collections/default.experimental index aa2f2e9f724..1e6ff625d39 100644 --- a/mysql-test/collections/default.experimental +++ b/mysql-test/collections/default.experimental @@ -21,7 +21,7 @@ main.outfile_loaddata @solaris # joro : Bug #46895 ndb.* # joro : NDB tests marked as experimental as agreed with bochklin -rpl.rpl_innodb_bug28430* @solaris # Bug#46029 +rpl.rpl_innodb_bug28430 @solaris # Bug#46029 rpl.rpl_row_sp011 @solaris # Joro : Bug #54138 rpl_ndb.* # joro : NDB tests marked as experimental as agreed with bochklin diff --git a/mysql-test/lib/mtr_report.pm b/mysql-test/lib/mtr_report.pm index 77f6920771d..42d93022392 100644 --- a/mysql-test/lib/mtr_report.pm +++ b/mysql-test/lib/mtr_report.pm @@ -129,7 +129,8 @@ sub mtr_report_test ($) { # Find out if this test case is an experimental one, so we can treat # the failure as an expected failure instead of a regression. for my $exp ( @$::experimental_test_cases ) { - if ( $exp ne $test_name ) { + # Include pattern match for combinations + if ( $exp ne $test_name && $test_name !~ /^$exp / ) { # if the expression is not the name of this test case, but has # an asterisk at the end, determine if the characters up to # but excluding the asterisk are the same From 5376a76dea7cd8b15c4b95911a18233fc924d305 Mon Sep 17 00:00:00 2001 From: Bjorn Munch Date: Tue, 11 Jan 2011 10:54:42 +0100 Subject: [PATCH 007/202] Bug #58900 query_get_value crashes when result begins with dollar sign Generalized fix for recursive backtick Optional arg to eval_expr telling it not to interpret --- client/mysqltest.cc | 13 +++++++++---- mysql-test/r/mysqltest.result | 3 +++ mysql-test/t/mysqltest.test | 6 ++++++ 3 files changed, 18 insertions(+), 4 deletions(-) diff --git a/client/mysqltest.cc b/client/mysqltest.cc index 38f8516f7da..feed964c2fa 100644 --- a/client/mysqltest.cc +++ b/client/mysqltest.cc @@ -474,7 +474,7 @@ VAR* var_init(VAR* v, const char *name, int name_len, const char *val, void var_free(void* v); VAR* var_get(const char *var_name, const char** var_name_end, my_bool raw, my_bool ignore_not_existing); -void eval_expr(VAR* v, const char *p, const char** p_end, bool backtick= true); +void eval_expr(VAR* v, const char *p, const char** p_end, bool do_eval= true); my_bool match_delimiter(int c, const char *delim, uint length); void dump_result_to_reject_file(char *buf, int size); void dump_warning_messages(); @@ -2371,7 +2371,7 @@ void var_set_query_get_value(struct st_command *command, VAR *var) break; } } - eval_expr(var, value, 0); + eval_expr(var, value, 0, false); } dynstr_free(&ds_query); mysql_free_result(res); @@ -2401,12 +2401,16 @@ void var_copy(VAR *dest, VAR *src) } -void eval_expr(VAR *v, const char *p, const char **p_end, bool backtick) +void eval_expr(VAR *v, const char *p, const char **p_end, bool do_eval) { DBUG_ENTER("eval_expr"); DBUG_PRINT("enter", ("p: '%s'", p)); + /* Skip to treat as pure string if no evaluation */ + if (! do_eval) + goto NO_EVAL; + if (*p == '$') { VAR *vp; @@ -2426,7 +2430,7 @@ void eval_expr(VAR *v, const char *p, const char **p_end, bool backtick) DBUG_VOID_RETURN; } - if (*p == '`' && backtick) + if (*p == '`') { var_query_set(v, p, p_end); DBUG_VOID_RETURN; @@ -2449,6 +2453,7 @@ void eval_expr(VAR *v, const char *p, const char **p_end, bool backtick) } } + NO_EVAL: { int new_val_len = (p_end && *p_end) ? (int) (*p_end - p) : (int) strlen(p); diff --git a/mysql-test/r/mysqltest.result b/mysql-test/r/mysqltest.result index 15730fff72c..00e4a598539 100644 --- a/mysql-test/r/mysqltest.result +++ b/mysql-test/r/mysqltest.result @@ -311,6 +311,9 @@ failing query in let create table t1 (a varchar(100)); insert into t1 values ('`select 42`'); `select 42` +insert into t1 values ('$dollar'); +$dollar +`select 42` drop table t1; mysqltest: At line 1: Error running query 'failing query': 1064 You have an error in your SQL syntax; check the manual that corresponds to your MySQL server version for the right syntax to use near 'failing query' at line 1 mysqltest: At line 1: Missing required argument 'filename' to command 'source' diff --git a/mysql-test/t/mysqltest.test b/mysql-test/t/mysqltest.test index 56c86f7d431..52dfd8e86d3 100644 --- a/mysql-test/t/mysqltest.test +++ b/mysql-test/t/mysqltest.test @@ -859,6 +859,12 @@ insert into t1 values ('`select 42`'); let $a= `select * from t1`; # This should output `select 42`, not evaluate it again to 42 echo $a; +insert into t1 values ('$dollar'); +# These should also output the string without evaluating it. +let $a= query_get_value(select * from t1 order by a, a, 1); +echo $a; +let $a= query_get_value(select * from t1 order by a, a, 2); +echo $a; drop table t1; --error 1 From e2b73747df97f7a739000671aa2454482b23f1d2 Mon Sep 17 00:00:00 2001 From: Bjorn Munch Date: Tue, 11 Jan 2011 15:00:21 +0100 Subject: [PATCH 008/202] Bug #59002 Please make mtr print correct file and line number when tests fail Followup: had forgotten to update mysqltest.test due to changed output - duh! --- mysql-test/r/mysqltest.result | 34 +++++++++++++++++++++++++++++----- 1 file changed, 29 insertions(+), 5 deletions(-) diff --git a/mysql-test/r/mysqltest.result b/mysql-test/r/mysqltest.result index 00e4a598539..a16b3ec2670 100644 --- a/mysql-test/r/mysqltest.result +++ b/mysql-test/r/mysqltest.result @@ -318,8 +318,26 @@ drop table t1; mysqltest: At line 1: Error running query 'failing query': 1064 You have an error in your SQL syntax; check the manual that corresponds to your MySQL server version for the right syntax to use near 'failing query' at line 1 mysqltest: At line 1: Missing required argument 'filename' to command 'source' mysqltest: At line 1: Could not open './non_existingFile' for reading, errno: 2 -mysqltest: In included file "MYSQLTEST_VARDIR/tmp/recursive.sql": At line 1: Source directives are nesting too deep -mysqltest: In included file "MYSQLTEST_VARDIR/tmp/error.sql": At line 1: query 'garbage ' failed: 1064: You have an error in your SQL syntax; check the manual that corresponds to your MySQL server version for the right syntax to use near 'garbage' at line 1 +mysqltest: In included file "MYSQLTEST_VARDIR/tmp/recursive.sql": +included from MYSQLTEST_VARDIR/tmp/recursive.sql at line 1: +included from MYSQLTEST_VARDIR/tmp/recursive.sql at line 1: +included from MYSQLTEST_VARDIR/tmp/recursive.sql at line 1: +included from MYSQLTEST_VARDIR/tmp/recursive.sql at line 1: +included from MYSQLTEST_VARDIR/tmp/recursive.sql at line 1: +included from MYSQLTEST_VARDIR/tmp/recursive.sql at line 1: +included from MYSQLTEST_VARDIR/tmp/recursive.sql at line 1: +included from MYSQLTEST_VARDIR/tmp/recursive.sql at line 1: +included from MYSQLTEST_VARDIR/tmp/recursive.sql at line 1: +included from MYSQLTEST_VARDIR/tmp/recursive.sql at line 1: +included from MYSQLTEST_VARDIR/tmp/recursive.sql at line 1: +included from MYSQLTEST_VARDIR/tmp/recursive.sql at line 1: +included from MYSQLTEST_VARDIR/tmp/recursive.sql at line 1: +included from MYSQLTEST_VARDIR/tmp/recursive.sql at line 1: +included from MYSQLTEST_VARDIR/tmp/recursive.sql at line 1: +At line 1: Source directives are nesting too deep +mysqltest: In included file "MYSQLTEST_VARDIR/tmp/error.sql": +included from MYSQLTEST_VARDIR/tmp/error.sql at line 1: +At line 1: query 'garbage ' failed: 1064: You have an error in your SQL syntax; check the manual that corresponds to your MySQL server version for the right syntax to use near 'garbage' at line 1 2 = outer loop variable after while here is the sourced script @@ -413,7 +431,9 @@ Beta is true while with string, only once 1 Testing while with not -mysqltest: In included file "MYSQLTEST_VARDIR/tmp/mysqltest_while.inc": At line 64: Nesting too deeply +mysqltest: In included file "MYSQLTEST_VARDIR/tmp/mysqltest_while.inc": +included from MYSQLTEST_VARDIR/tmp/mysqltest_while.inc at line 65: +At line 64: Nesting too deeply mysqltest: At line 1: missing '(' in while mysqltest: At line 1: missing ')' in while mysqltest: At line 1: Missing '{' after while. Found "dec $i" @@ -462,8 +482,12 @@ mysqltest: At line 1: query 'connect con2,localhost,root,,illegal_db' failed: 1 mysqltest: At line 1: Illegal argument for port: 'illegal_port' mysqltest: At line 1: Illegal option to connect: SMTP 200 connects succeeded -mysqltest: In included file "MYSQLTEST_VARDIR/tmp/mysqltest.sql": At line 3: connection 'test_con1' not found in connection pool -mysqltest: In included file "MYSQLTEST_VARDIR/tmp/mysqltest.sql": At line 2: Connection test_con1 already exists +mysqltest: In included file "MYSQLTEST_VARDIR/tmp/mysqltest.sql": +included from MYSQLTEST_VARDIR/tmp/mysqltest.sql at line 3: +At line 3: connection 'test_con1' not found in connection pool +mysqltest: In included file "MYSQLTEST_VARDIR/tmp/mysqltest.sql": +included from MYSQLTEST_VARDIR/tmp/mysqltest.sql at line 2: +At line 2: Connection test_con1 already exists show tables; ERROR 3D000: No database selected connect con1,localhost,root,,; From 634fe860562f7249c55a0f946a1fb50972b9f9ff Mon Sep 17 00:00:00 2001 From: Vasil Dimov Date: Wed, 12 Jan 2011 17:53:05 +0200 Subject: [PATCH 009/202] Suppress InnoDB warning about long semaphore wait if running under Valgrind Sometimes Valgrind could be extremely slow and could trigger the InnoDB diagnostic message making the test to fail. --- mysql-test/suite/innodb/t/innodb_bug56143.test | 5 +++++ mysql-test/suite/innodb_plugin/t/innodb_bug56143.test | 5 +++++ 2 files changed, 10 insertions(+) diff --git a/mysql-test/suite/innodb/t/innodb_bug56143.test b/mysql-test/suite/innodb/t/innodb_bug56143.test index 1218ae6621c..b69d0048ee8 100644 --- a/mysql-test/suite/innodb/t/innodb_bug56143.test +++ b/mysql-test/suite/innodb/t/innodb_bug56143.test @@ -8,6 +8,11 @@ -- disable_query_log -- disable_result_log +if ($VALGRIND_TEST) +{ + call mtr.add_suppression("InnoDB: Warning: a long semaphore wait:"); +} + SET foreign_key_checks=0; DROP TABLE IF EXISTS bug56143; CREATE TABLE `bug56143` ( diff --git a/mysql-test/suite/innodb_plugin/t/innodb_bug56143.test b/mysql-test/suite/innodb_plugin/t/innodb_bug56143.test index 7c7472303db..0f135a44f5d 100644 --- a/mysql-test/suite/innodb_plugin/t/innodb_bug56143.test +++ b/mysql-test/suite/innodb_plugin/t/innodb_bug56143.test @@ -8,6 +8,11 @@ -- disable_query_log -- disable_result_log +if ($VALGRIND_TEST) +{ + call mtr.add_suppression("InnoDB: Warning: a long semaphore wait:"); +} + SET foreign_key_checks=0; DROP TABLE IF EXISTS bug56143_1; From 5e9cb07b66cb3ac8db9daec5f55c736db2a33990 Mon Sep 17 00:00:00 2001 From: Luis Soares Date: Wed, 12 Jan 2011 19:32:45 +0000 Subject: [PATCH 010/202] BUG#59177: mysqlbinlog_row_big fails on Windows with out of memory The test case fails with out of memory while updating a table with several multi-megabytes sized rows. This can probably be too exhausting for PB2 env. The quick fix here is to reduce the size of the biggest row (256MB) so that it becomes a little smaller (64MB). --- mysql-test/r/mysqlbinlog_row_big.result | 8 ++++---- mysql-test/t/mysqlbinlog_row_big.test | 4 ++-- 2 files changed, 6 insertions(+), 6 deletions(-) diff --git a/mysql-test/r/mysqlbinlog_row_big.result b/mysql-test/r/mysqlbinlog_row_big.result index 46fa0dc79cd..0bdbfdcee3a 100644 --- a/mysql-test/r/mysqlbinlog_row_big.result +++ b/mysql-test/r/mysqlbinlog_row_big.result @@ -36,8 +36,8 @@ c1 LONGTEXT # # Insert some big rows. # -256MB -INSERT INTO t1 VALUES (REPEAT('ManyMegaByteBlck', 16777216)); +64MB +INSERT INTO t1 VALUES (REPEAT('ManyMegaByteBlck', 4194304)); affected rows: 1 32MB INSERT INTO t1 VALUES (REPEAT('ManyMegaByteBlck', 2097152)); @@ -53,7 +53,7 @@ affected rows: 1 # Do not display the column value itself, just its length. # SELECT LENGTH(c1) FROM t1; -LENGTH(c1) 268435456 +LENGTH(c1) 67108864 LENGTH(c1) 33554432 LENGTH(c1) 4194304 LENGTH(c1) 524288 @@ -69,7 +69,7 @@ info: Rows matched: 4 Changed: 4 Warnings: 0 # Do not display the column value itself, just its length. # SELECT LENGTH(c1) FROM t1; -LENGTH(c1) 536870912 +LENGTH(c1) 134217728 LENGTH(c1) 1048576 LENGTH(c1) 67108864 LENGTH(c1) 8388608 diff --git a/mysql-test/t/mysqlbinlog_row_big.test b/mysql-test/t/mysqlbinlog_row_big.test index 75f3b90269f..ffd1b79af34 100644 --- a/mysql-test/t/mysqlbinlog_row_big.test +++ b/mysql-test/t/mysqlbinlog_row_big.test @@ -79,8 +79,8 @@ eval CREATE TABLE t1 ( --echo # Insert some big rows. --echo # ---echo 256MB -INSERT INTO t1 VALUES (REPEAT('ManyMegaByteBlck', 16777216)); +--echo 64MB +INSERT INTO t1 VALUES (REPEAT('ManyMegaByteBlck', 4194304)); --echo 32MB INSERT INTO t1 VALUES (REPEAT('ManyMegaByteBlck', 2097152)); From 716b64cdb050ff9a22457990f336ef20a7b3663a Mon Sep 17 00:00:00 2001 From: Martin Hansson Date: Thu, 13 Jan 2011 08:57:15 +0100 Subject: [PATCH 011/202] Bug#58165: "my_empty_string" gets modified and causes LOAD DATA to fail and other crashes Some string manipulating SQL functions use a shared string object intended to contain an immutable empty string. This object was used by the SQL function SUBSTRING_INDEX() to return an empty string when one argument was of the wrong datatype. If the string object was then modified by the sql function INSERT(), undefined behavior ensued. Fixed by instead modifying the string object representing the function's result value whenever string manipulating SQL functions return an empty string. Relevant code has also been documented. --- mysql-test/r/func_str.result | 16 +++++++++++++ mysql-test/t/func_str.test | 11 +++++++++ sql/item_strfunc.cc | 45 ++++++++++++++++++------------------ sql/item_strfunc.h | 10 ++++++++ sql/sql_string.cc | 41 ++++++++++++++++++++++++++++---- sql/sql_string.h | 10 ++++++++ 6 files changed, 107 insertions(+), 26 deletions(-) diff --git a/mysql-test/r/func_str.result b/mysql-test/r/func_str.result index 0321b2d85ad..8f4038e1239 100644 --- a/mysql-test/r/func_str.result +++ b/mysql-test/r/func_str.result @@ -2612,4 +2612,20 @@ CONVERT(('' IN (REVERSE(CAST(('') AS DECIMAL)), '')), CHAR(3)) 1 Warnings: Warning 1292 Truncated incorrect DECIMAL value: '' +# +# Bug#58165: "my_empty_string" gets modified and causes LOAD DATA to fail +# and other crashes +# +CREATE TABLE t1 ( a TEXT ); +SELECT 'aaaaaaaaaaaaaa' INTO OUTFILE 'bug58165.txt'; +SELECT insert( substring_index( 'a', 'a', 'b' ), 1, 0, 'x' ); +insert( substring_index( 'a', 'a', 'b' ), 1, 0, 'x' ) +x +Warnings: +Warning 1292 Truncated incorrect INTEGER value: 'b' +LOAD DATA INFILE 'bug58165.txt' INTO TABLE t1; +SELECT * FROM t1; +a +aaaaaaaaaaaaaa +DROP TABLE t1; End of 5.1 tests diff --git a/mysql-test/t/func_str.test b/mysql-test/t/func_str.test index fdcfbcf519e..92c4bae5327 100644 --- a/mysql-test/t/func_str.test +++ b/mysql-test/t/func_str.test @@ -1369,4 +1369,15 @@ DROP TABLE t1; SELECT '1' IN ('1', SUBSTRING(-9223372036854775809, 1)); SELECT CONVERT(('' IN (REVERSE(CAST(('') AS DECIMAL)), '')), CHAR(3)); +--echo # +--echo # Bug#58165: "my_empty_string" gets modified and causes LOAD DATA to fail +--echo # and other crashes +--echo # +CREATE TABLE t1 ( a TEXT ); +SELECT 'aaaaaaaaaaaaaa' INTO OUTFILE 'bug58165.txt'; +SELECT insert( substring_index( 'a', 'a', 'b' ), 1, 0, 'x' ); +LOAD DATA INFILE 'bug58165.txt' INTO TABLE t1; +SELECT * FROM t1; +DROP TABLE t1; + --echo End of 5.1 tests diff --git a/sql/item_strfunc.cc b/sql/item_strfunc.cc index fd5c47d25cb..204a2dfc663 100644 --- a/sql/item_strfunc.cc +++ b/sql/item_strfunc.cc @@ -39,6 +39,9 @@ C_MODE_START #include "../mysys/my_static.h" // For soundex_map C_MODE_END +/** + @todo Remove this. It is not safe to use a shared String object. + */ String my_empty_string("",default_charset_info); @@ -461,7 +464,7 @@ String *Item_func_des_encrypt::val_str(String *str) if ((null_value= args[0]->null_value)) return 0; // ENCRYPT(NULL) == NULL if ((res_length=res->length()) == 0) - return &my_empty_string; + return make_empty_result(); if (arg_count == 1) { @@ -652,7 +655,7 @@ String *Item_func_concat_ws::val_str(String *str) } if (i == arg_count) - return &my_empty_string; + return make_empty_result(); for (i++; i < arg_count ; i++) { @@ -803,7 +806,7 @@ String *Item_func_reverse::val_str(String *str) return 0; /* An empty string is a special case as the string pointer may be null */ if (!res->length()) - return &my_empty_string; + return make_empty_result(); if (tmp_value.alloced_length() < res->length() && tmp_value.realloc(res->length())) { @@ -1143,8 +1146,7 @@ String *Item_func_left::val_str(String *str) /* if "unsigned_flag" is set, we have a *huge* positive number. */ if ((length <= 0) && (!args[1]->unsigned_flag)) - return &my_empty_string; - + return make_empty_result(); if ((res->length() <= (ulonglong) length) || (res->length() <= (char_pos= res->charpos((int) length)))) return res; @@ -1187,7 +1189,7 @@ String *Item_func_right::val_str(String *str) /* if "unsigned_flag" is set, we have a *huge* positive number. */ if ((length <= 0) && (!args[1]->unsigned_flag)) - return &my_empty_string; /* purecov: inspected */ + return make_empty_result(); /* purecov: inspected */ if (res->length() <= (ulonglong) length) return res; /* purecov: inspected */ @@ -1226,7 +1228,7 @@ String *Item_func_substr::val_str(String *str) /* Negative or zero length, will return empty string. */ if ((arg_count == 3) && (length <= 0) && (length == 0 || !args[2]->unsigned_flag)) - return &my_empty_string; + return make_empty_result(); /* Assumes that the maximum length of a String is < INT_MAX32. */ /* Set here so that rest of code sees out-of-bound value as such. */ @@ -1237,12 +1239,12 @@ String *Item_func_substr::val_str(String *str) /* Assumes that the maximum length of a String is < INT_MAX32. */ if ((!args[1]->unsigned_flag && (start < INT_MIN32 || start > INT_MAX32)) || (args[1]->unsigned_flag && ((ulonglong) start > INT_MAX32))) - return &my_empty_string; + return make_empty_result(); start= ((start < 0) ? res->numchars() + start : start - 1); start= res->charpos((int) start); if ((start < 0) || ((uint) start + 1 > res->length())) - return &my_empty_string; + return make_empty_result(); length= res->charpos((int) length, (uint32) start); tmp_length= res->length() - start; @@ -1305,7 +1307,7 @@ String *Item_func_substr_index::val_str(String *str) null_value=0; uint delimiter_length= delimiter->length(); if (!res->length() || !delimiter_length || !count) - return &my_empty_string; // Wrong parameters + return make_empty_result(); // Wrong parameters res->set_charset(collation.collation); @@ -1654,7 +1656,7 @@ String *Item_func_password::val_str(String *str) if ((null_value=args[0]->null_value)) return 0; if (res->length() == 0) - return &my_empty_string; + return make_empty_result(); my_make_scrambled_password(tmp_value, res->ptr(), res->length()); str->set(tmp_value, SCRAMBLED_PASSWORD_CHAR_LENGTH, res->charset()); return str; @@ -1678,7 +1680,7 @@ String *Item_func_old_password::val_str(String *str) if ((null_value=args[0]->null_value)) return 0; if (res->length() == 0) - return &my_empty_string; + return make_empty_result(); my_make_scrambled_password_323(tmp_value, res->ptr(), res->length()); str->set(tmp_value, SCRAMBLED_PASSWORD_CHAR_LENGTH_323, res->charset()); return str; @@ -1706,8 +1708,7 @@ String *Item_func_encrypt::val_str(String *str) if ((null_value=args[0]->null_value)) return 0; if (res->length() == 0) - return &my_empty_string; - + return make_empty_result(); if (arg_count == 1) { // generate random salt time_t timestamp=current_thd->query_start(); @@ -1967,7 +1968,7 @@ String *Item_func_soundex::val_str(String *str) for ( ; ; ) /* Skip pre-space */ { if ((rc= cs->cset->mb_wc(cs, &wc, (uchar*) from, (uchar*) end)) <= 0) - return &my_empty_string; /* EOL or invalid byte sequence */ + return make_empty_result(); /* EOL or invalid byte sequence */ if (rc == 1 && cs->ctype) { @@ -1992,7 +1993,7 @@ String *Item_func_soundex::val_str(String *str) { /* Extra safety - should not really happen */ DBUG_ASSERT(false); - return &my_empty_string; + return make_empty_result(); } to+= rc; break; @@ -2289,7 +2290,7 @@ String *Item_func_make_set::val_str(String *str) else { if (tmp_str.copy(*res)) // Don't use 'str' - return &my_empty_string; + return make_empty_result(); result= &tmp_str; } } @@ -2299,11 +2300,11 @@ String *Item_func_make_set::val_str(String *str) { // Copy data to tmp_str if (tmp_str.alloc(result->length()+res->length()+1) || tmp_str.copy(*result)) - return &my_empty_string; + return make_empty_result(); result= &tmp_str; } if (tmp_str.append(STRING_WITH_LEN(","), &my_charset_bin) || tmp_str.append(*res)) - return &my_empty_string; + return make_empty_result(); } } } @@ -2442,7 +2443,7 @@ String *Item_func_repeat::val_str(String *str) null_value= 0; if (count <= 0 && (count == 0 || !args[1]->unsigned_flag)) - return &my_empty_string; + return make_empty_result(); /* Assumes that the maximum length of a String is < INT_MAX32. */ /* Bounds check on count: If this is triggered, we will error. */ @@ -2750,7 +2751,7 @@ String *Item_func_conv::val_str(String *str) ptr= longlong2str(dec, ans, to_base); if (str->copy(ans, (uint32) (ptr-ans), default_charset())) - return &my_empty_string; + return make_empty_result(); return str; } @@ -2917,7 +2918,7 @@ String *Item_func_hex::val_str(String *str) return 0; ptr= longlong2str(dec,ans,16); if (str->copy(ans,(uint32) (ptr-ans),default_charset())) - return &my_empty_string; // End of memory + return make_empty_result(); // End of memory return str; } diff --git a/sql/item_strfunc.h b/sql/item_strfunc.h index ab2bf006032..6645a4c637a 100644 --- a/sql/item_strfunc.h +++ b/sql/item_strfunc.h @@ -22,6 +22,16 @@ class Item_str_func :public Item_func { +protected: + /** + Sets the result value of the function an empty string, using the current + character set. No memory is allocated. + @retval A pointer to the str_value member. + */ + String *make_empty_result() { + str_value.set("", 0, collation.collation); + return &str_value; + } public: Item_str_func() :Item_func() { decimals=NOT_FIXED_DEC; } Item_str_func(Item *a) :Item_func(a) {decimals=NOT_FIXED_DEC; } diff --git a/sql/sql_string.cc b/sql/sql_string.cc index a41f4d52101..4f76943bde7 100644 --- a/sql/sql_string.cc +++ b/sql/sql_string.cc @@ -58,11 +58,33 @@ bool String::real_alloc(uint32 arg_length) } -/* -** Check that string is big enough. Set string[alloc_length] to 0 -** (for C functions) -*/ +/** + Allocates a new buffer on the heap for this String. + - If the String's internal buffer is privately owned and heap allocated, + one of the following is performed. + + - If the requested length is greater than what fits in the buffer, a new + buffer is allocated, data moved and the old buffer freed. + + - If the requested length is less or equal to what fits in the buffer, a + null character is inserted at the appropriate position. + + - If the String does not keep a private buffer on the heap, such a buffer + will be allocated and the string copied accoring to its length, as found + in String::length(). + + For C compatibility, the new string buffer is null terminated. + + @param alloc_length The requested string size in characters, excluding any + null terminator. + + @retval false Either the copy operation is complete or, if the size of the + new buffer is smaller than the currently allocated buffer (if one exists), + no allocation occured. + + @retval true An error occured when attempting to allocate memory. +*/ bool String::realloc(uint32 alloc_length) { uint32 len=ALIGN_SIZE(alloc_length+1); @@ -196,6 +218,17 @@ bool String::copy() return FALSE; } +/** + Copies the internal buffer from str. If this String has a private heap + allocated buffer where new data does not fit, a new buffer is allocated + before copying and the old buffer freed. Character set information is also + copied. + + @param str The string whose internal buffer is to be copied. + + @retval false Success. + @retval true Memory allocation failed. +*/ bool String::copy(const String &str) { if (alloc(str.str_length)) diff --git a/sql/sql_string.h b/sql/sql_string.h index b15179bcbe5..092e194646f 100644 --- a/sql/sql_string.h +++ b/sql/sql_string.h @@ -136,6 +136,16 @@ public: Alloced_length=0; str_charset=str.str_charset; } + + + /** + Points the internal buffer to the supplied one. The old buffer is freed. + @param str Pointer to the new buffer. + @param arg_length Length of the new buffer in characters, excluding any + null character. + @param cs Character set to use for interpreting string data. + @note The new buffer will not be null terminated. + */ inline void set(char *str,uint32 arg_length, CHARSET_INFO *cs) { free(); From f949ac55f73c32dbbfc90e24cdcfdec0058d6234 Mon Sep 17 00:00:00 2001 From: Georgi Kodinov Date: Thu, 13 Jan 2011 10:57:19 +0200 Subject: [PATCH 012/202] bumped up the version to 5.0.93 --- configure.in | 4 ++-- 1 file changed, 2 insertions(+), 2 deletions(-) diff --git a/configure.in b/configure.in index 21386494bda..fda56554879 100644 --- a/configure.in +++ b/configure.in @@ -7,7 +7,7 @@ AC_INIT(sql/mysqld.cc) AC_CANONICAL_SYSTEM # The Docs Makefile.am parses this line! # remember to also change ndb version below and update version.c in ndb -AM_INIT_AUTOMAKE(mysql, 5.0.92) +AM_INIT_AUTOMAKE(mysql, 5.0.93) AM_CONFIG_HEADER([include/config.h:config.h.in]) PROTOCOL_VERSION=10 @@ -23,7 +23,7 @@ NDB_SHARED_LIB_VERSION=$NDB_SHARED_LIB_MAJOR_VERSION:0:0 # ndb version NDB_VERSION_MAJOR=5 NDB_VERSION_MINOR=0 -NDB_VERSION_BUILD=92 +NDB_VERSION_BUILD=93 NDB_VERSION_STATUS="" # Set all version vars based on $VERSION. How do we do this more elegant ? From b7635ee9dccaf38e20934a51aab1f25e61bdb68b Mon Sep 17 00:00:00 2001 From: unknown Date: Thu, 13 Jan 2011 10:00:03 +0100 Subject: [PATCH 013/202] Raise version number after cloning 5.0.92 --- configure.in | 4 ++-- 1 file changed, 2 insertions(+), 2 deletions(-) diff --git a/configure.in b/configure.in index 21386494bda..fda56554879 100644 --- a/configure.in +++ b/configure.in @@ -7,7 +7,7 @@ AC_INIT(sql/mysqld.cc) AC_CANONICAL_SYSTEM # The Docs Makefile.am parses this line! # remember to also change ndb version below and update version.c in ndb -AM_INIT_AUTOMAKE(mysql, 5.0.92) +AM_INIT_AUTOMAKE(mysql, 5.0.93) AM_CONFIG_HEADER([include/config.h:config.h.in]) PROTOCOL_VERSION=10 @@ -23,7 +23,7 @@ NDB_SHARED_LIB_VERSION=$NDB_SHARED_LIB_MAJOR_VERSION:0:0 # ndb version NDB_VERSION_MAJOR=5 NDB_VERSION_MINOR=0 -NDB_VERSION_BUILD=92 +NDB_VERSION_BUILD=93 NDB_VERSION_STATUS="" # Set all version vars based on $VERSION. How do we do this more elegant ? From db36f63984154a223d5eeeeb51e9a1db4c2fb937 Mon Sep 17 00:00:00 2001 From: Nirbhay Choubey Date: Thu, 13 Jan 2011 15:56:42 +0530 Subject: [PATCH 014/202] Bug#59109 : mysqlslap crashes on mysql_fetch_row after ignoring null from mysql_store_result. mysqlslap segfaults at a point when it tries to fetch rows from the result set. Under some circumstances, mysql_store_result can return 'NULL', even after query execution (mysql_query) succeeds, and eventually a segfault might occur if same unchecked return value is passed to mysql_fetch_row. Fixed by adding a check on mysql_store_result's return value. client/mysqlslap.c: Bug#59109 : mysqlslap crashes on mysql_fetch_row after ignoring null from mysql_store_result. Added a check on mysql_store_result's return value. A 'NULL' return value here shows an erroneous situation as mysql_field_count has already reported a non-zero value. --- client/mysqlslap.c | 20 +++++++++++++++----- 1 file changed, 15 insertions(+), 5 deletions(-) diff --git a/client/mysqlslap.c b/client/mysqlslap.c index b1eafe0082c..3b5c14dd74b 100644 --- a/client/mysqlslap.c +++ b/client/mysqlslap.c @@ -1519,7 +1519,12 @@ generate_primary_key_list(MYSQL *mysql, option_string *engine_stmt) exit(1); } - result= mysql_store_result(mysql); + if (!(result= mysql_store_result(mysql))) + { + fprintf(stderr, "%s: Error when storing result: %d %s\n", + my_progname, mysql_errno(mysql), mysql_error(mysql)); + exit(1); + } primary_keys_number_of= mysql_num_rows(result); /* So why check this? Blackhole :) */ @@ -1891,10 +1896,15 @@ limit_not_met: { if (mysql_field_count(mysql)) { - result= mysql_store_result(mysql); - while ((row = mysql_fetch_row(result))) - counter++; - mysql_free_result(result); + if (!(result= mysql_store_result(mysql))) + fprintf(stderr, "%s: Error when storing result: %d %s\n", + my_progname, mysql_errno(mysql), mysql_error(mysql)); + else + { + while ((row= mysql_fetch_row(result))) + counter++; + mysql_free_result(result); + } } } while(mysql_next_result(mysql) == 0); queries++; From 4f14e2f71cd23d12591beb6feb2b571d8a1a7ff9 Mon Sep 17 00:00:00 2001 From: Karen Langford Date: Thu, 13 Jan 2011 14:58:22 +0100 Subject: [PATCH 015/202] Raise version number after cloning 5.1.55 --- configure.in | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) diff --git a/configure.in b/configure.in index 7a35e8587d4..3849c362eec 100644 --- a/configure.in +++ b/configure.in @@ -12,7 +12,7 @@ dnl dnl When changing the major version number please also check the switch dnl statement in mysqlbinlog::check_master_version(). You may also need dnl to update version.c in ndb. -AC_INIT([MySQL Server], [5.1.55], [], [mysql]) +AC_INIT([MySQL Server], [5.1.56], [], [mysql]) AC_CONFIG_SRCDIR([sql/mysqld.cc]) AC_CANONICAL_SYSTEM From faafae781adc87d80dc0e7c5e631996ed015f8ed Mon Sep 17 00:00:00 2001 From: Sven Sandberg Date: Fri, 14 Jan 2011 11:33:12 +0100 Subject: [PATCH 016/202] BUG#59063: rpl_migration_crash_safe fails on Windows Backported the fix to 5.1. Problem: the auxiliary test files rpl_start_server.inc and rpl_stop_server.inc write a file that is later read by mtr. The bug was that the file was written with platform-dependent newline terminators, i.e., \r\n on windows, whereas mtr only understands \n. Fix: write the file so that it uses \n on all platforms. mysql-test/include/rpl_start_server.inc: Force test to use \n instead of platform-dependent newline terminator. mysql-test/include/rpl_stop_server.inc: Force test to use \n instead of platform-dependent newline terminator. --- mysql-test/include/rpl_start_server.inc | 10 +++++++++- mysql-test/include/rpl_stop_server.inc | 4 +++- 2 files changed, 12 insertions(+), 2 deletions(-) diff --git a/mysql-test/include/rpl_start_server.inc b/mysql-test/include/rpl_start_server.inc index c59c7759910..ac8106f141c 100644 --- a/mysql-test/include/rpl_start_server.inc +++ b/mysql-test/include/rpl_start_server.inc @@ -45,7 +45,15 @@ if ($rpl_server_parameters) --source include/rpl_connection.inc # Write file to make mysql-test-run.pl start up the server again ---exec echo "$_rpl_start_server_command" > $MYSQLTEST_VARDIR/tmp/mysqld.$rpl_server_number.expect +--let WRITE_TO_FILE= $MYSQLTEST_VARDIR/tmp/mysqld.$rpl_server_number.expect +--let WRITE_TO_VAR= $_rpl_start_server_command +perl; +my $file= $ENV{'WRITE_TO_FILE'}; +my $var= $ENV{'WRITE_TO_VAR'}; +open WRITE_FILE, ">> $file" or die "Error opening $file: $!"; +print WRITE_FILE $var, "\n" or die "Error appending to $file: $!"; +close WRITE_FILE or die "Error closing $file: $!"; +EOF --source include/rpl_reconnect.inc diff --git a/mysql-test/include/rpl_stop_server.inc b/mysql-test/include/rpl_stop_server.inc index e1f8839dd69..a90981d6de8 100644 --- a/mysql-test/include/rpl_stop_server.inc +++ b/mysql-test/include/rpl_stop_server.inc @@ -44,7 +44,9 @@ if ($rpl_debug) # Write file to make mysql-test-run.pl expect the "crash", but don't start # it until it's told to ---exec echo "wait" > $MYSQLTEST_VARDIR/tmp/mysqld.$rpl_server_number.expect +--append_file $MYSQLTEST_VARDIR/tmp/mysqld.$rpl_server_number.expect +wait +EOF # Send shutdown to the connected server and give # it 10 seconds to die before zapping it From eb85bdfa6d9537f5adea1f6bd048d4ff1b7d2a94 Mon Sep 17 00:00:00 2001 From: "John H. Embretsen" Date: Fri, 14 Jan 2011 14:50:39 +0100 Subject: [PATCH 017/202] Bug#56895 part 1 of 2: Backport of revid holyfoot@mysql.com-20100823084827-js10vjuil88je35r from mysql-5.5. The purpose is to make MTR logic for mysqlhotcopy the same in 5.1 as in 5.5, making it easier to maintain and fix bugs such as 56817. --- mysql-test/include/mysqlhotcopy.inc | 2 +- mysql-test/mysql-test-run.pl | 5 ++++- 2 files changed, 5 insertions(+), 2 deletions(-) diff --git a/mysql-test/include/mysqlhotcopy.inc b/mysql-test/include/mysqlhotcopy.inc index b3fd5e47179..91e0eff1e0f 100644 --- a/mysql-test/include/mysqlhotcopy.inc +++ b/mysql-test/include/mysqlhotcopy.inc @@ -5,7 +5,7 @@ --source include/not_windows.inc --source include/not_embedded.inc -if ($MYSQLHOTCOPY) +if (!$MYSQLHOTCOPY) { die due to missing mysqlhotcopy tool; } diff --git a/mysql-test/mysql-test-run.pl b/mysql-test/mysql-test-run.pl index e10c1116f2c..d9dd9d48299 100755 --- a/mysql-test/mysql-test-run.pl +++ b/mysql-test/mysql-test-run.pl @@ -2145,7 +2145,10 @@ sub environment_setup { mtr_pl_maybe_exists("$basedir/scripts/mysqlhotcopy"); # Since mysqltest interprets the real path as "false" in an if, # use 1 ("true") to indicate "not exists" so it can be tested for - $ENV{'MYSQLHOTCOPY'}= $mysqlhotcopy || 1; + if ($mysqlhotcopy) + { + $ENV{'MYSQLHOTCOPY'}= $mysqlhotcopy; + } # ---------------------------------------------------- # perror From ab2d29ec6b84eb4531d2d63887ac29f7d9617e60 Mon Sep 17 00:00:00 2001 From: Nirbhay Choubey Date: Fri, 14 Jan 2011 19:50:34 +0530 Subject: [PATCH 018/202] Bug#13618 : mysqldump --xml omits comment on table field When mysqldump tries to dump information in xml format, the result does not contain field level comments. In order to retrieve various informations for a field/column, mysqldump currently uses 'show fields from ' statement. The attributes returned by the statement lacks the information regarding field comments. Fixed by changing the query to one that probes I_S to retrieve required field informations, including the field comment. client/mysqldump.c: Bug#13618 : mysqldump --xml omits comment on table field. Replaced the 'show fields' command by a statement that queries I_S, in order to retrieve information on all the attributes that 'show fields' returns along-with an additional column_comment information. mysql-test/r/client_xml.result: Result modifications for bug#13618. mysql-test/r/mysqldump.result: Result modifications for bug#13618. mysql-test/t/mysqldump.test: Added a testcase for bug#13618. --- client/mysqldump.c | 13 ++++++++++-- mysql-test/r/client_xml.result | 6 +++--- mysql-test/r/mysqldump.result | 37 ++++++++++++++++++++++++---------- mysql-test/t/mysqldump.test | 9 +++++++++ 4 files changed, 49 insertions(+), 16 deletions(-) diff --git a/client/mysqldump.c b/client/mysqldump.c index e35672c2a2c..57e3f5b0349 100644 --- a/client/mysqldump.c +++ b/client/mysqldump.c @@ -2247,6 +2247,15 @@ static uint get_table_structure(char *table, char *db, char *table_type, const char *insert_option; char name_buff[NAME_LEN+3],table_buff[NAME_LEN*2+3]; char table_buff2[NAME_LEN*2+3], query_buff[QUERY_LENGTH]; + const char *show_fields_stmt= "SELECT `COLUMN_NAME` AS `Field`, " + "`COLUMN_TYPE` AS `Type`, " + "`IS_NULLABLE` AS `Null`, " + "`COLUMN_KEY` AS `Key`, " + "`COLUMN_DEFAULT` AS `Default`, " + "`EXTRA` AS `Extra`, " + "`COLUMN_COMMENT` AS `Comment` " + "FROM `INFORMATION_SCHEMA`.`COLUMNS` WHERE " + "TABLE_SCHEMA = '%s' AND TABLE_NAME = '%s'"; FILE *sql_file= md_result_file; int len; MYSQL_RES *result; @@ -2514,8 +2523,8 @@ static uint get_table_structure(char *table, char *db, char *table_type, verbose_msg("%s: Warning: Can't set SQL_QUOTE_SHOW_CREATE option (%s)\n", my_progname, mysql_error(mysql)); - my_snprintf(query_buff, sizeof(query_buff), "show fields from %s", - result_table); + my_snprintf(query_buff, sizeof(query_buff), show_fields_stmt, db, table); + if (mysql_query_with_error_report(mysql, &result, query_buff)) DBUG_RETURN(0); diff --git a/mysql-test/r/client_xml.result b/mysql-test/r/client_xml.result index aa4bdb2bd61..7f74a092af7 100644 --- a/mysql-test/r/client_xml.result +++ b/mysql-test/r/client_xml.result @@ -21,9 +21,9 @@ insert into t1 values (1, 2, 'a&b ab'); - - - + + + diff --git a/mysql-test/r/mysqldump.result b/mysql-test/r/mysqldump.result index d26eaac7a93..289e7f66406 100644 --- a/mysql-test/r/mysqldump.result +++ b/mysql-test/r/mysqldump.result @@ -14,7 +14,7 @@ INSERT INTO t1 VALUES (1), (2); - + @@ -150,9 +150,9 @@ INSERT INTO t1 VALUES (1, "test", "tes"), (2, "TEST", "TES"); - - - + + + @@ -178,7 +178,7 @@ INSERT INTO t1 VALUES ("1\""), ("\"2"); - + @@ -1612,10 +1612,10 @@ CREATE TABLE `t2` ( - + - + @@ -1623,10 +1623,10 @@ CREATE TABLE `t2` ( - + - + @@ -3644,8 +3644,8 @@ INSERT INTO t1 VALUES(1,0xff00fef0); - - + + @@ -4576,5 +4576,20 @@ LENGTH(a) 800 DROP TABLE t1, t2; # +# Bug #13618 : mysqldump --xml ommit comment on table field +# +CREATE TABLE `comment_table` (i INT COMMENT 'FIELD COMMENT') COMMENT = 'TABLE COMMENT'; + + + + + + + + + + +DROP TABLE `comment_table`; +# # End of 5.1 tests # diff --git a/mysql-test/t/mysqldump.test b/mysql-test/t/mysqldump.test index 9246d488dd8..fe0b05dbb42 100644 --- a/mysql-test/t/mysqldump.test +++ b/mysql-test/t/mysqldump.test @@ -2164,6 +2164,15 @@ SELECT LENGTH(a) FROM t2; DROP TABLE t1, t2; ########################################################################### + +--echo # +--echo # Bug #13618 : mysqldump --xml ommit comment on table field +--echo # + +CREATE TABLE `comment_table` (i INT COMMENT 'FIELD COMMENT') COMMENT = 'TABLE COMMENT'; +--exec $MYSQL_DUMP --compact --skip-create --xml test +DROP TABLE `comment_table`; + --echo # --echo # End of 5.1 tests --echo # From 29484d7a66767251666becb7bfc4cf8cead7756f Mon Sep 17 00:00:00 2001 From: "John H. Embretsen" Date: Fri, 14 Jan 2011 17:01:13 +0100 Subject: [PATCH 019/202] Bug#56895 part 2 of 2: Backport of revid holyfoot@mysql.com-20100825135522-8wrjjmvh2u2t0qo6 from mysql-5.5. Without this patch mysqlhotcopy tests would fail due to not finding the mysqlhotcopy tool in release-like builds. With this patch the tests would either pass, or fail due to missing Perl modules (see 56817). Text conflict in mysql-test/mysql-test-run.pl: - resolved by using logic from 5.5 to find mysqlhotcopy, the intention of this backport. Changed bindir to basedir. --- mysql-test/mysql-test-run.pl | 5 ++--- 1 file changed, 2 insertions(+), 3 deletions(-) diff --git a/mysql-test/mysql-test-run.pl b/mysql-test/mysql-test-run.pl index d9dd9d48299..a8a05ee730d 100755 --- a/mysql-test/mysql-test-run.pl +++ b/mysql-test/mysql-test-run.pl @@ -2142,9 +2142,8 @@ sub environment_setup { # mysqlhotcopy # ---------------------------------------------------- my $mysqlhotcopy= - mtr_pl_maybe_exists("$basedir/scripts/mysqlhotcopy"); - # Since mysqltest interprets the real path as "false" in an if, - # use 1 ("true") to indicate "not exists" so it can be tested for + mtr_pl_maybe_exists("$basedir/scripts/mysqlhotcopy") || + mtr_pl_maybe_exists("$path_client_bindir/mysqlhotcopy"); if ($mysqlhotcopy) { $ENV{'MYSQLHOTCOPY'}= $mysqlhotcopy; From 9cd4d4984025857782e12e53d32cea5e4b7684e5 Mon Sep 17 00:00:00 2001 From: Jimmy Yang Date: Fri, 14 Jan 2011 09:02:28 -0800 Subject: [PATCH 020/202] Fix Bug#30423 "InnoDBs treatment of NULL in index stats causes bad "rows examined" estimates". This change implements "innodb_stats_method" with options of "nulls_equal", "nulls_unequal" and "null_ignored". rb://553 approved by Marko --- .../suite/innodb/r/innodb_bug30423.result | 95 ++++++++ .../suite/innodb/t/innodb_bug30423.test | 211 ++++++++++++++++++ .../innodb_plugin/r/innodb_bug30423.result | 95 ++++++++ .../innodb_plugin/t/innodb_bug30423.test | 211 ++++++++++++++++++ storage/innobase/btr/btr0cur.c | 146 +++++++++--- storage/innobase/dict/dict0dict.c | 10 + storage/innobase/handler/ha_innodb.cc | 95 +++++++- storage/innobase/include/btr0cur.h | 5 +- storage/innobase/include/dict0mem.h | 6 + storage/innobase/include/rem0cmp.h | 4 + storage/innobase/include/rem0cmp.ic | 2 +- storage/innobase/include/srv0srv.h | 18 ++ storage/innobase/rem/rem0cmp.c | 14 +- storage/innobase/srv/srv0srv.c | 5 + storage/innodb_plugin/ChangeLog | 8 + storage/innodb_plugin/btr/btr0cur.c | 150 ++++++++++--- storage/innodb_plugin/dict/dict0dict.c | 10 + storage/innodb_plugin/handler/ha_innodb.cc | 95 +++++++- storage/innodb_plugin/include/btr0cur.h | 5 +- storage/innodb_plugin/include/dict0mem.h | 6 + storage/innodb_plugin/include/rem0cmp.h | 4 + storage/innodb_plugin/include/rem0cmp.ic | 2 +- storage/innodb_plugin/include/srv0srv.h | 18 ++ storage/innodb_plugin/rem/rem0cmp.c | 14 +- storage/innodb_plugin/srv/srv0srv.c | 5 + 25 files changed, 1157 insertions(+), 77 deletions(-) create mode 100644 mysql-test/suite/innodb/r/innodb_bug30423.result create mode 100644 mysql-test/suite/innodb/t/innodb_bug30423.test create mode 100644 mysql-test/suite/innodb_plugin/r/innodb_bug30423.result create mode 100644 mysql-test/suite/innodb_plugin/t/innodb_bug30423.test diff --git a/mysql-test/suite/innodb/r/innodb_bug30423.result b/mysql-test/suite/innodb/r/innodb_bug30423.result new file mode 100644 index 00000000000..a19809366ae --- /dev/null +++ b/mysql-test/suite/innodb/r/innodb_bug30423.result @@ -0,0 +1,95 @@ +set global innodb_stats_method = default; +select @@innodb_stats_method; +@@innodb_stats_method +nulls_equal +select count(*) from bug30243_3 where org_id is not NULL; +count(*) +20 +select count(*) from bug30243_3 where org_id is NULL; +count(*) +16384 +select count(*) from bug30243_2 where org_id is not NULL; +count(*) +224 +select count(*) from bug30243_2 where org_id is NULL; +count(*) +65536 +select @@innodb_stats_method; +@@innodb_stats_method +nulls_equal +analyze table bug30243_1; +Table Op Msg_type Msg_text +test.bug30243_1 analyze status OK +analyze table bug30243_2; +Table Op Msg_type Msg_text +test.bug30243_2 analyze status OK +analyze table bug30243_3; +Table Op Msg_type Msg_text +test.bug30243_3 analyze status OK +set global innodb_stats_method = "NULL"; +ERROR 42000: Variable 'stats_method' can't be set to the value of 'NULL' +set global innodb_stats_method = "nulls_ignored"; +select @@innodb_stats_method; +@@innodb_stats_method +nulls_ignored +analyze table bug30243_1; +Table Op Msg_type Msg_text +test.bug30243_1 analyze status OK +analyze table bug30243_2; +Table Op Msg_type Msg_text +test.bug30243_2 analyze status OK +analyze table bug30243_3; +Table Op Msg_type Msg_text +test.bug30243_3 analyze status OK +explain SELECT COUNT(*), 0 +FROM bug30243_1 orgs +LEFT JOIN bug30243_3 sa_opportunities +ON orgs.org_id=sa_opportunities.org_id +LEFT JOIN bug30243_2 contacts +ON orgs.org_id=contacts.org_id ; +id select_type table type possible_keys key key_len ref rows Extra +1 SIMPLE orgs index NULL org_id 4 NULL 128 Using index +1 SIMPLE sa_opportunities ref org_id org_id 5 test.orgs.org_id 1 Using index +1 SIMPLE contacts ref contacts$org_id contacts$org_id 5 test.orgs.org_id 1 Using index +select @@innodb_stats_method; +@@innodb_stats_method +nulls_ignored +set global innodb_stats_method = "nulls_unequal"; +select @@innodb_stats_method; +@@innodb_stats_method +nulls_unequal +analyze table bug30243_1; +Table Op Msg_type Msg_text +test.bug30243_1 analyze status OK +analyze table bug30243_2; +Table Op Msg_type Msg_text +test.bug30243_2 analyze status OK +analyze table bug30243_3; +Table Op Msg_type Msg_text +test.bug30243_3 analyze status OK +explain SELECT COUNT(*), 0 +FROM bug30243_1 orgs +LEFT JOIN bug30243_3 sa_opportunities +ON orgs.org_id=sa_opportunities.org_id +LEFT JOIN bug30243_2 contacts +ON orgs.org_id=contacts.org_id; +id select_type table type possible_keys key key_len ref rows Extra +1 SIMPLE orgs index NULL org_id 4 NULL 128 Using index +1 SIMPLE sa_opportunities ref org_id org_id 5 test.orgs.org_id 1 Using index +1 SIMPLE contacts ref contacts$org_id contacts$org_id 5 test.orgs.org_id 1 Using index +SELECT COUNT(*) FROM table_bug30423 WHERE org_id IS NULL; +COUNT(*) +1024 +set global innodb_stats_method = "nulls_unequal"; +analyze table table_bug30423; +Table Op Msg_type Msg_text +test.table_bug30423 analyze status OK +set global innodb_stats_method = "nulls_ignored"; +analyze table table_bug30423; +Table Op Msg_type Msg_text +test.table_bug30423 analyze status OK +set global innodb_stats_method = nulls_equal; +drop table bug30243_2; +drop table bug30243_1; +drop table bug30243_3; +drop table table_bug30423; diff --git a/mysql-test/suite/innodb/t/innodb_bug30423.test b/mysql-test/suite/innodb/t/innodb_bug30423.test new file mode 100644 index 00000000000..f2a3ee8d099 --- /dev/null +++ b/mysql-test/suite/innodb/t/innodb_bug30423.test @@ -0,0 +1,211 @@ +# Test for Bug #30423, InnoDBs treatment of NULL in index stats causes +# bad "rows examined" estimates. +# Implemented InnoDB system variable "innodb_stats_method" with +# "nulls_equal" (default), "nulls_unequal", and "nulls_ignored" options. + +-- source include/have_innodb.inc + +let $innodb_stats_method_orig = `select @@innodb_stats_method`; + +# default setting for innodb_stats_method is "nulls_equal" +set global innodb_stats_method = default; + +select @@innodb_stats_method; + +# create three tables, bug30243_1, bug30243_2 and bug30243_3. +# The test scenario is adopted from original bug #30423 report. +# table bug30243_1 and bug30243_3 have many NULL values + +-- disable_result_log +-- disable_query_log + +DROP TABLE IF EXISTS bug30243_1; +CREATE TABLE bug30243_1 ( + org_id int(11) NOT NULL default '0', + UNIQUE KEY (org_id) +) ENGINE=InnoDB DEFAULT CHARSET=latin1; + +LOCK TABLES bug30243_1 WRITE; +INSERT INTO bug30243_1 VALUES (11),(15),(16),(17),(19),(20),(21),(23),(24), +(25),(26),(27),(28),(29),(30),(31),(32),(33),(34),(35),(37),(38),(40),(41), +(42),(43),(44),(45),(46),(47),(48),(49),(50),(51),(52),(53),(54),(55),(56), +(57),(58),(59),(60),(61),(62),(63),(64),(65),(66),(67),(68),(69),(70),(71), +(72),(73),(74),(75),(76),(77),(78),(79),(80),(81),(82),(83),(84),(85),(86), +(87),(88),(89),(90),(91),(92),(93),(94),(95),(96),(97),(98),(99),(100),(101), +(102),(103),(104),(105),(106),(107),(108),(109),(110),(111),(112),(113),(114), +(115),(116),(117),(118),(119),(120),(121),(122),(123),(124),(125),(126),(127), +(128),(129),(130),(131),(132),(133),(134),(135),(136),(137),(138),(139),(140), +(141),(142),(143),(144),(145); +UNLOCK TABLES; + +DROP TABLE IF EXISTS bug30243_3; +CREATE TABLE bug30243_3 ( + org_id int(11) default NULL, + KEY (org_id) +) ENGINE=InnoDB DEFAULT CHARSET=latin1; + +INSERT INTO bug30243_3 VALUES (NULL); + +begin; +let $i=14; +while ($i) +{ + INSERT INTO bug30243_3 SELECT NULL FROM bug30243_3; + dec $i; +} + +INSERT INTO bug30243_3 VALUES (34),(34),(35),(56),(58),(62),(62),(64),(65),(66),(80),(135),(137),(138),(139),(140),(142),(143),(144),(145); +commit; + +DROP TABLE IF EXISTS bug30243_2; +CREATE TABLE bug30243_2 ( + org_id int(11) default NULL, + KEY `contacts$org_id` (org_id) +) ENGINE=InnoDB DEFAULT CHARSET=latin1; + +INSERT INTO bug30243_2 VALUES (NULL); + +begin; +let $i=16; +while ($i) +{ + INSERT INTO bug30243_2 SELECT NULL FROM bug30243_2; + dec $i; +} + +INSERT INTO bug30243_2 VALUES (11),(15),(16),(17),(20),(21),(23),(24),(25), +(26),(27),(28),(29),(30),(31),(32),(33),(34),(37),(38),(40),(41),(42),(43), +(44),(45),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46), +(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46), +(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46), +(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46), +(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46), +(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(48), +(48),(50),(51),(52),(52),(53),(54),(55),(57),(60),(61),(62),(62),(62),(62), +(62),(63),(64),(64),(65),(66),(66),(67),(68),(69),(70),(71),(72),(73),(74), +(75),(76),(77),(78),(79),(80),(80),(81),(82),(83),(84),(85),(86),(87),(88), +(89),(90),(91),(92),(93),(94),(95),(96),(97),(98),(99),(100),(101),(102), +(103),(104),(105),(106),(107),(108),(109),(110),(111),(112),(113),(114), +(115),(116),(117),(118),(119),(120),(121),(122),(123),(124),(125),(126), +(127),(128),(129),(130),(131),(132),(133),(133),(135),(135),(135),(135), +(136),(136),(138),(138),(139),(139),(139),(140),(141),(141),(142),(143), +(143),(145),(145); +commit; + + +-- enable_result_log +-- enable_query_log + +# check tables's value +select count(*) from bug30243_3 where org_id is not NULL; +select count(*) from bug30243_3 where org_id is NULL; + +select count(*) from bug30243_2 where org_id is not NULL; +select count(*) from bug30243_2 where org_id is NULL; + +select @@innodb_stats_method; + +analyze table bug30243_1; +analyze table bug30243_2; +analyze table bug30243_3; + +# Following query plan shows that we over estimate the rows per +# unique value (since there are many NULLs). +# Skip this query log since the stats estimate could vary from runs +-- disable_query_log +-- disable_result_log +explain SELECT COUNT(*), 0 + FROM bug30243_1 orgs + LEFT JOIN bug30243_3 sa_opportunities + ON orgs.org_id=sa_opportunities.org_id + LEFT JOIN bug30243_2 contacts + ON orgs.org_id=contacts.org_id ; +-- enable_query_log +-- enable_result_log + +# following set operation will fail +#--error ER_WRONG_VALUE_FOR_VAR +--error 1231 +set global innodb_stats_method = "NULL"; + +set global innodb_stats_method = "nulls_ignored"; + +select @@innodb_stats_method; + +# Regenerate the stats with "nulls_ignored" option + +analyze table bug30243_1; +analyze table bug30243_2; +analyze table bug30243_3; + +# Following query plan shows that we get the correct rows per +# unique value (should be approximately 1 row per value) +explain SELECT COUNT(*), 0 + FROM bug30243_1 orgs + LEFT JOIN bug30243_3 sa_opportunities + ON orgs.org_id=sa_opportunities.org_id + LEFT JOIN bug30243_2 contacts + ON orgs.org_id=contacts.org_id ; + +select @@innodb_stats_method; + +# Try the "nulls_unequal" option +set global innodb_stats_method = "nulls_unequal"; + +select @@innodb_stats_method; + +analyze table bug30243_1; +analyze table bug30243_2; +analyze table bug30243_3; + +# Following query plan shows that we get the correct rows per +# unique value (~1) +explain SELECT COUNT(*), 0 + FROM bug30243_1 orgs + LEFT JOIN bug30243_3 sa_opportunities + ON orgs.org_id=sa_opportunities.org_id + LEFT JOIN bug30243_2 contacts + ON orgs.org_id=contacts.org_id; + + +# Create a table with all NULL values, make sure the stats calculation +# does not crash with table of all NULL values +-- disable_query_log +CREATE TABLE table_bug30423 ( + org_id int(11) default NULL, + KEY(org_id) +) ENGINE=InnoDB DEFAULT CHARSET=latin1; + +INSERT INTO `table_bug30423` VALUES (NULL); + +begin; +let $i=10; +while ($i) +{ + INSERT INTO table_bug30423 SELECT NULL FROM table_bug30423; + dec $i; +} +commit; + +-- enable_query_log + +SELECT COUNT(*) FROM table_bug30423 WHERE org_id IS NULL; + +# calculate the statistics for the table for "nulls_ignored" and +# "nulls_unequal" option +set global innodb_stats_method = "nulls_unequal"; +analyze table table_bug30423; + +set global innodb_stats_method = "nulls_ignored"; +analyze table table_bug30423; + + +eval set global innodb_stats_method = $innodb_stats_method_orig; + +drop table bug30243_2; + +drop table bug30243_1; + +drop table bug30243_3; + +drop table table_bug30423; diff --git a/mysql-test/suite/innodb_plugin/r/innodb_bug30423.result b/mysql-test/suite/innodb_plugin/r/innodb_bug30423.result new file mode 100644 index 00000000000..a19809366ae --- /dev/null +++ b/mysql-test/suite/innodb_plugin/r/innodb_bug30423.result @@ -0,0 +1,95 @@ +set global innodb_stats_method = default; +select @@innodb_stats_method; +@@innodb_stats_method +nulls_equal +select count(*) from bug30243_3 where org_id is not NULL; +count(*) +20 +select count(*) from bug30243_3 where org_id is NULL; +count(*) +16384 +select count(*) from bug30243_2 where org_id is not NULL; +count(*) +224 +select count(*) from bug30243_2 where org_id is NULL; +count(*) +65536 +select @@innodb_stats_method; +@@innodb_stats_method +nulls_equal +analyze table bug30243_1; +Table Op Msg_type Msg_text +test.bug30243_1 analyze status OK +analyze table bug30243_2; +Table Op Msg_type Msg_text +test.bug30243_2 analyze status OK +analyze table bug30243_3; +Table Op Msg_type Msg_text +test.bug30243_3 analyze status OK +set global innodb_stats_method = "NULL"; +ERROR 42000: Variable 'stats_method' can't be set to the value of 'NULL' +set global innodb_stats_method = "nulls_ignored"; +select @@innodb_stats_method; +@@innodb_stats_method +nulls_ignored +analyze table bug30243_1; +Table Op Msg_type Msg_text +test.bug30243_1 analyze status OK +analyze table bug30243_2; +Table Op Msg_type Msg_text +test.bug30243_2 analyze status OK +analyze table bug30243_3; +Table Op Msg_type Msg_text +test.bug30243_3 analyze status OK +explain SELECT COUNT(*), 0 +FROM bug30243_1 orgs +LEFT JOIN bug30243_3 sa_opportunities +ON orgs.org_id=sa_opportunities.org_id +LEFT JOIN bug30243_2 contacts +ON orgs.org_id=contacts.org_id ; +id select_type table type possible_keys key key_len ref rows Extra +1 SIMPLE orgs index NULL org_id 4 NULL 128 Using index +1 SIMPLE sa_opportunities ref org_id org_id 5 test.orgs.org_id 1 Using index +1 SIMPLE contacts ref contacts$org_id contacts$org_id 5 test.orgs.org_id 1 Using index +select @@innodb_stats_method; +@@innodb_stats_method +nulls_ignored +set global innodb_stats_method = "nulls_unequal"; +select @@innodb_stats_method; +@@innodb_stats_method +nulls_unequal +analyze table bug30243_1; +Table Op Msg_type Msg_text +test.bug30243_1 analyze status OK +analyze table bug30243_2; +Table Op Msg_type Msg_text +test.bug30243_2 analyze status OK +analyze table bug30243_3; +Table Op Msg_type Msg_text +test.bug30243_3 analyze status OK +explain SELECT COUNT(*), 0 +FROM bug30243_1 orgs +LEFT JOIN bug30243_3 sa_opportunities +ON orgs.org_id=sa_opportunities.org_id +LEFT JOIN bug30243_2 contacts +ON orgs.org_id=contacts.org_id; +id select_type table type possible_keys key key_len ref rows Extra +1 SIMPLE orgs index NULL org_id 4 NULL 128 Using index +1 SIMPLE sa_opportunities ref org_id org_id 5 test.orgs.org_id 1 Using index +1 SIMPLE contacts ref contacts$org_id contacts$org_id 5 test.orgs.org_id 1 Using index +SELECT COUNT(*) FROM table_bug30423 WHERE org_id IS NULL; +COUNT(*) +1024 +set global innodb_stats_method = "nulls_unequal"; +analyze table table_bug30423; +Table Op Msg_type Msg_text +test.table_bug30423 analyze status OK +set global innodb_stats_method = "nulls_ignored"; +analyze table table_bug30423; +Table Op Msg_type Msg_text +test.table_bug30423 analyze status OK +set global innodb_stats_method = nulls_equal; +drop table bug30243_2; +drop table bug30243_1; +drop table bug30243_3; +drop table table_bug30423; diff --git a/mysql-test/suite/innodb_plugin/t/innodb_bug30423.test b/mysql-test/suite/innodb_plugin/t/innodb_bug30423.test new file mode 100644 index 00000000000..458c2967e19 --- /dev/null +++ b/mysql-test/suite/innodb_plugin/t/innodb_bug30423.test @@ -0,0 +1,211 @@ +# Test for Bug #30423, InnoDBs treatment of NULL in index stats causes +# bad "rows examined" estimates. +# Implemented InnoDB system variable "innodb_stats_method" with +# "nulls_equal" (default), "nulls_unequal", and "nulls_ignored" options. + +-- source include/have_innodb_plugin.inc + +let $innodb_stats_method_orig = `select @@innodb_stats_method`; + +# default setting for innodb_stats_method is "nulls_equal" +set global innodb_stats_method = default; + +select @@innodb_stats_method; + +# create three tables, bug30243_1, bug30243_2 and bug30243_3. +# The test scenario is adopted from original bug #30423 report. +# table bug30243_1 and bug30243_3 have many NULL values + +-- disable_result_log +-- disable_query_log + +DROP TABLE IF EXISTS bug30243_1; +CREATE TABLE bug30243_1 ( + org_id int(11) NOT NULL default '0', + UNIQUE KEY (org_id) +) ENGINE=InnoDB DEFAULT CHARSET=latin1; + +LOCK TABLES bug30243_1 WRITE; +INSERT INTO bug30243_1 VALUES (11),(15),(16),(17),(19),(20),(21),(23),(24), +(25),(26),(27),(28),(29),(30),(31),(32),(33),(34),(35),(37),(38),(40),(41), +(42),(43),(44),(45),(46),(47),(48),(49),(50),(51),(52),(53),(54),(55),(56), +(57),(58),(59),(60),(61),(62),(63),(64),(65),(66),(67),(68),(69),(70),(71), +(72),(73),(74),(75),(76),(77),(78),(79),(80),(81),(82),(83),(84),(85),(86), +(87),(88),(89),(90),(91),(92),(93),(94),(95),(96),(97),(98),(99),(100),(101), +(102),(103),(104),(105),(106),(107),(108),(109),(110),(111),(112),(113),(114), +(115),(116),(117),(118),(119),(120),(121),(122),(123),(124),(125),(126),(127), +(128),(129),(130),(131),(132),(133),(134),(135),(136),(137),(138),(139),(140), +(141),(142),(143),(144),(145); +UNLOCK TABLES; + +DROP TABLE IF EXISTS bug30243_3; +CREATE TABLE bug30243_3 ( + org_id int(11) default NULL, + KEY (org_id) +) ENGINE=InnoDB DEFAULT CHARSET=latin1; + +INSERT INTO bug30243_3 VALUES (NULL); + +begin; +let $i=14; +while ($i) +{ + INSERT INTO bug30243_3 SELECT NULL FROM bug30243_3; + dec $i; +} + +INSERT INTO bug30243_3 VALUES (34),(34),(35),(56),(58),(62),(62),(64),(65),(66),(80),(135),(137),(138),(139),(140),(142),(143),(144),(145); +commit; + +DROP TABLE IF EXISTS bug30243_2; +CREATE TABLE bug30243_2 ( + org_id int(11) default NULL, + KEY `contacts$org_id` (org_id) +) ENGINE=InnoDB DEFAULT CHARSET=latin1; + +INSERT INTO bug30243_2 VALUES (NULL); + +begin; +let $i=16; +while ($i) +{ + INSERT INTO bug30243_2 SELECT NULL FROM bug30243_2; + dec $i; +} + +INSERT INTO bug30243_2 VALUES (11),(15),(16),(17),(20),(21),(23),(24),(25), +(26),(27),(28),(29),(30),(31),(32),(33),(34),(37),(38),(40),(41),(42),(43), +(44),(45),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46), +(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46), +(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46), +(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46), +(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46), +(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(46),(48), +(48),(50),(51),(52),(52),(53),(54),(55),(57),(60),(61),(62),(62),(62),(62), +(62),(63),(64),(64),(65),(66),(66),(67),(68),(69),(70),(71),(72),(73),(74), +(75),(76),(77),(78),(79),(80),(80),(81),(82),(83),(84),(85),(86),(87),(88), +(89),(90),(91),(92),(93),(94),(95),(96),(97),(98),(99),(100),(101),(102), +(103),(104),(105),(106),(107),(108),(109),(110),(111),(112),(113),(114), +(115),(116),(117),(118),(119),(120),(121),(122),(123),(124),(125),(126), +(127),(128),(129),(130),(131),(132),(133),(133),(135),(135),(135),(135), +(136),(136),(138),(138),(139),(139),(139),(140),(141),(141),(142),(143), +(143),(145),(145); +commit; + + +-- enable_result_log +-- enable_query_log + +# check tables's value +select count(*) from bug30243_3 where org_id is not NULL; +select count(*) from bug30243_3 where org_id is NULL; + +select count(*) from bug30243_2 where org_id is not NULL; +select count(*) from bug30243_2 where org_id is NULL; + +select @@innodb_stats_method; + +analyze table bug30243_1; +analyze table bug30243_2; +analyze table bug30243_3; + +# Following query plan shows that we over estimate the rows per +# unique value (since there are many NULLs). +# Skip this query log since the stats estimate could vary from runs +-- disable_query_log +-- disable_result_log +explain SELECT COUNT(*), 0 + FROM bug30243_1 orgs + LEFT JOIN bug30243_3 sa_opportunities + ON orgs.org_id=sa_opportunities.org_id + LEFT JOIN bug30243_2 contacts + ON orgs.org_id=contacts.org_id ; +-- enable_query_log +-- enable_result_log + +# following set operation will fail +#--error ER_WRONG_VALUE_FOR_VAR +--error 1231 +set global innodb_stats_method = "NULL"; + +set global innodb_stats_method = "nulls_ignored"; + +select @@innodb_stats_method; + +# Regenerate the stats with "nulls_ignored" option + +analyze table bug30243_1; +analyze table bug30243_2; +analyze table bug30243_3; + +# Following query plan shows that we get the correct rows per +# unique value (should be approximately 1 row per value) +explain SELECT COUNT(*), 0 + FROM bug30243_1 orgs + LEFT JOIN bug30243_3 sa_opportunities + ON orgs.org_id=sa_opportunities.org_id + LEFT JOIN bug30243_2 contacts + ON orgs.org_id=contacts.org_id ; + +select @@innodb_stats_method; + +# Try the "nulls_unequal" option +set global innodb_stats_method = "nulls_unequal"; + +select @@innodb_stats_method; + +analyze table bug30243_1; +analyze table bug30243_2; +analyze table bug30243_3; + +# Following query plan shows that we get the correct rows per +# unique value (~1) +explain SELECT COUNT(*), 0 + FROM bug30243_1 orgs + LEFT JOIN bug30243_3 sa_opportunities + ON orgs.org_id=sa_opportunities.org_id + LEFT JOIN bug30243_2 contacts + ON orgs.org_id=contacts.org_id; + + +# Create a table with all NULL values, make sure the stats calculation +# does not crash with table of all NULL values +-- disable_query_log +CREATE TABLE table_bug30423 ( + org_id int(11) default NULL, + KEY(org_id) +) ENGINE=InnoDB DEFAULT CHARSET=latin1; + +INSERT INTO `table_bug30423` VALUES (NULL); + +begin; +let $i=10; +while ($i) +{ + INSERT INTO table_bug30423 SELECT NULL FROM table_bug30423; + dec $i; +} +commit; + +-- enable_query_log + +SELECT COUNT(*) FROM table_bug30423 WHERE org_id IS NULL; + +# calculate the statistics for the table for "nulls_ignored" and +# "nulls_unequal" option +set global innodb_stats_method = "nulls_unequal"; +analyze table table_bug30423; + +set global innodb_stats_method = "nulls_ignored"; +analyze table table_bug30423; + + +eval set global innodb_stats_method = $innodb_stats_method_orig; + +drop table bug30243_2; + +drop table bug30243_1; + +drop table bug30243_3; + +drop table table_bug30423; diff --git a/storage/innobase/btr/btr0cur.c b/storage/innobase/btr/btr0cur.c index a7160d74a32..9f4babfaae6 100644 --- a/storage/innobase/btr/btr0cur.c +++ b/storage/innobase/btr/btr0cur.c @@ -66,6 +66,13 @@ this many index pages */ /*--------------------------------------*/ #define BTR_BLOB_HDR_SIZE 8 +/* Estimated table level stats from sampled value. */ +#define BTR_TABLE_STATS_FROM_SAMPLE(value, index, ext_size, not_empty) \ + ((value * (ib_longlong) index->stat_n_leaf_pages \ + + BTR_KEY_VAL_ESTIMATE_N_PAGES - 1 + ext_size \ + + not_empty) \ + / (BTR_KEY_VAL_ESTIMATE_N_PAGES + ext_size)) + /*********************************************************************** Marks all extern fields in a record as owned by the record. This function should be called if the delete mark of a record is removed: a not delete @@ -2834,10 +2841,55 @@ btr_estimate_n_rows_in_range( } } +/*********************************************************************** +Record the number of non_null key values in a given index for +each n-column prefix of the index where n < dict_index_get_n_unique(index). +The estimates are eventually stored in the array: +index->stat_n_non_null_key_vals. */ +static +void +btr_record_not_null_field_in_rec( +/*=============================*/ + rec_t* rec, /* in: physical record */ + ulint n_unique, /* in: dict_index_get_n_unique(index), + number of columns uniquely determine + an index entry */ + const ulint* offsets, /* in: rec_get_offsets(rec, index), + its size could be for all fields or + that of "n_unique" */ + ib_longlong* n_not_null) /* in/out: array to record number of + not null rows for n-column prefix */ +{ + ulint i; + + ut_ad(rec_offs_n_fields(offsets) >= n_unique); + + if (n_not_null == NULL) { + return; + } + + for (i = 0; i < n_unique; i++) { + ulint rec_len; + byte* field; + + field = rec_get_nth_field(rec, offsets, i, &rec_len); + + if (rec_len != UNIV_SQL_NULL) { + n_not_null[i]++; + } else { + /* Break if we hit the first NULL value */ + break; + } + } +} + /*********************************************************************** Estimates the number of different key values in a given index, for each n-column prefix of the index where n <= dict_index_get_n_unique(index). -The estimates are stored in the array index->stat_n_diff_key_vals. */ +The estimates are stored in the array index->stat_n_diff_key_vals. +If innodb_stats_method is "nulls_ignored", we also record the number of +non-null values for each prefix and store the estimates in +array index->stat_n_non_null_key_vals. */ void btr_estimate_number_of_different_key_vals( @@ -2851,6 +2903,8 @@ btr_estimate_number_of_different_key_vals( ulint matched_fields; ulint matched_bytes; ib_longlong* n_diff; + ib_longlong* n_not_null; + ibool stats_null_not_equal; ulint not_empty_flag = 0; ulint total_external_size = 0; ulint i; @@ -2858,24 +2912,47 @@ btr_estimate_number_of_different_key_vals( ulint add_on; mtr_t mtr; mem_heap_t* heap = NULL; - ulint offsets_rec_[REC_OFFS_NORMAL_SIZE]; - ulint offsets_next_rec_[REC_OFFS_NORMAL_SIZE]; - ulint* offsets_rec = offsets_rec_; - ulint* offsets_next_rec= offsets_next_rec_; - *offsets_rec_ = (sizeof offsets_rec_) / sizeof *offsets_rec_; - *offsets_next_rec_ - = (sizeof offsets_next_rec_) / sizeof *offsets_next_rec_; + ulint* offsets_rec = NULL; + ulint* offsets_next_rec = NULL; n_cols = dict_index_get_n_unique(index); - n_diff = mem_alloc((n_cols + 1) * sizeof(ib_longlong)); + heap = mem_heap_create((sizeof *n_diff + sizeof *n_not_null) + * (n_cols + 1) + + dict_index_get_n_fields(index) + * (sizeof *offsets_rec + + sizeof *offsets_next_rec)); - memset(n_diff, 0, (n_cols + 1) * sizeof(ib_longlong)); + n_diff = mem_heap_zalloc(heap, (n_cols + 1) * sizeof(ib_longlong)); + + n_not_null = NULL; + + /* Check srv_innodb_stats_method setting, and decide whether we + need to record non-null value and also decide if NULL is + considered equal (by setting stats_null_not_equal value) */ + switch (srv_innodb_stats_method) { + case SRV_STATS_NULLS_IGNORED: + n_not_null = mem_heap_zalloc(heap, (n_cols + 1) + * sizeof *n_not_null); + /* fall through */ + + case SRV_STATS_NULLS_UNEQUAL: + /* for both SRV_STATS_NULLS_IGNORED and SRV_STATS_NULLS_UNEQUAL + case, we will treat NULLs as unequal value */ + stats_null_not_equal = TRUE; + break; + + case SRV_STATS_NULLS_EQUAL: + stats_null_not_equal = FALSE; + break; + + default: + ut_error; + } /* We sample some pages in the index to get an estimate */ for (i = 0; i < BTR_KEY_VAL_ESTIMATE_N_PAGES; i++) { - rec_t* supremum; mtr_start(&mtr); btr_cur_open_at_rnd_pos(index, BTR_SEARCH_LEAF, &cursor, &mtr); @@ -2888,18 +2965,22 @@ btr_estimate_number_of_different_key_vals( page = btr_cur_get_page(&cursor); - supremum = page_get_supremum_rec(page); rec = page_rec_get_next(page_get_infimum_rec(page)); - if (rec != supremum) { + if (!page_rec_is_supremum(rec)) { not_empty_flag = 1; offsets_rec = rec_get_offsets(rec, index, offsets_rec, ULINT_UNDEFINED, &heap); + + if (n_not_null) { + btr_record_not_null_field_in_rec( + rec, n_cols, offsets_rec, n_not_null); + } } - while (rec != supremum) { + while (!page_rec_is_supremum(rec)) { rec_t* next_rec = page_rec_get_next(rec); - if (next_rec == supremum) { + if (page_rec_is_supremum(next_rec)) { break; } @@ -2911,7 +2992,8 @@ btr_estimate_number_of_different_key_vals( cmp_rec_rec_with_match(rec, next_rec, offsets_rec, offsets_next_rec, - index, &matched_fields, + index, stats_null_not_equal, + &matched_fields, &matched_bytes); for (j = matched_fields + 1; j <= n_cols; j++) { @@ -2921,6 +3003,12 @@ btr_estimate_number_of_different_key_vals( n_diff[j]++; } + if (n_not_null) { + btr_record_not_null_field_in_rec( + next_rec, n_cols, offsets_next_rec, + n_not_null); + } + total_external_size += btr_rec_get_externally_stored_len( rec, offsets_rec); @@ -2971,14 +3059,8 @@ btr_estimate_number_of_different_key_vals( included in index->stat_n_leaf_pages) */ for (j = 0; j <= n_cols; j++) { - index->stat_n_diff_key_vals[j] - = ((n_diff[j] - * (ib_longlong)index->stat_n_leaf_pages - + BTR_KEY_VAL_ESTIMATE_N_PAGES - 1 - + total_external_size - + not_empty_flag) - / (BTR_KEY_VAL_ESTIMATE_N_PAGES - + total_external_size)); + index->stat_n_diff_key_vals[j] = BTR_TABLE_STATS_FROM_SAMPLE( + n_diff[j], index, total_external_size, not_empty_flag); /* If the tree is small, smaller than 10 * BTR_KEY_VAL_ESTIMATE_N_PAGES + total_external_size, then @@ -2997,12 +3079,20 @@ btr_estimate_number_of_different_key_vals( } index->stat_n_diff_key_vals[j] += add_on; + + /* Update the stat_n_non_null_key_vals[] with our + sampled result. stat_n_non_null_key_vals[] is created + and initialized to zero in dict_index_add_to_cache(), + along with stat_n_diff_key_vals[] array */ + if (n_not_null != NULL && (j < n_cols)) { + index->stat_n_non_null_key_vals[j] = + BTR_TABLE_STATS_FROM_SAMPLE( + n_not_null[j], index, + total_external_size, not_empty_flag); + } } - mem_free(n_diff); - if (UNIV_LIKELY_NULL(heap)) { - mem_heap_free(heap); - } + mem_heap_free(heap); } /*================== EXTERNAL STORAGE OF BIG FIELDS ===================*/ diff --git a/storage/innobase/dict/dict0dict.c b/storage/innobase/dict/dict0dict.c index fda6555e082..beea0a2f411 100644 --- a/storage/innobase/dict/dict0dict.c +++ b/storage/innobase/dict/dict0dict.c @@ -1358,6 +1358,12 @@ dict_index_add_to_cache( new_index->heap, (1 + dict_index_get_n_unique(new_index)) * sizeof(ib_longlong)); + + new_index->stat_n_non_null_key_vals = mem_heap_zalloc( + new_index->heap, + (1 + dict_index_get_n_unique(new_index)) + * sizeof(*new_index->stat_n_non_null_key_vals)); + /* Give some sensible values to stat_n_... in case we do not calculate statistics quickly enough */ @@ -3817,6 +3823,10 @@ dict_update_statistics_low( for (i = dict_index_get_n_unique(index); i; ) { index->stat_n_diff_key_vals[i--] = 1; } + + memset(index->stat_n_non_null_key_vals, 0, + (1 + dict_index_get_n_unique(index)) + * sizeof(*index->stat_n_non_null_key_vals)); } index = dict_table_get_next_index(index); diff --git a/storage/innobase/handler/ha_innodb.cc b/storage/innobase/handler/ha_innodb.cc index 4c52326a58a..6f58fd70fbd 100644 --- a/storage/innobase/handler/ha_innodb.cc +++ b/storage/innobase/handler/ha_innodb.cc @@ -130,6 +130,25 @@ static my_bool innobase_adaptive_hash_index = TRUE; static char* internal_innobase_data_file_path = NULL; +/* Possible values for system variable "innodb_stats_method". The values +are defined the same as its corresponding MyISAM system variable +"myisam_stats_method"(see "myisam_stats_method_names"), for better usability */ +static const char* innodb_stats_method_names[] = { + "nulls_equal", + "nulls_unequal", + "nulls_ignored", + NullS +}; + +/* Used to define an enumerate type of the system variable innodb_stats_method. +This is the same as "myisam_stats_method_typelib" */ +static TYPELIB innodb_stats_method_typelib = { + array_elements(innodb_stats_method_names) - 1, + "innodb_stats_method_typelib", + innodb_stats_method_names, + NULL +}; + /* The following counter is used to convey information to InnoDB about server activity: in selects it is not sensible to call srv_active_wake_master_thread after each fetch or search, we only do @@ -6362,6 +6381,65 @@ ha_innobase::read_time( return(ranges + (double) rows / (double) total_rows * time_for_scan); } +/************************************************************************* +Calculate Record Per Key value. Need to exclude the NULL value if +innodb_stats_method is set to "nulls_ignored" */ +static +ha_rows +innodb_rec_per_key( +/*===============*/ + /* out: estimated record per key + value */ + dict_index_t* index, /* in: dict_index_t structure */ + ulint i, /* in: the column we are + calculating rec per key */ + ha_rows records) /* in: estimated total records */ +{ + ha_rows rec_per_key; + + ut_ad(i < dict_index_get_n_unique(index)); + + /* Note the stat_n_diff_key_vals[] stores the diff value with + n-prefix indexing, so it is always stat_n_diff_key_vals[i + 1] */ + if (index->stat_n_diff_key_vals[i + 1] == 0) { + + rec_per_key = records; + } else if (srv_innodb_stats_method == SRV_STATS_NULLS_IGNORED) { + ib_longlong num_null; + + /* Number of rows with NULL value in this + field */ + num_null = records - index->stat_n_non_null_key_vals[i]; + + /* In theory, index->stat_n_non_null_key_vals[i] + should always be less than the number of records. + Since this is statistics value, the value could + have slight discrepancy. But we will make sure + the number of null values is not a negative number. */ + num_null = (num_null < 0) ? 0 : num_null; + + /* If the number of NULL values is the same as or + large than that of the distinct values, we could + consider that the table consists mostly of NULL value. + Set rec_per_key to 1. */ + if (index->stat_n_diff_key_vals[i + 1] <= num_null) { + rec_per_key = 1; + } else { + /* Need to exclude rows with NULL values from + rec_per_key calculation */ + rec_per_key = (ha_rows)( + (records - num_null) + / (index->stat_n_diff_key_vals[i + 1] + - num_null)); + } + } else { + rec_per_key = (ha_rows) + (records / index->stat_n_diff_key_vals[i + 1]); + } + + return(rec_per_key); +} + /************************************************************************* Returns statistics information of the table to the MySQL interpreter, in various fields of the handle object. */ @@ -6568,13 +6646,8 @@ ha_innobase::info_low( break; } - if (index->stat_n_diff_key_vals[j + 1] == 0) { - - rec_per_key = stats.records; - } else { - rec_per_key = (ha_rows)(stats.records / - index->stat_n_diff_key_vals[j + 1]); - } + rec_per_key = innodb_rec_per_key( + index, j, stats.records); /* Since MySQL seems to favor table scans too much over index searches, we pretend @@ -8990,6 +9063,13 @@ static MYSQL_SYSVAR_LONG(autoinc_lock_mode, innobase_autoinc_lock_mode, AUTOINC_OLD_STYLE_LOCKING, /* Minimum value */ AUTOINC_NO_LOCKING, 0); /* Maximum value */ +static MYSQL_SYSVAR_ENUM(stats_method, srv_innodb_stats_method, + PLUGIN_VAR_RQCMDARG, + "Specifies how InnoDB index statistics collection code should " + "treat NULLs. Possible values are NULLS_EQUAL (default), " + "NULLS_UNEQUAL and NULLS_IGNORED", + NULL, NULL, SRV_STATS_NULLS_EQUAL, &innodb_stats_method_typelib); + #if defined UNIV_DEBUG || defined UNIV_IBUF_DEBUG static MYSQL_SYSVAR_UINT(change_buffering_debug, ibuf_debug, PLUGIN_VAR_RQCMDARG, @@ -9031,6 +9111,7 @@ static struct st_mysql_sys_var* innobase_system_variables[]= { MYSQL_SYSVAR(stats_on_metadata), MYSQL_SYSVAR(use_legacy_cardinality_algorithm), MYSQL_SYSVAR(adaptive_hash_index), + MYSQL_SYSVAR(stats_method), MYSQL_SYSVAR(status_file), MYSQL_SYSVAR(support_xa), MYSQL_SYSVAR(sync_spin_loops), diff --git a/storage/innobase/include/btr0cur.h b/storage/innobase/include/btr0cur.h index 213dcb7f568..20235c55f22 100644 --- a/storage/innobase/include/btr0cur.h +++ b/storage/innobase/include/btr0cur.h @@ -404,7 +404,10 @@ btr_estimate_n_rows_in_range( /*********************************************************************** Estimates the number of different key values in a given index, for each n-column prefix of the index where n <= dict_index_get_n_unique(index). -The estimates are stored in the array index->stat_n_diff_key_vals. */ +The estimates are stored in the array index->stat_n_diff_key_vals. +If innodb_stats_method is nulls_ignored, we also record the number of +non-null values for each prefix and stored the estimates in +array index->stat_n_non_null_key_vals. */ void btr_estimate_number_of_different_key_vals( diff --git a/storage/innobase/include/dict0mem.h b/storage/innobase/include/dict0mem.h index 2f2a7441478..83dbf65ea41 100644 --- a/storage/innobase/include/dict0mem.h +++ b/storage/innobase/include/dict0mem.h @@ -222,6 +222,12 @@ struct dict_index_struct{ for this index, for each n-column prefix where n <= dict_get_n_unique(index); we periodically calculate new estimates */ + ib_longlong* stat_n_non_null_key_vals; + /* approximate number of non-null key values + for this index, for each column where + n < dict_get_n_unique(index); This + is used when innodb_stats_method is + "nulls_ignored". */ ulint stat_index_size; /* approximate index size in database pages */ ulint stat_n_leaf_pages; diff --git a/storage/innobase/include/rem0cmp.h b/storage/innobase/include/rem0cmp.h index c6a6e5de4db..22a22d13e17 100644 --- a/storage/innobase/include/rem0cmp.h +++ b/storage/innobase/include/rem0cmp.h @@ -141,6 +141,10 @@ cmp_rec_rec_with_match( const ulint* offsets1,/* in: rec_get_offsets(rec1, index) */ const ulint* offsets2,/* in: rec_get_offsets(rec2, index) */ dict_index_t* index, /* in: data dictionary index */ + ibool nulls_unequal, + /* in: TRUE if this is for index statistics + cardinality estimation, and innodb_stats_method + is "nulls_unequal" or "nulls_ignored" */ ulint* matched_fields, /* in/out: number of already completely matched fields; when the function returns, contains the value the for current diff --git a/storage/innobase/include/rem0cmp.ic b/storage/innobase/include/rem0cmp.ic index 52dc7ff5dc9..45e12301a3c 100644 --- a/storage/innobase/include/rem0cmp.ic +++ b/storage/innobase/include/rem0cmp.ic @@ -72,5 +72,5 @@ cmp_rec_rec( ulint match_b = 0; return(cmp_rec_rec_with_match(rec1, rec2, offsets1, offsets2, index, - &match_f, &match_b)); + FALSE, &match_f, &match_b)); } diff --git a/storage/innobase/include/srv0srv.h b/storage/innobase/include/srv0srv.h index 3dd4bb961f9..811074b2be8 100644 --- a/storage/innobase/include/srv0srv.h +++ b/storage/innobase/include/srv0srv.h @@ -91,6 +91,11 @@ extern ulint srv_lock_table_size; extern ulint srv_n_file_io_threads; +/* The "innodb_stats_method" setting, decides how InnoDB is going +to treat NULL value when collecting statistics. It is not defined +as enum type because the configure option takes unsigned integer type. */ +extern ulong srv_innodb_stats_method; + #ifdef UNIV_LOG_ARCHIVE extern ibool srv_log_archive_on; extern ibool srv_archive_recovery; @@ -286,6 +291,19 @@ of lower numbers are included. */ #define SRV_FORCE_NO_LOG_REDO 6 /* do not do the log roll-forward in connection with recovery */ +/* Alternatives for srv_innodb_stats_method, which could be changed by +setting innodb_stats_method */ +enum srv_stats_method_name_enum { + SRV_STATS_NULLS_EQUAL, /* All NULL values are treated as + equal. This is the default setting + for innodb_stats_method */ + SRV_STATS_NULLS_UNEQUAL, /* All NULL values are treated as + NOT equal. */ + SRV_STATS_NULLS_IGNORED /* NULL values are ignored */ +}; + +typedef enum srv_stats_method_name_enum srv_stats_method_name_t; + /************************************************************************* Boots Innobase server. */ diff --git a/storage/innobase/rem/rem0cmp.c b/storage/innobase/rem/rem0cmp.c index ca0ec663548..2939c119e2e 100644 --- a/storage/innobase/rem/rem0cmp.c +++ b/storage/innobase/rem/rem0cmp.c @@ -720,6 +720,10 @@ cmp_rec_rec_with_match( const ulint* offsets1,/* in: rec_get_offsets(rec1, index) */ const ulint* offsets2,/* in: rec_get_offsets(rec2, index) */ dict_index_t* index, /* in: data dictionary index */ + ibool nulls_unequal, + /* in: TRUE if this is for index statistics + cardinality estimation, and innodb_stats_method + is "nulls_unequal" or "nulls_ignored" */ ulint* matched_fields, /* in/out: number of already completely matched fields; when the function returns, contains the value the for current @@ -821,9 +825,13 @@ cmp_rec_rec_with_match( || rec2_f_len == UNIV_SQL_NULL) { if (rec1_f_len == rec2_f_len) { - - goto next_field; - + /* This is limited to stats collection, + cannot use it for regular search */ + if (nulls_unequal) { + ret = -1; + } else { + goto next_field; + } } else if (rec2_f_len == UNIV_SQL_NULL) { /* We define the SQL null to be the diff --git a/storage/innobase/srv/srv0srv.c b/storage/innobase/srv/srv0srv.c index 5b1184fb416..9c34e73109c 100644 --- a/storage/innobase/srv/srv0srv.c +++ b/storage/innobase/srv/srv0srv.c @@ -218,6 +218,11 @@ ulong srv_max_buf_pool_modified_pct = 90; /* variable counts amount of data read in total (in bytes) */ ulint srv_data_read = 0; +/* Internal setting for "innodb_stats_method". Decides how InnoDB treats +NULL value when collecting statistics. By default, it is set to +SRV_STATS_NULLS_EQUAL(0), ie. all NULL value are treated equal */ +ulong srv_innodb_stats_method = SRV_STATS_NULLS_EQUAL; + /* here we count the amount of data written in total (in bytes) */ ulint srv_data_written = 0; diff --git a/storage/innodb_plugin/ChangeLog b/storage/innodb_plugin/ChangeLog index 8eb63fe8c78..43ffa762ddb 100644 --- a/storage/innodb_plugin/ChangeLog +++ b/storage/innodb_plugin/ChangeLog @@ -1,3 +1,11 @@ +2011-01-14 The InnoDB Team + * btr/btr0cur.c, dict/dict0dict.c, handler/ha_innodb.cc, + include/btr0cur.h, include/dict0mem.h, include/rem0cmp.h, + include/rem0cmp.ic, include/srv0srv.h, rem/rem0cmp.c, + srv/srv0srv.c, innodb_bug30423.test: + Fix Bug#30423 InnoDBs treatment of NULL in index stats causes + bad "rows examined" estimates + 2011-01-06 The InnoDB Team * handler/i_s.cc, include/trx0i_s.h, trx/trx0i_s.c: Fix Bug#55397 cannot select from innodb_trx when trx_query contains diff --git a/storage/innodb_plugin/btr/btr0cur.c b/storage/innodb_plugin/btr/btr0cur.c index c57255a25ae..1fb0bc39933 100644 --- a/storage/innodb_plugin/btr/btr0cur.c +++ b/storage/innodb_plugin/btr/btr0cur.c @@ -100,6 +100,18 @@ can be released by page reorganize, then it is reorganized */ /*--------------------------------------*/ #define BTR_BLOB_HDR_SIZE 8 /*!< Size of a BLOB part header, in bytes */ + +/** Estimated table level stats from sampled value. +@param value sampled stats +@param index index being sampled +@param sample number of sampled rows +@param ext_size external stored data size +@param not_empty table not empty +@return estimated table wide stats from sampled value */ +#define BTR_TABLE_STATS_FROM_SAMPLE(value, index, sample, ext_size, not_empty)\ + (((value) * (ib_int64_t) index->stat_n_leaf_pages \ + + (sample) - 1 + (ext_size) + (not_empty)) / ((sample) + (ext_size))) + /* @} */ #endif /* !UNIV_HOTBACKUP */ @@ -3200,10 +3212,55 @@ btr_estimate_n_rows_in_range( } } +/*******************************************************************//** +Record the number of non_null key values in a given index for +each n-column prefix of the index where n < dict_index_get_n_unique(index). +The estimates are eventually stored in the array: +index->stat_n_non_null_key_vals. */ +static +void +btr_record_not_null_field_in_rec( +/*=============================*/ + rec_t* rec, /*!< in: physical record */ + ulint n_unique, /*!< in: dict_index_get_n_unique(index), + number of columns uniquely determine + an index entry */ + const ulint* offsets, /*!< in: rec_get_offsets(rec, index), + its size could be for all fields or + that of "n_unique" */ + ib_int64_t* n_not_null) /*!< in/out: array to record number of + not null rows for n-column prefix */ +{ + ulint i; + + ut_ad(rec_offs_n_fields(offsets) >= n_unique); + + if (n_not_null == NULL) { + return; + } + + for (i = 0; i < n_unique; i++) { + ulint rec_len; + byte* field; + + field = rec_get_nth_field(rec, offsets, i, &rec_len); + + if (rec_len != UNIV_SQL_NULL) { + n_not_null[i]++; + } else { + /* Break if we hit the first NULL value */ + break; + } + } +} + /*******************************************************************//** Estimates the number of different key values in a given index, for each n-column prefix of the index where n <= dict_index_get_n_unique(index). -The estimates are stored in the array index->stat_n_diff_key_vals. */ +The estimates are stored in the array index->stat_n_diff_key_vals. +If innodb_stats_method is "nulls_ignored", we also record the number of +non-null values for each prefix and store the estimates in +array index->stat_n_non_null_key_vals. */ UNIV_INTERN void btr_estimate_number_of_different_key_vals( @@ -3217,6 +3274,8 @@ btr_estimate_number_of_different_key_vals( ulint matched_fields; ulint matched_bytes; ib_int64_t* n_diff; + ib_int64_t* n_not_null; + ibool stats_null_not_equal; ullint n_sample_pages; /* number of pages to sample */ ulint not_empty_flag = 0; ulint total_external_size = 0; @@ -3225,16 +3284,43 @@ btr_estimate_number_of_different_key_vals( ullint add_on; mtr_t mtr; mem_heap_t* heap = NULL; - ulint offsets_rec_[REC_OFFS_NORMAL_SIZE]; - ulint offsets_next_rec_[REC_OFFS_NORMAL_SIZE]; - ulint* offsets_rec = offsets_rec_; - ulint* offsets_next_rec= offsets_next_rec_; - rec_offs_init(offsets_rec_); - rec_offs_init(offsets_next_rec_); + ulint* offsets_rec = NULL; + ulint* offsets_next_rec = NULL; n_cols = dict_index_get_n_unique(index); - n_diff = mem_zalloc((n_cols + 1) * sizeof(ib_int64_t)); + heap = mem_heap_create((sizeof *n_diff + sizeof *n_not_null) + * (n_cols + 1) + + dict_index_get_n_fields(index) + * (sizeof *offsets_rec + + sizeof *offsets_next_rec)); + + n_diff = mem_heap_zalloc(heap, (n_cols + 1) * sizeof(ib_int64_t)); + + n_not_null = NULL; + + /* Check srv_innodb_stats_method setting, and decide whether we + need to record non-null value and also decide if NULL is + considered equal (by setting stats_null_not_equal value) */ + switch (srv_innodb_stats_method) { + case SRV_STATS_NULLS_IGNORED: + n_not_null = mem_heap_zalloc(heap, (n_cols + 1) + * sizeof *n_not_null); + /* fall through */ + + case SRV_STATS_NULLS_UNEQUAL: + /* for both SRV_STATS_NULLS_IGNORED and SRV_STATS_NULLS_UNEQUAL + case, we will treat NULLs as unequal value */ + stats_null_not_equal = TRUE; + break; + + case SRV_STATS_NULLS_EQUAL: + stats_null_not_equal = FALSE; + break; + + default: + ut_error; + } /* It makes no sense to test more pages than are contained in the index, thus we lower the number if it is too high */ @@ -3251,7 +3337,6 @@ btr_estimate_number_of_different_key_vals( /* We sample some pages in the index to get an estimate */ for (i = 0; i < n_sample_pages; i++) { - rec_t* supremum; mtr_start(&mtr); btr_cur_open_at_rnd_pos(index, BTR_SEARCH_LEAF, &cursor, &mtr); @@ -3264,18 +3349,22 @@ btr_estimate_number_of_different_key_vals( page = btr_cur_get_page(&cursor); - supremum = page_get_supremum_rec(page); rec = page_rec_get_next(page_get_infimum_rec(page)); - if (rec != supremum) { + if (!page_rec_is_supremum(rec)) { not_empty_flag = 1; offsets_rec = rec_get_offsets(rec, index, offsets_rec, ULINT_UNDEFINED, &heap); + + if (n_not_null) { + btr_record_not_null_field_in_rec( + rec, n_cols, offsets_rec, n_not_null); + } } - while (rec != supremum) { + while (!page_rec_is_supremum(rec)) { rec_t* next_rec = page_rec_get_next(rec); - if (next_rec == supremum) { + if (page_rec_is_supremum(next_rec)) { break; } @@ -3287,7 +3376,8 @@ btr_estimate_number_of_different_key_vals( cmp_rec_rec_with_match(rec, next_rec, offsets_rec, offsets_next_rec, - index, &matched_fields, + index, stats_null_not_equal, + &matched_fields, &matched_bytes); for (j = matched_fields + 1; j <= n_cols; j++) { @@ -3297,6 +3387,12 @@ btr_estimate_number_of_different_key_vals( n_diff[j]++; } + if (n_not_null) { + btr_record_not_null_field_in_rec( + next_rec, n_cols, offsets_next_rec, + n_not_null); + } + total_external_size += btr_rec_get_externally_stored_len( rec, offsets_rec); @@ -3348,13 +3444,9 @@ btr_estimate_number_of_different_key_vals( for (j = 0; j <= n_cols; j++) { index->stat_n_diff_key_vals[j] - = ((n_diff[j] - * (ib_int64_t)index->stat_n_leaf_pages - + n_sample_pages - 1 - + total_external_size - + not_empty_flag) - / (n_sample_pages - + total_external_size)); + = BTR_TABLE_STATS_FROM_SAMPLE( + n_diff[j], index, n_sample_pages, + total_external_size, not_empty_flag); /* If the tree is small, smaller than 10 * n_sample_pages + total_external_size, then @@ -3373,12 +3465,20 @@ btr_estimate_number_of_different_key_vals( } index->stat_n_diff_key_vals[j] += add_on; + + /* Update the stat_n_non_null_key_vals[] with our + sampled result. stat_n_non_null_key_vals[] is created + and initialized to zero in dict_index_add_to_cache(), + along with stat_n_diff_key_vals[] array */ + if (n_not_null != NULL && (j < n_cols)) { + index->stat_n_non_null_key_vals[j] = + BTR_TABLE_STATS_FROM_SAMPLE( + n_not_null[j], index, n_sample_pages, + total_external_size, not_empty_flag); + } } - mem_free(n_diff); - if (UNIV_LIKELY_NULL(heap)) { - mem_heap_free(heap); - } + mem_heap_free(heap); } /*================== EXTERNAL STORAGE OF BIG FIELDS ===================*/ diff --git a/storage/innodb_plugin/dict/dict0dict.c b/storage/innodb_plugin/dict/dict0dict.c index 67765555658..ff56e9cb76a 100644 --- a/storage/innodb_plugin/dict/dict0dict.c +++ b/storage/innodb_plugin/dict/dict0dict.c @@ -1669,6 +1669,12 @@ undo_size_ok: new_index->heap, (1 + dict_index_get_n_unique(new_index)) * sizeof(ib_int64_t)); + + new_index->stat_n_non_null_key_vals = mem_heap_zalloc( + new_index->heap, + (1 + dict_index_get_n_unique(new_index)) + * sizeof(*new_index->stat_n_non_null_key_vals)); + /* Give some sensible values to stat_n_... in case we do not calculate statistics quickly enough */ @@ -4291,6 +4297,10 @@ dict_update_statistics( for (i = dict_index_get_n_unique(index); i; ) { index->stat_n_diff_key_vals[i--] = 1; } + + memset(index->stat_n_non_null_key_vals, 0, + (1 + dict_index_get_n_unique(index)) + * sizeof(*index->stat_n_non_null_key_vals)); } index = dict_table_get_next_index(index); diff --git a/storage/innodb_plugin/handler/ha_innodb.cc b/storage/innodb_plugin/handler/ha_innodb.cc index 86168e2bc9b..2d60c7397b0 100644 --- a/storage/innodb_plugin/handler/ha_innodb.cc +++ b/storage/innodb_plugin/handler/ha_innodb.cc @@ -174,6 +174,25 @@ static char* internal_innobase_data_file_path = NULL; static char* innodb_version_str = (char*) INNODB_VERSION_STR; +/** Possible values for system variable "innodb_stats_method". The values +are defined the same as its corresponding MyISAM system variable +"myisam_stats_method"(see "myisam_stats_method_names"), for better usability */ +static const char* innodb_stats_method_names[] = { + "nulls_equal", + "nulls_unequal", + "nulls_ignored", + NullS +}; + +/** Used to define an enumerate type of the system variable innodb_stats_method. +This is the same as "myisam_stats_method_typelib" */ +static TYPELIB innodb_stats_method_typelib = { + array_elements(innodb_stats_method_names) - 1, + "innodb_stats_method_typelib", + innodb_stats_method_names, + NULL +}; + /* The following counter is used to convey information to InnoDB about server activity: in selects it is not sensible to call srv_active_wake_master_thread after each fetch or search, we only do @@ -7507,6 +7526,65 @@ innobase_get_mysql_key_number_for_index( return(0); } + +/*********************************************************************//** +Calculate Record Per Key value. Need to exclude the NULL value if +innodb_stats_method is set to "nulls_ignored" +@return estimated record per key value */ +static +ha_rows +innodb_rec_per_key( +/*===============*/ + dict_index_t* index, /*!< in: dict_index_t structure */ + ulint i, /*!< in: the column we are + calculating rec per key */ + ha_rows records) /*!< in: estimated total records */ +{ + ha_rows rec_per_key; + + ut_ad(i < dict_index_get_n_unique(index)); + + /* Note the stat_n_diff_key_vals[] stores the diff value with + n-prefix indexing, so it is always stat_n_diff_key_vals[i + 1] */ + if (index->stat_n_diff_key_vals[i + 1] == 0) { + + rec_per_key = records; + } else if (srv_innodb_stats_method == SRV_STATS_NULLS_IGNORED) { + ib_int64_t num_null; + + /* Number of rows with NULL value in this + field */ + num_null = records - index->stat_n_non_null_key_vals[i]; + + /* In theory, index->stat_n_non_null_key_vals[i] + should always be less than the number of records. + Since this is statistics value, the value could + have slight discrepancy. But we will make sure + the number of null values is not a negative number. */ + num_null = (num_null < 0) ? 0 : num_null; + + /* If the number of NULL values is the same as or + large than that of the distinct values, we could + consider that the table consists mostly of NULL value. + Set rec_per_key to 1. */ + if (index->stat_n_diff_key_vals[i + 1] <= num_null) { + rec_per_key = 1; + } else { + /* Need to exclude rows with NULL values from + rec_per_key calculation */ + rec_per_key = (ha_rows)( + (records - num_null) + / (index->stat_n_diff_key_vals[i + 1] + - num_null)); + } + } else { + rec_per_key = (ha_rows) + (records / index->stat_n_diff_key_vals[i + 1]); + } + + return(rec_per_key); +} + /*********************************************************************//** Returns statistics information of the table to the MySQL interpreter, in various fields of the handle object. */ @@ -7737,13 +7815,8 @@ ha_innobase::info_low( break; } - if (index->stat_n_diff_key_vals[j + 1] == 0) { - - rec_per_key = stats.records; - } else { - rec_per_key = (ha_rows)(stats.records / - index->stat_n_diff_key_vals[j + 1]); - } + rec_per_key = innodb_rec_per_key( + index, j, stats.records); /* Since MySQL seems to favor table scans too much over index searches, we pretend @@ -10934,6 +11007,13 @@ static MYSQL_SYSVAR_STR(change_buffering, innobase_change_buffering, innodb_change_buffering_validate, innodb_change_buffering_update, "inserts"); +static MYSQL_SYSVAR_ENUM(stats_method, srv_innodb_stats_method, + PLUGIN_VAR_RQCMDARG, + "Specifies how InnoDB index statistics collection code should " + "treat NULLs. Possible values are NULLS_EQUAL (default), " + "NULLS_UNEQUAL and NULLS_IGNORED", + NULL, NULL, SRV_STATS_NULLS_EQUAL, &innodb_stats_method_typelib); + #if defined UNIV_DEBUG || defined UNIV_IBUF_DEBUG static MYSQL_SYSVAR_UINT(change_buffering_debug, ibuf_debug, PLUGIN_VAR_RQCMDARG, @@ -10988,6 +11068,7 @@ static struct st_mysql_sys_var* innobase_system_variables[]= { MYSQL_SYSVAR(stats_on_metadata), MYSQL_SYSVAR(stats_sample_pages), MYSQL_SYSVAR(adaptive_hash_index), + MYSQL_SYSVAR(stats_method), MYSQL_SYSVAR(replication_delay), MYSQL_SYSVAR(status_file), MYSQL_SYSVAR(strict_mode), diff --git a/storage/innodb_plugin/include/btr0cur.h b/storage/innodb_plugin/include/btr0cur.h index b477ad0320a..cb8cb399715 100644 --- a/storage/innodb_plugin/include/btr0cur.h +++ b/storage/innodb_plugin/include/btr0cur.h @@ -478,7 +478,10 @@ btr_estimate_n_rows_in_range( /*******************************************************************//** Estimates the number of different key values in a given index, for each n-column prefix of the index where n <= dict_index_get_n_unique(index). -The estimates are stored in the array index->stat_n_diff_key_vals. */ +The estimates are stored in the array index->stat_n_diff_key_vals. +If innodb_stats_method is nulls_ignored, we also record the number of +non-null values for each prefix and stored the estimates in +array index->stat_n_non_null_key_vals. */ UNIV_INTERN void btr_estimate_number_of_different_key_vals( diff --git a/storage/innodb_plugin/include/dict0mem.h b/storage/innodb_plugin/include/dict0mem.h index 19782c2e76a..09a068ccb93 100644 --- a/storage/innodb_plugin/include/dict0mem.h +++ b/storage/innodb_plugin/include/dict0mem.h @@ -321,6 +321,12 @@ struct dict_index_struct{ dict_get_n_unique(index); we periodically calculate new estimates */ + ib_int64_t* stat_n_non_null_key_vals; + /* approximate number of non-null key values + for this index, for each column where + n < dict_get_n_unique(index); This + is used when innodb_stats_method is + "nulls_ignored". */ ulint stat_index_size; /*!< approximate index size in database pages */ diff --git a/storage/innodb_plugin/include/rem0cmp.h b/storage/innodb_plugin/include/rem0cmp.h index 2f751a38864..a908521c9f7 100644 --- a/storage/innodb_plugin/include/rem0cmp.h +++ b/storage/innodb_plugin/include/rem0cmp.h @@ -165,6 +165,10 @@ cmp_rec_rec_with_match( const ulint* offsets1,/*!< in: rec_get_offsets(rec1, index) */ const ulint* offsets2,/*!< in: rec_get_offsets(rec2, index) */ dict_index_t* index, /*!< in: data dictionary index */ + ibool nulls_unequal, + /* in: TRUE if this is for index statistics + cardinality estimation, and innodb_stats_method + is "nulls_unequal" or "nulls_ignored" */ ulint* matched_fields, /*!< in/out: number of already completely matched fields; when the function returns, contains the value the for current diff --git a/storage/innodb_plugin/include/rem0cmp.ic b/storage/innodb_plugin/include/rem0cmp.ic index 39ef5f4fba3..63415fe7837 100644 --- a/storage/innodb_plugin/include/rem0cmp.ic +++ b/storage/innodb_plugin/include/rem0cmp.ic @@ -87,5 +87,5 @@ cmp_rec_rec( ulint match_b = 0; return(cmp_rec_rec_with_match(rec1, rec2, offsets1, offsets2, index, - &match_f, &match_b)); + FALSE, &match_f, &match_b)); } diff --git a/storage/innodb_plugin/include/srv0srv.h b/storage/innodb_plugin/include/srv0srv.h index 7aa2ce74720..91ae895040c 100644 --- a/storage/innodb_plugin/include/srv0srv.h +++ b/storage/innodb_plugin/include/srv0srv.h @@ -154,6 +154,11 @@ capacity. PCT_IO(5) -> returns the number of IO operations that is 5% of the max where max is srv_io_capacity. */ #define PCT_IO(p) ((ulong) (srv_io_capacity * ((double) p / 100.0))) +/* The "innodb_stats_method" setting, decides how InnoDB is going +to treat NULL value when collecting statistics. It is not defined +as enum type because the configure option takes unsigned integer type. */ +extern ulong srv_innodb_stats_method; + #ifdef UNIV_LOG_ARCHIVE extern ibool srv_log_archive_on; extern ibool srv_archive_recovery; @@ -363,6 +368,19 @@ enum { in connection with recovery */ }; +/* Alternatives for srv_innodb_stats_method, which could be changed by +setting innodb_stats_method */ +enum srv_stats_method_name_enum { + SRV_STATS_NULLS_EQUAL, /* All NULL values are treated as + equal. This is the default setting + for innodb_stats_method */ + SRV_STATS_NULLS_UNEQUAL, /* All NULL values are treated as + NOT equal. */ + SRV_STATS_NULLS_IGNORED /* NULL values are ignored */ +}; + +typedef enum srv_stats_method_name_enum srv_stats_method_name_t; + #ifndef UNIV_HOTBACKUP /** Types of threads existing in the system. */ enum srv_thread_type { diff --git a/storage/innodb_plugin/rem/rem0cmp.c b/storage/innodb_plugin/rem/rem0cmp.c index 35b67992558..04d2c15437b 100644 --- a/storage/innodb_plugin/rem/rem0cmp.c +++ b/storage/innodb_plugin/rem/rem0cmp.c @@ -862,6 +862,10 @@ cmp_rec_rec_with_match( const ulint* offsets1,/*!< in: rec_get_offsets(rec1, index) */ const ulint* offsets2,/*!< in: rec_get_offsets(rec2, index) */ dict_index_t* index, /*!< in: data dictionary index */ + ibool nulls_unequal, + /* in: TRUE if this is for index statistics + cardinality estimation, and innodb_stats_method + is "nulls_unequal" or "nulls_ignored" */ ulint* matched_fields, /*!< in/out: number of already completely matched fields; when the function returns, contains the value the for current @@ -961,9 +965,13 @@ cmp_rec_rec_with_match( || rec2_f_len == UNIV_SQL_NULL) { if (rec1_f_len == rec2_f_len) { - - goto next_field; - + /* This is limited to stats collection, + cannot use it for regular search */ + if (nulls_unequal) { + ret = -1; + } else { + goto next_field; + } } else if (rec2_f_len == UNIV_SQL_NULL) { /* We define the SQL null to be the diff --git a/storage/innodb_plugin/srv/srv0srv.c b/storage/innodb_plugin/srv/srv0srv.c index f7e7e351bdc..3cf17f33c40 100644 --- a/storage/innodb_plugin/srv/srv0srv.c +++ b/storage/innodb_plugin/srv/srv0srv.c @@ -243,6 +243,11 @@ UNIV_INTERN ulong srv_max_buf_pool_modified_pct = 75; /* variable counts amount of data read in total (in bytes) */ UNIV_INTERN ulint srv_data_read = 0; +/* Internal setting for "innodb_stats_method". Decides how InnoDB treats +NULL value when collecting statistics. By default, it is set to +SRV_STATS_NULLS_EQUAL(0), ie. all NULL value are treated equal */ +ulong srv_innodb_stats_method = SRV_STATS_NULLS_EQUAL; + /* here we count the amount of data written in total (in bytes) */ UNIV_INTERN ulint srv_data_written = 0; From 335fcd91b300f1670eb57378b5391a52be152add Mon Sep 17 00:00:00 2001 From: Alexey Botchkov Date: Sat, 15 Jan 2011 00:56:09 +0400 Subject: [PATCH 021/202] Bug#52208 gis fails on some platforms (Solaris, HP-UX, Linux) IA64 and some other arcitectures use different float rounding mode and i find no decent way to make it consistent. So the test changed to be insensitive to this. per-file messages: mysql-test/t/gis.test Bug#52208 gis fails on some platforms (Solaris, HP-UX, Linux) --replace_result added --- mysql-test/t/gis.test | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) diff --git a/mysql-test/t/gis.test b/mysql-test/t/gis.test index 97fc6f94b6a..bdbbfc7c064 100644 --- a/mysql-test/t/gis.test +++ b/mysql-test/t/gis.test @@ -358,7 +358,7 @@ t1 where object_id=85998; # Expected result is 36.3310176346905, but IA64 returns 36.3310176346904 # due to fused multiply-add instructions. ---replace_result 36.3310176346904 36.3310176346905 +--replace_result 36.3310176346904 36.3310176346905 -114.87787186923326 -114.87787186923313 36.33101763469053 36.33101763469059 36.33101763469043 36.33101763469059 select object_id, geometrytype(geo), ISSIMPLE(GEO), ASTEXT(centroid(geo)) from t1 where object_id=85984; From 12c6d1f355c45d00421862837a1810a5d0b28049 Mon Sep 17 00:00:00 2001 From: unknown Date: Sat, 15 Jan 2011 13:48:16 +0800 Subject: [PATCH 022/202] BUG#49124 Security issue with /*!-versioned */ SQL statements on Slave Backport to 5.0. /*![:version:] Query Code */, where [:version:] is a sequence of 5 digits representing the mysql server version(e.g /*!50200 ... */), is a special comment that the query in it can be executed on those servers whose versions are larger than the version appearing in the comment. It leads to a security issue when slave's version is larger than master's. A malicious user can improve his privileges on slaves. Because slave SQL thread is running with SUPER privileges, so it can execute queries that he/she does not have privileges on master. This bug is fixed with the logic below: - To replace '!' with ' ' in the magic comments which are not applied on master. So they become common comments and will not be applied on slave. - Example: 'INSERT INTO t1 VALUES (1) /*!10000, (2)*/ /*!99999 ,(3)*/ will be binlogged as 'INSERT INTO t1 VALUES (1) /*!10000, (2)*/ /* 99999 ,(3)*/ --- mysql-test/r/rpl_conditional_comments.result | 57 +++++++++++++++ mysql-test/t/rpl_conditional_comments.test | 73 ++++++++++++++++++++ sql/mysql_priv.h | 2 +- sql/sql_lex.cc | 25 ++++++- sql/sql_lex.h | 8 +-- sql/sql_parse.cc | 12 ++-- 6 files changed, 163 insertions(+), 14 deletions(-) create mode 100644 mysql-test/r/rpl_conditional_comments.result create mode 100644 mysql-test/t/rpl_conditional_comments.test diff --git a/mysql-test/r/rpl_conditional_comments.result b/mysql-test/r/rpl_conditional_comments.result new file mode 100644 index 00000000000..105d3bc59f3 --- /dev/null +++ b/mysql-test/r/rpl_conditional_comments.result @@ -0,0 +1,57 @@ +stop slave; +drop table if exists t1,t2,t3,t4,t5,t6,t7,t8,t9; +reset master; +reset slave; +drop table if exists t1,t2,t3,t4,t5,t6,t7,t8,t9; +start slave; +CREATE TABLE t1(c1 INT); +show binlog events from ; +Log_name Pos Event_type Server_id End_log_pos Info +master-bin.000001 # Query # # use `test`; CREATE TABLE t1(c1 INT) + +# Case 1: +# ------------------------------------------------------------------ +# In a statement, some CCs are applied while others are not. The CCs +# which are not applied on master will be binlogged as common comments. +/*!99999 --- */INSERT /*!INTO*/ /*!10000 t1 */ VALUES(10) /*!99999 ,(11)*/; +show binlog events from ; +Log_name Pos Event_type Server_id End_log_pos Info +master-bin.000001 # Query # # use `test`; /* 99999 --- */INSERT /*!INTO*/ /*!10000 t1 */ VALUES(10) /* 99999 ,(11)*/ +Comparing tables master:test.t1 and slave:test.t1 + +# Case 2: +# ----------------------------------------------------------------- +# Verify whether it can be binlogged correctly when executing prepared +# statement. +PREPARE stmt FROM 'INSERT INTO /*!99999 blabla*/ t1 VALUES(60) /*!99999 ,(61)*/'; +EXECUTE stmt; +DROP TABLE t1; +CREATE TABLE t1(c1 INT); +EXECUTE stmt; +Comparing tables master:test.t1 and slave:test.t1 + +SET @value=62; +PREPARE stmt FROM 'INSERT INTO /*!99999 blabla */ t1 VALUES(?) /*!99999 ,(63)*/'; +EXECUTE stmt USING @value; +DROP TABLE t1; +CREATE TABLE t1(c1 INT); +EXECUTE stmt USING @value; +show binlog events from ; +Log_name Pos Event_type Server_id End_log_pos Info +master-bin.000001 # Query # # use `test`; INSERT INTO /* 99999 blabla*/ t1 VALUES(60) /* 99999 ,(61)*/ +master-bin.000001 # Query # # use `test`; DROP TABLE t1 +master-bin.000001 # Query # # use `test`; CREATE TABLE t1(c1 INT) +master-bin.000001 # Query # # use `test`; INSERT INTO /* 99999 blabla*/ t1 VALUES(60) /* 99999 ,(61)*/ +master-bin.000001 # Query # # use `test`; INSERT INTO /* 99999 blabla */ t1 VALUES(62) /* 99999 ,(63)*/ +master-bin.000001 # Query # # use `test`; DROP TABLE t1 +master-bin.000001 # Query # # use `test`; CREATE TABLE t1(c1 INT) +master-bin.000001 # Query # # use `test`; INSERT INTO /* 99999 blabla */ t1 VALUES(62) /* 99999 ,(63)*/ +Comparing tables master:test.t1 and slave:test.t1 + +# Case 3: +# ----------------------------------------------------------------- +# Verify it can restore the '!', if the it is an uncomplete conditional +# comments +SELECT c1 FROM /*!99999 t1 WHEREN; +ERROR 42000: You have an error in your SQL syntax; check the manual that corresponds to your MySQL server version for the right syntax to use near '/*!99999 t1 WHEREN' at line 1 +DROP TABLE t1; diff --git a/mysql-test/t/rpl_conditional_comments.test b/mysql-test/t/rpl_conditional_comments.test new file mode 100644 index 00000000000..f1f46b8fc41 --- /dev/null +++ b/mysql-test/t/rpl_conditional_comments.test @@ -0,0 +1,73 @@ +############################################################################### +# After the patch for BUG#49124: +# - Use ' ' instead of '!' in the conditional comments which are not applied on +# master. So they become common comments and will not be applied on slave. +# +# - Example: +# 'INSERT INTO t1 VALUES (1) /*!10000, (2)*/ /*!99999 ,(3)*/ +# will be binlogged as +# 'INSERT INTO t1 VALUES (1) /*!10000, (2)*/ /* 99999 ,(3)*/'. +############################################################################### +source include/master-slave.inc; + +CREATE TABLE t1(c1 INT); +source include/show_binlog_events.inc; +let $binlog_start= query_get_value(SHOW MASTER STATUS, Position, 1); + +--echo +--echo # Case 1: +--echo # ------------------------------------------------------------------ +--echo # In a statement, some CCs are applied while others are not. The CCs +--echo # which are not applied on master will be binlogged as common comments. + +/*!99999 --- */INSERT /*!INTO*/ /*!10000 t1 */ VALUES(10) /*!99999 ,(11)*/; + +source include/show_binlog_events.inc; +let $binlog_start= query_get_value(SHOW MASTER STATUS, Position, 1); +sync_slave_with_master; +let $diff_table_1=master:test.t1; +let $diff_table_2=slave:test.t1; +source include/diff_tables.inc; + +--echo +--echo # Case 2: +--echo # ----------------------------------------------------------------- +--echo # Verify whether it can be binlogged correctly when executing prepared +--echo # statement. +PREPARE stmt FROM 'INSERT INTO /*!99999 blabla*/ t1 VALUES(60) /*!99999 ,(61)*/'; +EXECUTE stmt; +DROP TABLE t1; +CREATE TABLE t1(c1 INT); +EXECUTE stmt; + +sync_slave_with_master; +let $diff_table_1=master:test.t1; +let $diff_table_2=slave:test.t1; +source include/diff_tables.inc; + +--echo +SET @value=62; +PREPARE stmt FROM 'INSERT INTO /*!99999 blabla */ t1 VALUES(?) /*!99999 ,(63)*/'; +EXECUTE stmt USING @value; +DROP TABLE t1; +CREATE TABLE t1(c1 INT); +EXECUTE stmt USING @value; + +source include/show_binlog_events.inc; +let $binlog_start= query_get_value(SHOW MASTER STATUS, Position, 1); + +sync_slave_with_master; +let $diff_table_1=master:test.t1; +let $diff_table_2=slave:test.t1; +source include/diff_tables.inc; + +--echo +--echo # Case 3: +--echo # ----------------------------------------------------------------- +--echo # Verify it can restore the '!', if the it is an uncomplete conditional +--echo # comments +--error 1064 +SELECT c1 FROM /*!99999 t1 WHEREN; + +DROP TABLE t1; +source include/master-slave-end.inc; diff --git a/sql/mysql_priv.h b/sql/mysql_priv.h index 55bcd30999d..5f8458f4f1e 100644 --- a/sql/mysql_priv.h +++ b/sql/mysql_priv.h @@ -751,7 +751,7 @@ bool do_rename(THD *thd, TABLE_LIST *ren_table, char *new_db, bool mysql_change_db(THD *thd, const LEX_STRING *new_db_name, bool force_switch); -void mysql_parse(THD *thd, const char *inBuf, uint length, +void mysql_parse(THD *thd, char *rawbuf, uint length, const char ** semicolon); bool mysql_test_parse_for_slave(THD *thd,char *inBuf,uint length); diff --git a/sql/sql_lex.cc b/sql/sql_lex.cc index 17ee53d446b..a013d5466c1 100644 --- a/sql/sql_lex.cc +++ b/sql/sql_lex.cc @@ -109,7 +109,7 @@ st_parsing_options::reset() } Lex_input_stream::Lex_input_stream(THD *thd, - const char* buffer, + char* buffer, unsigned int length) : m_thd(thd), yylineno(1), @@ -580,7 +580,7 @@ int MYSQLlex(void *arg, void *yythd) state=MY_LEX_COMMENT; break; } - yylval->lex_str.str=(char*) (lip->ptr=lip->tok_start);// Set to first chr + yylval->lex_str.str=lip->ptr=(char*)lip->tok_start;// Set to first chr yylval->lex_str.length=1; c=yyGet(); if (c != ')') @@ -946,6 +946,9 @@ int MYSQLlex(void *arg, void *yythd) state = MY_LEX_START; // Try again break; case MY_LEX_LONG_COMMENT: /* Long C comment? */ + { + char *version_mark= NULL; + if (yyPeek() != '*') { state=MY_LEX_CHAR; // Probable division @@ -956,6 +959,8 @@ int MYSQLlex(void *arg, void *yythd) if (yyPeek() == '!') // MySQL command in comment { ulong version=MYSQL_VERSION_ID; + version_mark= lip->ptr; + yySkip(); state=MY_LEX_START; if (my_isdigit(cs,yyPeek())) @@ -964,9 +969,18 @@ int MYSQLlex(void *arg, void *yythd) } if (version <= MYSQL_VERSION_ID) { - lex->in_comment=1; + lex->in_comment=1; + version_mark= NULL; break; } + else + { + /* + Patch and skip the conditional comment to avoid it + being propagated infinitely (eg. to a slave). + */ + *version_mark= ' '; + } } /* Discard: @@ -995,8 +1009,13 @@ int MYSQLlex(void *arg, void *yythd) } /* Unbalanced comments with a missing '*' '/' are a syntax error */ if (! comment_closed) + { + if (version_mark != NULL) + *version_mark= '!'; return (ABORT_SYM); + } break; + } case MY_LEX_END_LONG_COMMENT: if (lex->in_comment && yyPeek() == '/') { diff --git a/sql/sql_lex.h b/sql/sql_lex.h index 5c0367632e1..7a315d81aa5 100644 --- a/sql/sql_lex.h +++ b/sql/sql_lex.h @@ -935,7 +935,7 @@ struct st_parsing_options class Lex_input_stream { public: - Lex_input_stream(THD *thd, const char* buff, unsigned int length); + Lex_input_stream(THD *thd, char* buff, unsigned int length); ~Lex_input_stream(); /** Current thread. */ @@ -951,7 +951,7 @@ public: LEX_YYSTYPE yylval; /** Pointer to the current position in the input stream. */ - const char* ptr; + char* ptr; /** Starting position of the last token parsed. */ const char* tok_start; @@ -966,7 +966,7 @@ public: const char* tok_start_prev; /** Begining of the query text in the input stream. */ - const char* buf; + char* buf; /** Current state of the lexical analyser. */ enum my_lex_states next_state; @@ -1355,7 +1355,7 @@ public: class Parser_state { public: - Parser_state(THD *thd, const char* buff, unsigned int length) + Parser_state(THD *thd, char* buff, unsigned int length) : m_lip(thd, buff, length), m_yacc() {} diff --git a/sql/sql_parse.cc b/sql/sql_parse.cc index 1bd68e5424f..0f75b835315 100644 --- a/sql/sql_parse.cc +++ b/sql/sql_parse.cc @@ -6414,13 +6414,13 @@ void mysql_init_multi_delete(LEX *lex) /** Parse a query. @param thd Current thread - @param inBuf Begining of the query text + @param rawbuf Begining of the query text @param length Length of the query text @param [out] semicolon For multi queries, position of the character of the next query in the query text. */ -void mysql_parse(THD *thd, const char *inBuf, uint length, +void mysql_parse(THD *thd, char *rawbuf, uint length, const char ** found_semicolon) { DBUG_ENTER("mysql_parse"); @@ -6446,14 +6446,14 @@ void mysql_parse(THD *thd, const char *inBuf, uint length, lex_start(thd); mysql_reset_thd_for_next_command(thd); - if (query_cache_send_result_to_client(thd, (char*) inBuf, length) <= 0) + if (query_cache_send_result_to_client(thd, rawbuf, length) <= 0) { LEX *lex= thd->lex; sp_cache_flush_obsolete(&thd->sp_proc_cache); sp_cache_flush_obsolete(&thd->sp_func_cache); - Parser_state parser_state(thd, inBuf, length); + Parser_state parser_state(thd, rawbuf, length); thd->m_parser_state= &parser_state; int err= MYSQLparse(thd); @@ -6538,13 +6538,13 @@ void mysql_parse(THD *thd, const char *inBuf, uint length, 1 can be ignored */ -bool mysql_test_parse_for_slave(THD *thd, char *inBuf, uint length) +bool mysql_test_parse_for_slave(THD *thd, char *rawbuf, uint length) { LEX *lex= thd->lex; bool error= 0; DBUG_ENTER("mysql_test_parse_for_slave"); - Parser_state parser_state(thd, inBuf, length); + Parser_state parser_state(thd, rawbuf, length); thd->m_parser_state= &parser_state; lex_start(thd); From 208b677637ef9d140c1629a0de4d4963c02ea533 Mon Sep 17 00:00:00 2001 From: Nirbhay Choubey Date: Sun, 16 Jan 2011 02:04:08 +0530 Subject: [PATCH 023/202] Bug#58221 : mysqladmin --sleep=x --count=x keeps looping When mysqldadmin is run with sleep and count options, it goes into an infinite loop and keeps executing the specified command. This happened because the statement, responsible for decrementing the count value, was missing. Fixed by adding a statement which will decrement the count value for each iteration. client/mysqladmin.cc: Bug#58221 : mysqladmin --sleep=x --count=x keeps looping Added a condition to check and decrement the count value stored in nr_iterations per iteration. mysql-test/r/mysqladmin.result: Added a testcase for Bug#58221. mysql-test/t/mysqladmin.test: Added a testcase for Bug#58221. --- client/mysqladmin.cc | 3 +++ mysql-test/r/mysqladmin.result | 8 ++++++++ mysql-test/t/mysqladmin.test | 12 ++++++++++++ 3 files changed, 23 insertions(+) diff --git a/client/mysqladmin.cc b/client/mysqladmin.cc index fe3e51a4d61..18ee8fae400 100644 --- a/client/mysqladmin.cc +++ b/client/mysqladmin.cc @@ -416,6 +416,9 @@ int main(int argc,char *argv[]) if (interval) /* --sleep=interval given */ { + if (opt_count_iterations && --nr_iterations == 0) + break; + /* If connection was dropped (unintentionally, or due to SHUTDOWN), re-establish it if --wait ("retry-connect") was given and user diff --git a/mysql-test/r/mysqladmin.result b/mysql-test/r/mysqladmin.result index 57927f8aa67..748152bffcc 100644 --- a/mysql-test/r/mysqladmin.result +++ b/mysql-test/r/mysqladmin.result @@ -2,3 +2,11 @@ mysqld is alive mysqladmin: unknown variable 'database=db1' Warning: mysqladmin: unknown variable 'loose-database=db2' mysqld is alive +# +# Bug#58221 : mysqladmin --sleep=x --count=x keeps looping +# +# Executing mysqladmin with --sleep=1 and --count=2. +# Done. +# Displaying the output : +mysqld is alive +mysqld is alive diff --git a/mysql-test/t/mysqladmin.test b/mysql-test/t/mysqladmin.test index 839ecf00b60..a2b12dbc9b6 100644 --- a/mysql-test/t/mysqladmin.test +++ b/mysql-test/t/mysqladmin.test @@ -33,3 +33,15 @@ EOF --exec $MYSQLADMIN --defaults-file=$MYSQLTEST_VARDIR/tmp/bug10608.cnf -S $MASTER_MYSOCK -P $MASTER_MYPORT -u root --password= ping 2>&1 remove_file $MYSQLTEST_VARDIR/tmp/bug10608.cnf; + +--echo # +--echo # Bug#58221 : mysqladmin --sleep=x --count=x keeps looping +--echo # + +--echo # Executing mysqladmin with --sleep=1 and --count=2. +--exec $MYSQLADMIN -u root -S $MASTER_MYSOCK -P $MASTER_MYPORT --sleep=1 --count=2 ping > $MYSQLTEST_VARDIR/tmp/mysqladmin.tmp +--echo # Done. +--echo # Displaying the output : +--cat_file $MYSQLTEST_VARDIR/tmp/mysqladmin.tmp + +--remove_file $MYSQLTEST_VARDIR/tmp/mysqladmin.tmp From a2850a2f5323bfe8eaae17746c88986cee37fc76 Mon Sep 17 00:00:00 2001 From: Alexander Barkov Date: Mon, 17 Jan 2011 12:30:22 +0300 Subject: [PATCH 024/202] Bug#59149 valgrind warnings with "like .. escape .." function Problem: when processing a query like: SELECT '' LIKE '1' ESCAPE COUNT(1); escape_item->val_str() was never executed and the "escape" class member stayed initialized, which led to valgrind uninitialized memory error. Note, a query with some tables in "FROM" clause returns ER_WRONG_ARGUMENTS in the same situation: SELECT '' LIKE '1' ESCAPE COUNT(1) FROM t1; ERROR 1210 (HY000): Incorrect arguments to ESCAPE Fix: disallowing using aggregate functions in ESCAPE clause, even if there are no tables used. There is no much use of that anyway. --- mysql-test/r/func_like.result | 5 +++++ mysql-test/t/func_like.test | 5 +++++ sql/item_sum.h | 1 + 3 files changed, 11 insertions(+) diff --git a/mysql-test/r/func_like.result b/mysql-test/r/func_like.result index 21da211160b..76174982e8e 100644 --- a/mysql-test/r/func_like.result +++ b/mysql-test/r/func_like.result @@ -182,4 +182,9 @@ INSERT INTO t2 VALUES (1), (2), (3); SELECT 1 FROM t2 JOIN t1 ON 1 LIKE a GROUP BY a; 1 DROP TABLE t1, t2; +# +# Bug#59149 valgrind warnings with "like .. escape .." function +# +SELECT '' LIKE '1' ESCAPE COUNT(1); +ERROR HY000: Incorrect arguments to ESCAPE End of 5.1 tests diff --git a/mysql-test/t/func_like.test b/mysql-test/t/func_like.test index 1204d04d9a0..f1fe52274b2 100644 --- a/mysql-test/t/func_like.test +++ b/mysql-test/t/func_like.test @@ -126,5 +126,10 @@ INSERT INTO t2 VALUES (1), (2), (3); SELECT 1 FROM t2 JOIN t1 ON 1 LIKE a GROUP BY a; DROP TABLE t1, t2; +--echo # +--echo # Bug#59149 valgrind warnings with "like .. escape .." function +--echo # +--error ER_WRONG_ARGUMENTS +SELECT '' LIKE '1' ESCAPE COUNT(1); --echo End of 5.1 tests diff --git a/sql/item_sum.h b/sql/item_sum.h index de988c196ec..f8819d63bf4 100644 --- a/sql/item_sum.h +++ b/sql/item_sum.h @@ -339,6 +339,7 @@ public: forced_const= TRUE; } virtual bool const_item() const { return forced_const; } + virtual bool const_during_execution() const { return false; } virtual void print(String *str, enum_query_type query_type); void fix_num_length_and_dec(); From 1f3975b4f8b22eef97b2d86b8ecbc17c90c5f1ea Mon Sep 17 00:00:00 2001 From: =?UTF-8?q?Marko=20M=C3=A4kel=C3=A4?= Date: Mon, 17 Jan 2011 14:06:48 +0200 Subject: [PATCH 025/202] Non-functional changes. Remove the unused data type dict_cluster_t. Remove a bogus comment about latching order. --- storage/innobase/include/dict0types.h | 5 ----- storage/innobase/include/trx0rseg.h | 4 +--- storage/innodb_plugin/include/dict0types.h | 5 ----- storage/innodb_plugin/include/trx0rseg.h | 4 +--- 4 files changed, 2 insertions(+), 16 deletions(-) diff --git a/storage/innobase/include/dict0types.h b/storage/innobase/include/dict0types.h index b90545f2105..6674b5ff397 100644 --- a/storage/innobase/include/dict0types.h +++ b/storage/innobase/include/dict0types.h @@ -16,11 +16,6 @@ typedef struct dict_index_struct dict_index_t; typedef struct dict_table_struct dict_table_t; typedef struct dict_foreign_struct dict_foreign_t; -/* A cluster object is a table object with the type field set to -DICT_CLUSTERED */ - -typedef dict_table_t dict_cluster_t; - typedef struct ind_node_struct ind_node_t; typedef struct tab_node_struct tab_node_t; diff --git a/storage/innobase/include/trx0rseg.h b/storage/innobase/include/trx0rseg.h index 46ba010bd1d..22f8aa89181 100644 --- a/storage/innobase/include/trx0rseg.h +++ b/storage/innobase/include/trx0rseg.h @@ -121,9 +121,7 @@ struct trx_rseg_struct{ ulint id; /* rollback segment id == the index of its slot in the trx system file copy */ mutex_t mutex; /* mutex protecting the fields in this - struct except id; NOTE that the latching - order must always be kernel mutex -> - rseg mutex */ + struct except id, which is constant */ ulint space; /* space where the rollback segment is header is placed */ ulint page_no;/* page number of the rollback segment diff --git a/storage/innodb_plugin/include/dict0types.h b/storage/innodb_plugin/include/dict0types.h index 7ad69193cc9..f14b59a19d4 100644 --- a/storage/innodb_plugin/include/dict0types.h +++ b/storage/innodb_plugin/include/dict0types.h @@ -33,11 +33,6 @@ typedef struct dict_index_struct dict_index_t; typedef struct dict_table_struct dict_table_t; typedef struct dict_foreign_struct dict_foreign_t; -/* A cluster object is a table object with the type field set to -DICT_CLUSTERED */ - -typedef dict_table_t dict_cluster_t; - typedef struct ind_node_struct ind_node_t; typedef struct tab_node_struct tab_node_t; diff --git a/storage/innodb_plugin/include/trx0rseg.h b/storage/innodb_plugin/include/trx0rseg.h index a25d84f1e84..e3674089735 100644 --- a/storage/innodb_plugin/include/trx0rseg.h +++ b/storage/innodb_plugin/include/trx0rseg.h @@ -135,9 +135,7 @@ struct trx_rseg_struct{ ulint id; /*!< rollback segment id == the index of its slot in the trx system file copy */ mutex_t mutex; /*!< mutex protecting the fields in this - struct except id; NOTE that the latching - order must always be kernel mutex -> - rseg mutex */ + struct except id, which is constant */ ulint space; /*!< space where the rollback segment is header is placed */ ulint zip_size;/* compressed page size of space From 6665ca25afdeea7a3fd2db0094d3f67af37e14ba Mon Sep 17 00:00:00 2001 From: Alexander Barkov Date: Mon, 17 Jan 2011 15:11:33 +0300 Subject: [PATCH 026/202] Bug#58371 Assertion failed: !s.uses_buffer_owned_by(this) with format string function Introduced by the fix for bug#44766. Problem: it's not correct to use args[0]->str_value as a buffer, because args[0] may need this buffer for its own purposes. Fix: adding a new class member tmp_value to use as return value. @ mysql-test/r/ctype_many.result @ mysql-test/t/ctype_many.test Adding tests @ sql/item_strfunc.cc Changing code into traditional style: use "str" as a buffer for the argument and tmp_value for the result value. @ sql/item_strfunc.h Adding tmp_value --- mysql-test/r/ctype_many.result | 15 +++++++++++++++ mysql-test/t/ctype_many.test | 16 ++++++++++++++++ sql/item_strfunc.cc | 12 +++--------- sql/item_strfunc.h | 1 + 4 files changed, 35 insertions(+), 9 deletions(-) diff --git a/mysql-test/r/ctype_many.result b/mysql-test/r/ctype_many.result index 89e05bf4484..dbec746cdae 100644 --- a/mysql-test/r/ctype_many.result +++ b/mysql-test/r/ctype_many.result @@ -1683,3 +1683,18 @@ ARMENIAN CAPIT DA 2 ARMENIAN CAPIT ECH 2 ARMENIAN CAPIT ZA 2 DROP TABLE t1; +# +# Start of 5.1 tests +# +# +# Bug#58371 Assertion failed: !s.uses_buffer_owned_by(this) with format string function +# +SET NAMES latin1; +DO CONVERT(CAST(SUBSTRING_INDEX(FORMAT(1,'1111'), FORMAT('','Zpq'),1) +AS BINARY(0)) USING utf8); +Warnings: +Warning 1292 Truncated incorrect INTEGER value: 'Zpq' +Warning 1292 Truncated incorrect BINARY(0) value: '1.' +# +# End of 5.1 tests +# diff --git a/mysql-test/t/ctype_many.test b/mysql-test/t/ctype_many.test index 0903c3dd7fa..84048761228 100644 --- a/mysql-test/t/ctype_many.test +++ b/mysql-test/t/ctype_many.test @@ -211,3 +211,19 @@ SELECT min(comment),count(*) FROM t1 GROUP BY ucs2_f; DROP TABLE t1; # End of 4.1 tests + + +--echo # +--echo # Start of 5.1 tests +--echo # + +--echo # +--echo # Bug#58371 Assertion failed: !s.uses_buffer_owned_by(this) with format string function +--echo # + +SET NAMES latin1; +DO CONVERT(CAST(SUBSTRING_INDEX(FORMAT(1,'1111'), FORMAT('','Zpq'),1) + AS BINARY(0)) USING utf8); +--echo # +--echo # End of 5.1 tests +--echo # diff --git a/sql/item_strfunc.cc b/sql/item_strfunc.cc index 204a2dfc663..c637c9c29b8 100644 --- a/sql/item_strfunc.cc +++ b/sql/item_strfunc.cc @@ -2761,22 +2761,16 @@ String *Item_func_conv_charset::val_str(String *str) DBUG_ASSERT(fixed == 1); if (use_cached_value) return null_value ? 0 : &str_value; - /* - Here we don't pass 'str' as a parameter to args[0]->val_str() - as 'str' may point to 'str_value' (e.g. see Item::save_in_field()), - which we use below to convert string. - Use argument's 'str_value' instead. - */ - String *arg= args[0]->val_str(&args[0]->str_value); + String *arg= args[0]->val_str(str); uint dummy_errors; if (!arg) { null_value=1; return 0; } - null_value= str_value.copy(arg->ptr(),arg->length(),arg->charset(), + null_value= tmp_value.copy(arg->ptr(), arg->length(), arg->charset(), conv_charset, &dummy_errors); - return null_value ? 0 : check_well_formed_result(&str_value); + return null_value ? 0 : check_well_formed_result(&tmp_value); } void Item_func_conv_charset::fix_length_and_dec() diff --git a/sql/item_strfunc.h b/sql/item_strfunc.h index 6645a4c637a..408062ddc08 100644 --- a/sql/item_strfunc.h +++ b/sql/item_strfunc.h @@ -713,6 +713,7 @@ public: class Item_func_conv_charset :public Item_str_func { bool use_cached_value; + String tmp_value; public: bool safe; CHARSET_INFO *conv_charset; // keep it public From afa2ec12d076947d70baa10a5dd4922fa483a1a4 Mon Sep 17 00:00:00 2001 From: Vinay Fisrekar Date: Tue, 18 Jan 2011 09:24:52 +0530 Subject: [PATCH 027/202] BUG#58858 : sys_vars.innodb_max_dirty_pages_pct_func fails sporadically Committing After latest merge. Modified check_pct procedure to check return value of wait condition instead of calling "dirty_pct". Adding Review comments: 1) Added comment for success variable value 2) Procedure check_pct changed For Adding BOOLEAN input and SELECT QUERY Change --- .../sys_vars/r/innodb_max_dirty_pages_pct_func.result | 8 ++++---- .../sys_vars/t/innodb_max_dirty_pages_pct_func.test | 9 +++++---- 2 files changed, 9 insertions(+), 8 deletions(-) diff --git a/mysql-test/suite/sys_vars/r/innodb_max_dirty_pages_pct_func.result b/mysql-test/suite/sys_vars/r/innodb_max_dirty_pages_pct_func.result index baf06092126..55de5adbc33 100644 --- a/mysql-test/suite/sys_vars/r/innodb_max_dirty_pages_pct_func.result +++ b/mysql-test/suite/sys_vars/r/innodb_max_dirty_pages_pct_func.result @@ -64,12 +64,12 @@ SET last = pct; END IF; END WHILE; END// -CREATE PROCEDURE check_pct(IN num DECIMAL) +CREATE PROCEDURE check_pct(IN success_on_wait BOOLEAN) BEGIN -IF (dirty_pct() < num) THEN +IF (success_on_wait > 0) THEN SELECT 'BELOW_MAX' AS PCT_VALUE; ELSE -SELECT 'ABOVE_MAX' AS PCT_VALUE; +SELECT 'ABOVE_MAX or TimeOut Of The Test' AS PCT_VALUE; END IF; END// CREATE TABLE t1( @@ -83,7 +83,7 @@ CALL add_until(10); FLUSH TABLES; CALL add_records(500); 'We expect dirty pages pct to be BELOW_MAX after some time depending on performance' -CALL check_pct(10); +CALL check_pct(1); PCT_VALUE BELOW_MAX DROP PROCEDURE add_records; diff --git a/mysql-test/suite/sys_vars/t/innodb_max_dirty_pages_pct_func.test b/mysql-test/suite/sys_vars/t/innodb_max_dirty_pages_pct_func.test index b577ae5fcc4..c7a9e567e69 100644 --- a/mysql-test/suite/sys_vars/t/innodb_max_dirty_pages_pct_func.test +++ b/mysql-test/suite/sys_vars/t/innodb_max_dirty_pages_pct_func.test @@ -117,12 +117,12 @@ BEGIN END WHILE; END// -CREATE PROCEDURE check_pct(IN num DECIMAL) +CREATE PROCEDURE check_pct(IN success_on_wait BOOLEAN) BEGIN - IF (dirty_pct() < num) THEN + IF (success_on_wait > 0) THEN SELECT 'BELOW_MAX' AS PCT_VALUE; ELSE - SELECT 'ABOVE_MAX' AS PCT_VALUE; + SELECT 'ABOVE_MAX or TimeOut Of The Test' AS PCT_VALUE; END IF; END// @@ -155,7 +155,8 @@ let $wait_condition= SELECT (dirty_pct() <= @@global.innodb_max_dirty_pages_pct) --source include/wait_condition.inc --echo 'We expect dirty pages pct to be BELOW_MAX after some time depending on performance' -CALL check_pct(10); +# Value For $sucess will be set from include/wait_condition.inc file. It can have values 1 or 0. It will be 1 if dirty_pct() <= @@global.innodb_max_dirty_pages_pct else it will be 0. +eval CALL check_pct($success); DROP PROCEDURE add_records; DROP PROCEDURE add_until; DROP PROCEDURE check_pct; From 5574a2cd91eaf76fd2263b38d64d8c617d3c1d02 Mon Sep 17 00:00:00 2001 From: Alexander Barkov Date: Tue, 18 Jan 2011 09:38:41 +0300 Subject: [PATCH 028/202] Bug#44332 my_xml_scan reads behind the end of buffer Problem: the scanner function tested for strings "" without checking input string boundaries, which led to valgrind's "Conditional jump or move depends on uninitialised value(s)" error. Fix: Adding boundary checking. @ mysql-test/r/xml.result @ mysql-test/t/xml.test Adding test @ strings/xml.c Adding a helper function my_xml_parser_prefix_cmp(), with input string boundary check. --- mysql-test/r/xml.result | 11 +++++++++++ mysql-test/t/xml.test | 5 +++++ strings/xml.c | 23 +++++++++++++++++------ 3 files changed, 33 insertions(+), 6 deletions(-) diff --git a/mysql-test/r/xml.result b/mysql-test/r/xml.result index 92f84381415..0a71a596505 100644 --- a/mysql-test/r/xml.result +++ b/mysql-test/r/xml.result @@ -1113,4 +1113,15 @@ SELECT UPDATEXML(NULL, (LPAD(0.1111E-15, '2011', 1)), 1); ERROR 22007: Illegal double '111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111' value found during parsing SELECT EXTRACTVALUE('', LPAD(0.1111E-15, '2011', 1)); ERROR 22007: Illegal double '111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111' value found during parsing +# +# Bug #44332 my_xml_scan reads behind the end of buffer +# +SELECT UPDATEXML(CONVERT(_latin1'<' USING utf8),'1','1'); +UPDATEXML(CONVERT(_latin1'<' USING utf8),'1','1') +NULL +Warnings: +Warning 1525 Incorrect XML value: 'parse error at line 1 pos 2: END-OF-INPUT unexpected (ident or '/' wanted)' +SELECT UPDATEXML(CONVERT(_latin1'", 3); p->cur++) - {} - if (!memcmp(p->cur, "-->", 3)) - p->cur+=3; + for (; p->cur < p->end; p->cur++) + { + if (!my_xml_parser_prefix_cmp(p, C_STRING_WITH_LEN("-->"))) + { + p->cur+= 3; + break; + } + } a->end=p->cur; lex=MY_XML_COMMENT; } - else if (!memcmp(p->cur, "cur+= 9; for (; p->cur < p->end - 2 ; p->cur++) From 5a85609d6be1ab6dd56489c70c5640c43aba33c2 Mon Sep 17 00:00:00 2001 From: Bjorn Munch Date: Tue, 18 Jan 2011 11:03:44 +0100 Subject: [PATCH 029/202] Fixed copyright headers in mtr src files --- client/mysqltest.cc | 4 ++-- mysql-test/Makefile.am | 9 ++++----- mysql-test/lib/My/ConfigFactory.pm | 16 ++++++++++++++++ mysql-test/lib/My/CoreDump.pm | 2 +- mysql-test/lib/My/File/Path.pm | 15 +++++++++++++++ mysql-test/lib/My/Find.pm | 2 +- mysql-test/lib/My/Options.pm | 2 +- mysql-test/lib/My/Platform.pm | 2 +- mysql-test/lib/My/SafeProcess.pm | 13 +++++++------ mysql-test/lib/My/SafeProcess/Base.pm | 2 +- mysql-test/lib/My/SafeProcess/CMakeLists.txt | 2 +- mysql-test/lib/My/SafeProcess/Makefile.am | 2 +- .../lib/My/SafeProcess/safe_kill_win.cc | 2 +- mysql-test/lib/My/SafeProcess/safe_process.cc | 2 +- .../lib/My/SafeProcess/safe_process_win.cc | 2 +- mysql-test/lib/My/SysInfo.pm | 2 +- mysql-test/lib/My/Test.pm | 14 ++++++++++++++ mysql-test/lib/mtr_misc.pl | 19 ++++++++++--------- mysql-test/lib/mtr_report.pm | 2 +- mysql-test/mysql-stress-test.pl | 9 ++++----- mysql-test/mysql-test-run.pl | 7 +++---- mysql-test/valgrind.supp | 9 ++++----- 22 files changed, 91 insertions(+), 48 deletions(-) diff --git a/client/mysqltest.cc b/client/mysqltest.cc index feed964c2fa..9421e80de2d 100644 --- a/client/mysqltest.cc +++ b/client/mysqltest.cc @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by @@ -11,7 +11,7 @@ You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software - Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA */ + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA */ /* mysqltest diff --git a/mysql-test/Makefile.am b/mysql-test/Makefile.am index ced8b894a6d..f3b4343f9a0 100644 --- a/mysql-test/Makefile.am +++ b/mysql-test/Makefile.am @@ -1,4 +1,4 @@ -# Copyright (C) 2000-2006 MySQL AB +# Copyright (c) 2000, 2010, Oracle and/or its affiliates. All rights reserved. # # This program is free software; you can redistribute it and/or # modify it under the terms of the GNU Library General Public @@ -10,10 +10,9 @@ # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU # Library General Public License for more details. # -# You should have received a copy of the GNU Library General Public -# License along with this library; if not, write to the Free -# Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, -# MA 02111-1307, USA +# You should have received a copy of the GNU General Public License +# along with this program; if not, write to the Free Software +# Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA ## Process this file with automake to create Makefile.in diff --git a/mysql-test/lib/My/ConfigFactory.pm b/mysql-test/lib/My/ConfigFactory.pm index 342390edef8..bb990a9f8d2 100644 --- a/mysql-test/lib/My/ConfigFactory.pm +++ b/mysql-test/lib/My/ConfigFactory.pm @@ -1,4 +1,20 @@ # -*- cperl -*- +# Copyright (c) 2008, 2010, Oracle and/or its affiliates. All rights reserved. +# +# This program is free software; you can redistribute it and/or +# modify it under the terms of the GNU Library General Public +# License as published by the Free Software Foundation; version 2 +# of the License. +# +# This program is distributed in the hope that it will be useful, +# but WITHOUT ANY WARRANTY; without even the implied warranty of +# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU +# Library General Public License for more details. +# +# You should have received a copy of the GNU General Public License +# along with this program; if not, write to the Free Software +# Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA + package My::ConfigFactory; use strict; diff --git a/mysql-test/lib/My/CoreDump.pm b/mysql-test/lib/My/CoreDump.pm index 3ac9e385070..c0f6535b96e 100644 --- a/mysql-test/lib/My/CoreDump.pm +++ b/mysql-test/lib/My/CoreDump.pm @@ -1,5 +1,5 @@ # -*- cperl -*- -# Copyright (C) 2004-2006 MySQL AB +# Copyright (C) 2008 MySQL AB, 2009 Sun Microsystems, Inc. # # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by diff --git a/mysql-test/lib/My/File/Path.pm b/mysql-test/lib/My/File/Path.pm index 25a26568eee..d1ac2b432ac 100644 --- a/mysql-test/lib/My/File/Path.pm +++ b/mysql-test/lib/My/File/Path.pm @@ -1,4 +1,19 @@ # -*- cperl -*- +# Copyright (C) 2008 MySQL AB, 2009 Sun Microsystems, Inc. +# +# This program is free software; you can redistribute it and/or modify +# it under the terms of the GNU General Public License as published by +# the Free Software Foundation; version 2 of the License. +# +# This program is distributed in the hope that it will be useful, +# but WITHOUT ANY WARRANTY; without even the implied warranty of +# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the +# GNU General Public License for more details. +# +# You should have received a copy of the GNU General Public License +# along with this program; if not, write to the Free Software +# Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA + package My::File::Path; use strict; diff --git a/mysql-test/lib/My/Find.pm b/mysql-test/lib/My/Find.pm index 8557584bbc8..9c89a7e4e2a 100644 --- a/mysql-test/lib/My/Find.pm +++ b/mysql-test/lib/My/Find.pm @@ -1,5 +1,5 @@ # -*- cperl -*- -# Copyright (C) 2004-2006 MySQL AB +# Copyright (C) 2008 MySQL AB # # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by diff --git a/mysql-test/lib/My/Options.pm b/mysql-test/lib/My/Options.pm index 40f05c41d1c..6e8cf7ec919 100644 --- a/mysql-test/lib/My/Options.pm +++ b/mysql-test/lib/My/Options.pm @@ -1,5 +1,5 @@ # -*- cperl -*- -# Copyright (C) 2004-2006 MySQL AB +# Copyright (C) 2008 MySQL AB # # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by diff --git a/mysql-test/lib/My/Platform.pm b/mysql-test/lib/My/Platform.pm index 371120ab644..cbe8f929d71 100644 --- a/mysql-test/lib/My/Platform.pm +++ b/mysql-test/lib/My/Platform.pm @@ -1,5 +1,5 @@ # -*- cperl -*- -# Copyright (C) 2004-2006 MySQL AB +# Copyright (C) 2008 MySQL AB, 2009 Sun Microsystems, Inc. # # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by diff --git a/mysql-test/lib/My/SafeProcess.pm b/mysql-test/lib/My/SafeProcess.pm index a4ae988ed9e..9334d97f665 100644 --- a/mysql-test/lib/My/SafeProcess.pm +++ b/mysql-test/lib/My/SafeProcess.pm @@ -1,14 +1,15 @@ # -*- cperl -*- -# Copyright (C) 2004-2006 MySQL AB +# Copyright (c) 2008, 2010, Oracle and/or its affiliates. All rights reserved. # -# This program is free software; you can redistribute it and/or modify -# it under the terms of the GNU General Public License as published by -# the Free Software Foundation; version 2 of the License. +# This program is free software; you can redistribute it and/or +# modify it under the terms of the GNU Library General Public +# License as published by the Free Software Foundation; version 2 +# of the License. # # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of -# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the -# GNU General Public License for more details. +# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU +# Library General Public License for more details. # # You should have received a copy of the GNU General Public License # along with this program; if not, write to the Free Software diff --git a/mysql-test/lib/My/SafeProcess/Base.pm b/mysql-test/lib/My/SafeProcess/Base.pm index 9a6871264b8..c0c70e48082 100644 --- a/mysql-test/lib/My/SafeProcess/Base.pm +++ b/mysql-test/lib/My/SafeProcess/Base.pm @@ -1,5 +1,5 @@ # -*- cperl -*- -# Copyright (C) 2004-2006 MySQL AB +# Copyright (C) 2008 MySQL AB, 2009 Sun Microsystems, Inc. # # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by diff --git a/mysql-test/lib/My/SafeProcess/CMakeLists.txt b/mysql-test/lib/My/SafeProcess/CMakeLists.txt index 97fab820f95..5150fcaafff 100644 --- a/mysql-test/lib/My/SafeProcess/CMakeLists.txt +++ b/mysql-test/lib/My/SafeProcess/CMakeLists.txt @@ -1,4 +1,4 @@ -# Copyright (C) 2006 MySQL AB +# Copyright (C) 2008 MySQL AB # # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by diff --git a/mysql-test/lib/My/SafeProcess/Makefile.am b/mysql-test/lib/My/SafeProcess/Makefile.am index 722331453fe..eb665240190 100644 --- a/mysql-test/lib/My/SafeProcess/Makefile.am +++ b/mysql-test/lib/My/SafeProcess/Makefile.am @@ -1,4 +1,4 @@ -# Copyright (C) 2000-2006 MySQL AB +# Copyright (C) 2008 MySQL AB # # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by diff --git a/mysql-test/lib/My/SafeProcess/safe_kill_win.cc b/mysql-test/lib/My/SafeProcess/safe_kill_win.cc index 963a02c8099..9b013b960bf 100755 --- a/mysql-test/lib/My/SafeProcess/safe_kill_win.cc +++ b/mysql-test/lib/My/SafeProcess/safe_kill_win.cc @@ -1,4 +1,4 @@ -/* Copyright (C) 2004 MySQL AB +/* Copyright (C) 2008 MySQL AB, 2009 Sun Microsystems, Inc. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/mysql-test/lib/My/SafeProcess/safe_process.cc b/mysql-test/lib/My/SafeProcess/safe_process.cc index 1c778362975..477beca0ada 100644 --- a/mysql-test/lib/My/SafeProcess/safe_process.cc +++ b/mysql-test/lib/My/SafeProcess/safe_process.cc @@ -1,4 +1,4 @@ -/* Copyright (C) 2008 MySQL AB +/* Copyright (C) 2008 MySQL AB, 2009 Sun Microsystems, Inc. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/mysql-test/lib/My/SafeProcess/safe_process_win.cc b/mysql-test/lib/My/SafeProcess/safe_process_win.cc index 896bd599f4f..931705e1911 100755 --- a/mysql-test/lib/My/SafeProcess/safe_process_win.cc +++ b/mysql-test/lib/My/SafeProcess/safe_process_win.cc @@ -1,4 +1,4 @@ -/* Copyright (C) 2004 MySQL AB +/* Copyright (C) 2008 MySQL AB, 2009 Sun Microsystems, Inc. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/mysql-test/lib/My/SysInfo.pm b/mysql-test/lib/My/SysInfo.pm index f1ba5fb610f..b8569e415e8 100644 --- a/mysql-test/lib/My/SysInfo.pm +++ b/mysql-test/lib/My/SysInfo.pm @@ -1,5 +1,5 @@ # -*- cperl -*- -# Copyright (C) 2004-2006 MySQL AB +# Copyright (C) 2008 MySQL AB # # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by diff --git a/mysql-test/lib/My/Test.pm b/mysql-test/lib/My/Test.pm index 68b100f91af..c756a677052 100644 --- a/mysql-test/lib/My/Test.pm +++ b/mysql-test/lib/My/Test.pm @@ -1,4 +1,18 @@ # -*- cperl -*- +# Copyright (C) 2008 MySQL AB +# +# This program is free software; you can redistribute it and/or modify +# it under the terms of the GNU General Public License as published by +# the Free Software Foundation; version 2 of the License. +# +# This program is distributed in the hope that it will be useful, +# but WITHOUT ANY WARRANTY; without even the implied warranty of +# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the +# GNU General Public License for more details. +# +# You should have received a copy of the GNU General Public License +# along with this program; if not, write to the Free Software +# Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA # diff --git a/mysql-test/lib/mtr_misc.pl b/mysql-test/lib/mtr_misc.pl index 32960d866ce..1b988f42242 100644 --- a/mysql-test/lib/mtr_misc.pl +++ b/mysql-test/lib/mtr_misc.pl @@ -1,15 +1,16 @@ # -*- cperl -*- -# Copyright (C) 2004-2006 MySQL AB -# -# This program is free software; you can redistribute it and/or modify -# it under the terms of the GNU General Public License as published by -# the Free Software Foundation; version 2 of the License. -# +# Copyright (c) 2004, 2010, Oracle and/or its affiliates. All rights reserved. +# +# This program is free software; you can redistribute it and/or +# modify it under the terms of the GNU Library General Public +# License as published by the Free Software Foundation; version 2 +# of the License. +# # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of -# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the -# GNU General Public License for more details. -# +# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU +# Library General Public License for more details. +# # You should have received a copy of the GNU General Public License # along with this program; if not, write to the Free Software # Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA diff --git a/mysql-test/lib/mtr_report.pm b/mysql-test/lib/mtr_report.pm index 42d93022392..0090316cf7b 100644 --- a/mysql-test/lib/mtr_report.pm +++ b/mysql-test/lib/mtr_report.pm @@ -1,5 +1,5 @@ # -*- cperl -*- -# Copyright 2004-2008 MySQL AB, 2008 Sun Microsystems, Inc. +# Copyright (c) 2004, 2011, Oracle and/or its affiliates. All rights reserved. # # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by diff --git a/mysql-test/mysql-stress-test.pl b/mysql-test/mysql-stress-test.pl index 06954de38ca..2db8b748d5c 100755 --- a/mysql-test/mysql-stress-test.pl +++ b/mysql-test/mysql-stress-test.pl @@ -1,6 +1,6 @@ #!/usr/bin/perl -# Copyright (C) 2005, 2006 MySQL AB +# Copyright (c) 2005, 2010, Oracle and/or its affiliates. All rights reserved. # # This program is free software; you can redistribute it and/or # modify it under the terms of the GNU Library General Public @@ -12,10 +12,9 @@ # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU # Library General Public License for more details. # -# You should have received a copy of the GNU Library General Public -# License along with this library; if not, write to the Free -# Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, -# MA 02111-1307, USA +# You should have received a copy of the GNU General Public License +# along with this program; if not, write to the Free Software +# Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA # ====================================================================== # MySQL server stress test system diff --git a/mysql-test/mysql-test-run.pl b/mysql-test/mysql-test-run.pl index e10c1116f2c..ebf3976033b 100755 --- a/mysql-test/mysql-test-run.pl +++ b/mysql-test/mysql-test-run.pl @@ -13,10 +13,9 @@ # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU # Library General Public License for more details. # -# You should have received a copy of the GNU Library General Public -# License along with this library; if not, write to the Free -# Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, -# MA 02111-1307, USA +# You should have received a copy of the GNU General Public License +# along with this program; if not, write to the Free Software +# Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA # ############################################################################## diff --git a/mysql-test/valgrind.supp b/mysql-test/valgrind.supp index 24ce2e22e54..1016923a360 100644 --- a/mysql-test/valgrind.supp +++ b/mysql-test/valgrind.supp @@ -1,4 +1,4 @@ -# Copyright (C) 2005, 2008 MySQL AB +# Copyright (c) 2005, 2010, Oracle and/or its affiliates. All rights reserved. # # This program is free software; you can redistribute it and/or # modify it under the terms of the GNU Library General Public @@ -10,10 +10,9 @@ # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU # Library General Public License for more details. # -# You should have received a copy of the GNU Library General Public -# License along with this library; if not, write to the Free -# Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, -# MA 02111-1307, USA +# You should have received a copy of the GNU General Public License +# along with this program; if not, write to the Free Software +# Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA # # Suppress some common (not fatal) errors in system libraries found by valgrind From 359bddbee1a27864a38195e85fceab8a1678081d Mon Sep 17 00:00:00 2001 From: =?UTF-8?q?Marko=20M=C3=A4kel=C3=A4?= Date: Tue, 18 Jan 2011 12:25:13 +0200 Subject: [PATCH 030/202] Bug#59579 rw_lock_debug_print outputs to stderr rw_lock_debug_print(): Add parameter FILE* for specifying the output stream. rw_lock_list_print_info(): Invoke rw_lock_debug_print() on file, not stderr. --- storage/innobase/include/sync0rw.h | 3 ++- storage/innobase/sync/sync0arr.c | 4 ++-- storage/innobase/sync/sync0rw.c | 19 ++++++++++--------- storage/innodb_plugin/ChangeLog | 6 ++++++ storage/innodb_plugin/include/sync0rw.h | 3 ++- storage/innodb_plugin/sync/sync0arr.c | 4 ++-- storage/innodb_plugin/sync/sync0rw.c | 19 ++++++++++--------- 7 files changed, 34 insertions(+), 24 deletions(-) diff --git a/storage/innobase/include/sync0rw.h b/storage/innobase/include/sync0rw.h index 008df80a2c7..dd898557d6e 100644 --- a/storage/innobase/include/sync0rw.h +++ b/storage/innobase/include/sync0rw.h @@ -1,7 +1,7 @@ /****************************************************** The read-write lock (for threads, not for database transactions) -(c) 1995 Innobase Oy +Copyright (c) 1995, 2011, Oracle and/or its affiliates. All Rights Reserved. Created 9/11/1995 Heikki Tuuri *******************************************************/ @@ -409,6 +409,7 @@ Prints info of a debug struct. */ void rw_lock_debug_print( /*================*/ + FILE* f, /* in: output stream */ rw_lock_debug_t* info); /* in: debug struct */ #endif /* UNIV_SYNC_DEBUG */ diff --git a/storage/innobase/sync/sync0arr.c b/storage/innobase/sync/sync0arr.c index 154593a9035..41d3492c8c9 100644 --- a/storage/innobase/sync/sync0arr.c +++ b/storage/innobase/sync/sync0arr.c @@ -1,7 +1,7 @@ /****************************************************** The wait array used in synchronization primitives -(c) 1995 Innobase Oy +Copyright (c) 1995, 2011, Oracle and/or its affiliates. All Rights Reserved. Created 9/5/1995 Heikki Tuuri *******************************************************/ @@ -709,7 +709,7 @@ print: fprintf(stderr, "rw-lock %p ", (void*) lock); sync_array_cell_print(stderr, cell); - rw_lock_debug_print(debug); + rw_lock_debug_print(stderr, debug); return(TRUE); } } diff --git a/storage/innobase/sync/sync0rw.c b/storage/innobase/sync/sync0rw.c index 0b05fb826ac..ef4c07e8c26 100644 --- a/storage/innobase/sync/sync0rw.c +++ b/storage/innobase/sync/sync0rw.c @@ -1,7 +1,7 @@ /****************************************************** The read-write lock (for thread synchronization) -(c) 1995 Innobase Oy +Copyright (c) 1995, 2011, Oracle and/or its affiliates. All Rights Reserved. Created 9/11/1995 Heikki Tuuri *******************************************************/ @@ -830,7 +830,7 @@ rw_lock_list_print_info( info = UT_LIST_GET_FIRST(lock->debug_list); while (info != NULL) { - rw_lock_debug_print(info); + rw_lock_debug_print(file, info); info = UT_LIST_GET_NEXT(list, info); } } @@ -870,7 +870,7 @@ rw_lock_print( info = UT_LIST_GET_FIRST(lock->debug_list); while (info != NULL) { - rw_lock_debug_print(info); + rw_lock_debug_print(stderr, info); info = UT_LIST_GET_NEXT(list, info); } } @@ -882,28 +882,29 @@ Prints info of a debug struct. */ void rw_lock_debug_print( /*================*/ + FILE* f, /* in: output stream */ rw_lock_debug_t* info) /* in: debug struct */ { ulint rwt; rwt = info->lock_type; - fprintf(stderr, "Locked: thread %lu file %s line %lu ", + fprintf(f, "Locked: thread %lu file %s line %lu ", (ulong) os_thread_pf(info->thread_id), info->file_name, (ulong) info->line); if (rwt == RW_LOCK_SHARED) { - fputs("S-LOCK", stderr); + fputs("S-LOCK", f); } else if (rwt == RW_LOCK_EX) { - fputs("X-LOCK", stderr); + fputs("X-LOCK", f); } else if (rwt == RW_LOCK_WAIT_EX) { - fputs("WAIT X-LOCK", stderr); + fputs("WAIT X-LOCK", f); } else { ut_error; } if (info->pass != 0) { - fprintf(stderr, " pass value %lu", (ulong) info->pass); + fprintf(f, " pass value %lu", (ulong) info->pass); } - putc('\n', stderr); + putc('\n', f); } /******************************************************************* diff --git a/storage/innodb_plugin/ChangeLog b/storage/innodb_plugin/ChangeLog index 43ffa762ddb..4d35bcff4a1 100644 --- a/storage/innodb_plugin/ChangeLog +++ b/storage/innodb_plugin/ChangeLog @@ -1,3 +1,9 @@ +2011-01-18 The InnoDB Team + + * include/sync0rw.h, sync/sync0arr.c, sync/sync0rw.c: + Fix Bug#59579 rw_lock_debug_print outputs to stderr, not to + SHOW ENGINE INNODB STATUS + 2011-01-14 The InnoDB Team * btr/btr0cur.c, dict/dict0dict.c, handler/ha_innodb.cc, include/btr0cur.h, include/dict0mem.h, include/rem0cmp.h, diff --git a/storage/innodb_plugin/include/sync0rw.h b/storage/innodb_plugin/include/sync0rw.h index 175f3deb77c..47f7dbfe0eb 100644 --- a/storage/innodb_plugin/include/sync0rw.h +++ b/storage/innodb_plugin/include/sync0rw.h @@ -1,6 +1,6 @@ /***************************************************************************** -Copyright (c) 1995, 2010, Innobase Oy. All Rights Reserved. +Copyright (c) 1995, 2011, Oracle and/or its affiliates. All Rights Reserved. Copyright (c) 2008, Google Inc. Portions of this file contain modifications contributed and copyrighted by @@ -490,6 +490,7 @@ UNIV_INTERN void rw_lock_debug_print( /*================*/ + FILE* f, /*!< in: output stream */ rw_lock_debug_t* info); /*!< in: debug struct */ #endif /* UNIV_SYNC_DEBUG */ diff --git a/storage/innodb_plugin/sync/sync0arr.c b/storage/innodb_plugin/sync/sync0arr.c index 3c825e2202b..ad29b90d344 100644 --- a/storage/innodb_plugin/sync/sync0arr.c +++ b/storage/innodb_plugin/sync/sync0arr.c @@ -1,6 +1,6 @@ /***************************************************************************** -Copyright (c) 1995, 2009, Innobase Oy. All Rights Reserved. +Copyright (c) 1995, 2011, Oracle and/or its affiliates. All Rights Reserved. Copyright (c) 2008, Google Inc. Portions of this file contain modifications contributed and copyrighted by @@ -715,7 +715,7 @@ print: fprintf(stderr, "rw-lock %p ", (void*) lock); sync_array_cell_print(stderr, cell); - rw_lock_debug_print(debug); + rw_lock_debug_print(stderr, debug); return(TRUE); } } diff --git a/storage/innodb_plugin/sync/sync0rw.c b/storage/innodb_plugin/sync/sync0rw.c index 572c3690a7f..00e0324becd 100644 --- a/storage/innodb_plugin/sync/sync0rw.c +++ b/storage/innodb_plugin/sync/sync0rw.c @@ -1,6 +1,6 @@ /***************************************************************************** -Copyright (c) 1995, 2009, Innobase Oy. All Rights Reserved. +Copyright (c) 1995, 2011, Oracle and/or its affiliates. All Rights Reserved. Copyright (c) 2008, Google Inc. Portions of this file contain modifications contributed and copyrighted by @@ -925,7 +925,7 @@ rw_lock_list_print_info( info = UT_LIST_GET_FIRST(lock->debug_list); while (info != NULL) { - rw_lock_debug_print(info); + rw_lock_debug_print(file, info); info = UT_LIST_GET_NEXT(list, info); } } @@ -973,7 +973,7 @@ rw_lock_print( info = UT_LIST_GET_FIRST(lock->debug_list); while (info != NULL) { - rw_lock_debug_print(info); + rw_lock_debug_print(stderr, info); info = UT_LIST_GET_NEXT(list, info); } } @@ -985,28 +985,29 @@ UNIV_INTERN void rw_lock_debug_print( /*================*/ + FILE* f, /*!< in: output stream */ rw_lock_debug_t* info) /*!< in: debug struct */ { ulint rwt; rwt = info->lock_type; - fprintf(stderr, "Locked: thread %lu file %s line %lu ", + fprintf(f, "Locked: thread %lu file %s line %lu ", (ulong) os_thread_pf(info->thread_id), info->file_name, (ulong) info->line); if (rwt == RW_LOCK_SHARED) { - fputs("S-LOCK", stderr); + fputs("S-LOCK", f); } else if (rwt == RW_LOCK_EX) { - fputs("X-LOCK", stderr); + fputs("X-LOCK", f); } else if (rwt == RW_LOCK_WAIT_EX) { - fputs("WAIT X-LOCK", stderr); + fputs("WAIT X-LOCK", f); } else { ut_error; } if (info->pass != 0) { - fprintf(stderr, " pass value %lu", (ulong) info->pass); + fprintf(f, " pass value %lu", (ulong) info->pass); } - putc('\n', stderr); + putc('\n', f); } /***************************************************************//** From 6579abf3bbc5ddda7905d8db2154f063b07fa7c2 Mon Sep 17 00:00:00 2001 From: Bjorn Munch Date: Tue, 18 Jan 2011 12:01:40 +0100 Subject: [PATCH 031/202] Some more copyright fixes in mtr --- mysql-test/lib/mtr_gcov.pl | 2 +- mysql-test/lib/mtr_io.pl | 2 +- mysql-test/lib/mtr_match.pm | 2 +- mysql-test/lib/mtr_stress.pl | 2 +- mysql-test/lib/mtr_unique.pm | 2 +- 5 files changed, 5 insertions(+), 5 deletions(-) diff --git a/mysql-test/lib/mtr_gcov.pl b/mysql-test/lib/mtr_gcov.pl index f531889b08d..d8fb1c0a07d 100644 --- a/mysql-test/lib/mtr_gcov.pl +++ b/mysql-test/lib/mtr_gcov.pl @@ -1,5 +1,5 @@ # -*- cperl -*- -# Copyright (C) 2004, 2006 MySQL AB +# Copyright (C) 2004, 2006 MySQL AB, 2009 Sun Microsystems, Inc. # # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by diff --git a/mysql-test/lib/mtr_io.pl b/mysql-test/lib/mtr_io.pl index 21581798ddc..6a6b3a3d028 100644 --- a/mysql-test/lib/mtr_io.pl +++ b/mysql-test/lib/mtr_io.pl @@ -1,5 +1,5 @@ # -*- cperl -*- -# Copyright (C) 2004-2006 MySQL AB +# Copyright (C) 2004-2007 MySQL AB, 2008 Sun Microsystems, Inc. # # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by diff --git a/mysql-test/lib/mtr_match.pm b/mysql-test/lib/mtr_match.pm index 40afd4e0336..6fc9832ac43 100644 --- a/mysql-test/lib/mtr_match.pm +++ b/mysql-test/lib/mtr_match.pm @@ -1,5 +1,5 @@ # -*- cperl -*- -# Copyright (C) 2004-2006 MySQL AB +# Copyright (C) 2004-2008 MySQL AB # # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by diff --git a/mysql-test/lib/mtr_stress.pl b/mysql-test/lib/mtr_stress.pl index 702bc178ae5..ab4214791d0 100644 --- a/mysql-test/lib/mtr_stress.pl +++ b/mysql-test/lib/mtr_stress.pl @@ -1,5 +1,5 @@ # -*- cperl -*- -# Copyright (C) 2006 MySQL AB +# Copyright (C) 2004-2007 MySQL AB, 2009 Sun Microsystems, Inc. # # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by diff --git a/mysql-test/lib/mtr_unique.pm b/mysql-test/lib/mtr_unique.pm index 6b60157422d..506af448266 100644 --- a/mysql-test/lib/mtr_unique.pm +++ b/mysql-test/lib/mtr_unique.pm @@ -1,5 +1,5 @@ # -*- cperl -*- -# Copyright (C) 2006 MySQL AB +# Copyright (C) 2006-2008 MySQL AB, 2009 Sun Microsystems, Inc. # # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by From 96adf25850ca3a84ea0b307a19ace58244bf1a7b Mon Sep 17 00:00:00 2001 From: Bjorn Munch Date: Tue, 18 Jan 2011 12:11:52 +0100 Subject: [PATCH 032/202] oops forgot one file in last commit --- mysql-test/lib/mtr_gprof.pl | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) diff --git a/mysql-test/lib/mtr_gprof.pl b/mysql-test/lib/mtr_gprof.pl index 5820a4007b8..a5e05b28723 100644 --- a/mysql-test/lib/mtr_gprof.pl +++ b/mysql-test/lib/mtr_gprof.pl @@ -1,5 +1,5 @@ # -*- cperl -*- -# Copyright (C) 2004 MySQL AB +# Copyright (C) 2004 MySQL AB, 2009 Sun Microsystems, Inc. # # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by From 00a6d119ea0f8fa894c24096b9ed96eb3fbe50cd Mon Sep 17 00:00:00 2001 From: Bjorn Munch Date: Tue, 18 Jan 2011 12:25:07 +0100 Subject: [PATCH 033/202] Bug #59063 rpl_migration_crash_safe fails on Windows Undoing the patch, it complicates the code but is not the solution I do not beleive newline mismatch could be the cause of this failure First, I cannot see how this could be a problem, mtr ignores the newline when reading the expect file, and the file is written and read on Windows. Second, if this really was the problem it should have been deterministic: either the newline is correctly interepreted or it is not. --- mysql-test/include/rpl_start_server.inc | 10 +--------- mysql-test/include/rpl_stop_server.inc | 4 +--- 2 files changed, 2 insertions(+), 12 deletions(-) diff --git a/mysql-test/include/rpl_start_server.inc b/mysql-test/include/rpl_start_server.inc index ac8106f141c..c59c7759910 100644 --- a/mysql-test/include/rpl_start_server.inc +++ b/mysql-test/include/rpl_start_server.inc @@ -45,15 +45,7 @@ if ($rpl_server_parameters) --source include/rpl_connection.inc # Write file to make mysql-test-run.pl start up the server again ---let WRITE_TO_FILE= $MYSQLTEST_VARDIR/tmp/mysqld.$rpl_server_number.expect ---let WRITE_TO_VAR= $_rpl_start_server_command -perl; -my $file= $ENV{'WRITE_TO_FILE'}; -my $var= $ENV{'WRITE_TO_VAR'}; -open WRITE_FILE, ">> $file" or die "Error opening $file: $!"; -print WRITE_FILE $var, "\n" or die "Error appending to $file: $!"; -close WRITE_FILE or die "Error closing $file: $!"; -EOF +--exec echo "$_rpl_start_server_command" > $MYSQLTEST_VARDIR/tmp/mysqld.$rpl_server_number.expect --source include/rpl_reconnect.inc diff --git a/mysql-test/include/rpl_stop_server.inc b/mysql-test/include/rpl_stop_server.inc index a90981d6de8..e1f8839dd69 100644 --- a/mysql-test/include/rpl_stop_server.inc +++ b/mysql-test/include/rpl_stop_server.inc @@ -44,9 +44,7 @@ if ($rpl_debug) # Write file to make mysql-test-run.pl expect the "crash", but don't start # it until it's told to ---append_file $MYSQLTEST_VARDIR/tmp/mysqld.$rpl_server_number.expect -wait -EOF +--exec echo "wait" > $MYSQLTEST_VARDIR/tmp/mysqld.$rpl_server_number.expect # Send shutdown to the connected server and give # it 10 seconds to die before zapping it From 77bc81b89ca65edb244fe4da30ca61e2f97cb5de Mon Sep 17 00:00:00 2001 From: Libing Song Date: Wed, 19 Jan 2011 01:23:49 +0800 Subject: [PATCH 034/202] Bug#58546 test rpl_packet timeout failure sporadically on PB rpl_packet got a timeout failure sporadically on PB when stopping slave. The real reason of this bug is that STOP SLAVE stopped IO thread first and then stopped SQL thread. It was possible that IO thread stopped after replicating part of a transaction which SQL thread was executing. SQL thread would be hung if the transaction could not be rolled back safely. After this patch, STOP SLAVE will stop SQL thread first and then stop IO thread, which guarantees that IO thread will fetch the reset of the events of the transaction that SQL thread is executing, so that SQL thread can finish the transaction if it cannot be rolled back safely. Added below auxiliary files to make the test code neater. restart_slave_sql.inc rpl_connection_master.inc rpl_connection_slave.inc rpl_connection_slave1.inc --- mysql-test/include/restart_slave_sql.inc | 43 +++++++++++++ mysql-test/include/rpl_connection_master.inc | 2 + mysql-test/include/rpl_connection_slave.inc | 2 + mysql-test/include/rpl_connection_slave1.inc | 2 + mysql-test/suite/rpl/r/rpl_stop_slave.result | 42 +++++++++++++ mysql-test/suite/rpl/t/rpl_packet.test | 2 +- mysql-test/suite/rpl/t/rpl_stop_slave.test | 64 +++++++++++++++++++- sql/slave.cc | 22 +++---- sql/sql_repl.cc | 23 +++++++ 9 files changed, 189 insertions(+), 13 deletions(-) create mode 100644 mysql-test/include/restart_slave_sql.inc create mode 100644 mysql-test/include/rpl_connection_master.inc create mode 100644 mysql-test/include/rpl_connection_slave.inc create mode 100644 mysql-test/include/rpl_connection_slave1.inc diff --git a/mysql-test/include/restart_slave_sql.inc b/mysql-test/include/restart_slave_sql.inc new file mode 100644 index 00000000000..ee6c6d7ced6 --- /dev/null +++ b/mysql-test/include/restart_slave_sql.inc @@ -0,0 +1,43 @@ +# ==== Purpose ==== +# +# Provide a earier way to restart SQL thread when you want to stop sql thread +# and then start it immediately. +# +# Sources stop_slave_sql.inc to stop SQL thread on the current connection. +# Then issues START SLAVE SQL_THREAD and then waits until +# the SQL threads have started, or until a timeout is reached. +# +# Please use this instead of 'STOP|START SLAVE SQL_THREAD', to reduce the risk of +# test case bugs. +# +# +# ==== Usage ==== +# +# [--let $slave_timeout= NUMBER] +# [--let $rpl_debug= 1] +# --source include/restart_slave_sql.inc +# +# Parameters: +# $slave_timeout +# See include/wait_for_slave_param.inc +# +# $rpl_debug +# See include/rpl_init.inc + + +--let $include_filename= restart_slave.inc +--source include/begin_include_file.inc + + +if (!$rpl_debug) +{ + --disable_query_log +} + +source include/stop_slave_sql.inc; +START SLAVE SQL_THREAD; +source include/wait_for_slave_sql_to_start.inc; + + +--let $include_filename= restart_slave.inc +--source include/end_include_file.inc \ No newline at end of file diff --git a/mysql-test/include/rpl_connection_master.inc b/mysql-test/include/rpl_connection_master.inc new file mode 100644 index 00000000000..e54e34071c8 --- /dev/null +++ b/mysql-test/include/rpl_connection_master.inc @@ -0,0 +1,2 @@ +let $rpl_connection_name= master; +source include/rpl_connection.inc; \ No newline at end of file diff --git a/mysql-test/include/rpl_connection_slave.inc b/mysql-test/include/rpl_connection_slave.inc new file mode 100644 index 00000000000..ef3876394d6 --- /dev/null +++ b/mysql-test/include/rpl_connection_slave.inc @@ -0,0 +1,2 @@ +let $rpl_connection_name= slave; +source include/rpl_connection.inc; \ No newline at end of file diff --git a/mysql-test/include/rpl_connection_slave1.inc b/mysql-test/include/rpl_connection_slave1.inc new file mode 100644 index 00000000000..8aee6defbdd --- /dev/null +++ b/mysql-test/include/rpl_connection_slave1.inc @@ -0,0 +1,2 @@ +let $rpl_connection_name= slave1; +source include/rpl_connection.inc; \ No newline at end of file diff --git a/mysql-test/suite/rpl/r/rpl_stop_slave.result b/mysql-test/suite/rpl/r/rpl_stop_slave.result index 2e9522e8947..ff0061f264b 100644 --- a/mysql-test/suite/rpl/r/rpl_stop_slave.result +++ b/mysql-test/suite/rpl/r/rpl_stop_slave.result @@ -128,5 +128,47 @@ START SLAVE SQL_THREAD; include/wait_for_slave_sql_to_start.inc # Test end SET GLOBAL debug= '$debug_save'; +include/restart_slave.inc +[connection master] DROP TABLE t1, t2; + +# Bug#58546 test rpl_packet timeout failure sporadically on PB +# ---------------------------------------------------------------------- +# STOP SLAVE stopped IO thread first and then stopped SQL thread. It was +# possible that IO thread stopped after replicating part of a transaction +# which SQL thread was executing. SQL thread would be hung if the +# transaction could not be rolled back safely. +# It caused some sporadic failures on PB2. +# +# This test verifies that when 'STOP SLAVE' is issued by a user, IO +# thread will continue to fetch the rest events of the transaction which +# is being executed by SQL thread and is not able to be rolled back safely. +CREATE TABLE t1 (c1 INT KEY, c2 INT) ENGINE=InnoDB; +CREATE TABLE t2 (c1 INT) ENGINE=MyISAM; +INSERT INTO t1 VALUES(1, 1); +SET GLOBAL debug= 'd,dump_thread_wait_before_send_xid'; +[connection slave] +include/restart_slave.inc +BEGIN; +UPDATE t1 SET c2 = 2 WHERE c1 = 1; +[connection master] +BEGIN; +INSERT INTO t1 VALUES(2, 2); +INSERT INTO t2 VALUES(1); +UPDATE t1 SET c2 = 3 WHERE c1 = 1; +COMMIT; +[connection slave1] +STOP SLAVE; +[connection slave] +ROLLBACK; +[connection master] +SET DEBUG_SYNC= 'now SIGNAL signal.continue'; +SET DEBUG_SYNC= 'RESET'; +[connection slave] +include/wait_for_slave_to_stop.inc +[connection slave1] +include/start_slave.inc +[connection master] +DROP TABLE t1, t2; +SET GLOBAL debug= $debug_save; include/rpl_end.inc diff --git a/mysql-test/suite/rpl/t/rpl_packet.test b/mysql-test/suite/rpl/t/rpl_packet.test index b11bd0a227e..3197b6160cd 100644 --- a/mysql-test/suite/rpl/t/rpl_packet.test +++ b/mysql-test/suite/rpl/t/rpl_packet.test @@ -26,8 +26,8 @@ let $old_net_buffer_length= `SELECT @@global.net_buffer_length`; SET @@global.max_allowed_packet=1024; SET @@global.net_buffer_length=1024; +sync_slave_with_master; # Restart slave for setting to take effect -connection slave; source include/stop_slave.inc; source include/start_slave.inc; diff --git a/mysql-test/suite/rpl/t/rpl_stop_slave.test b/mysql-test/suite/rpl/t/rpl_stop_slave.test index e7c67448dbe..e44b2f15f25 100644 --- a/mysql-test/suite/rpl/t/rpl_stop_slave.test +++ b/mysql-test/suite/rpl/t/rpl_stop_slave.test @@ -54,7 +54,69 @@ source extra/rpl_tests/rpl_stop_slave.test; --echo # Test end SET GLOBAL debug= '$debug_save'; +source include/restart_slave_sql.inc; -connection master; +--source include/rpl_connection_master.inc DROP TABLE t1, t2; + +--echo +--echo # Bug#58546 test rpl_packet timeout failure sporadically on PB +--echo # ---------------------------------------------------------------------- +--echo # STOP SLAVE stopped IO thread first and then stopped SQL thread. It was +--echo # possible that IO thread stopped after replicating part of a transaction +--echo # which SQL thread was executing. SQL thread would be hung if the +--echo # transaction could not be rolled back safely. +--echo # It caused some sporadic failures on PB2. +--echo # +--echo # This test verifies that when 'STOP SLAVE' is issued by a user, IO +--echo # thread will continue to fetch the rest events of the transaction which +--echo # is being executed by SQL thread and is not able to be rolled back safely. + +CREATE TABLE t1 (c1 INT KEY, c2 INT) ENGINE=InnoDB; +CREATE TABLE t2 (c1 INT) ENGINE=MyISAM; +INSERT INTO t1 VALUES(1, 1); + +let $debug_save= `SELECT @@GLOBAL.debug`; +SET GLOBAL debug= 'd,dump_thread_wait_before_send_xid'; + +sync_slave_with_master; + +--source include/rpl_connection_slave.inc +source include/restart_slave_sql.inc; + +BEGIN; +UPDATE t1 SET c2 = 2 WHERE c1 = 1; + +--source include/rpl_connection_master.inc +BEGIN; +INSERT INTO t1 VALUES(2, 2); +INSERT INTO t2 VALUES(1); +UPDATE t1 SET c2 = 3 WHERE c1 = 1; +COMMIT; + +--source include/rpl_connection_slave1.inc +let $show_statement= SHOW PROCESSLIST; +let $field= Info; +let $condition= = 'UPDATE t1 SET c2 = 3 WHERE c1 = 1'; +source include/wait_show_condition.inc; + +send STOP SLAVE; + +--source include/rpl_connection_slave.inc +ROLLBACK; + +--source include/rpl_connection_master.inc +SET DEBUG_SYNC= 'now SIGNAL signal.continue'; +SET DEBUG_SYNC= 'RESET'; + +--source include/rpl_connection_slave.inc +source include/wait_for_slave_to_stop.inc; + +--source include/rpl_connection_slave1.inc +reap; +source include/start_slave.inc; + +--source include/rpl_connection_master.inc +DROP TABLE t1, t2; +SET GLOBAL debug= $debug_save; --source include/rpl_end.inc diff --git a/sql/slave.cc b/sql/slave.cc index 96319de5427..0e74d0ce3c0 100644 --- a/sql/slave.cc +++ b/sql/slave.cc @@ -408,17 +408,6 @@ int terminate_slave_threads(Master_info* mi,int thread_mask,bool skip_lock) int error,force_all = (thread_mask & SLAVE_FORCE_ALL); pthread_mutex_t *sql_lock = &mi->rli.run_lock, *io_lock = &mi->run_lock; - if (thread_mask & (SLAVE_IO|SLAVE_FORCE_ALL)) - { - DBUG_PRINT("info",("Terminating IO thread")); - mi->abort_slave=1; - if ((error=terminate_slave_thread(mi->io_thd, io_lock, - &mi->stop_cond, - &mi->slave_running, - skip_lock)) && - !force_all) - DBUG_RETURN(error); - } if (thread_mask & (SLAVE_SQL|SLAVE_FORCE_ALL)) { DBUG_PRINT("info",("Terminating SQL thread")); @@ -430,6 +419,17 @@ int terminate_slave_threads(Master_info* mi,int thread_mask,bool skip_lock) !force_all) DBUG_RETURN(error); } + if (thread_mask & (SLAVE_IO|SLAVE_FORCE_ALL)) + { + DBUG_PRINT("info",("Terminating IO thread")); + mi->abort_slave=1; + if ((error=terminate_slave_thread(mi->io_thd, io_lock, + &mi->stop_cond, + &mi->slave_running, + skip_lock)) && + !force_all) + DBUG_RETURN(error); + } DBUG_RETURN(0); } diff --git a/sql/sql_repl.cc b/sql/sql_repl.cc index cb5aac863c0..0ade0b759d5 100644 --- a/sql/sql_repl.cc +++ b/sql/sql_repl.cc @@ -21,6 +21,7 @@ #include "log_event.h" #include "rpl_filter.h" #include +#include "debug_sync.h" int max_binlog_dump_events = 0; // unlimited my_bool opt_sporadic_binlog_dump_fail = 0; @@ -556,6 +557,20 @@ impossible position"; } #endif + DBUG_EXECUTE_IF("dump_thread_wait_before_send_xid", + { + if ((*packet)[EVENT_TYPE_OFFSET+1] == XID_EVENT) + { + net_flush(net); + const char act[]= + "now " + "wait_for signal.continue"; + DBUG_ASSERT(opt_debug_sync_timeout > 0); + DBUG_ASSERT(!debug_sync_set_action(current_thd, + STRING_WITH_LEN(act))); + } + }); + if ((*packet)[EVENT_TYPE_OFFSET+1] == FORMAT_DESCRIPTION_EVENT) { binlog_can_be_corrupted= test((*packet)[FLAGS_OFFSET+1] & @@ -572,6 +587,14 @@ impossible position"; goto err; } + DBUG_EXECUTE_IF("dump_thread_wait_before_send_xid", + { + if ((*packet)[EVENT_TYPE_OFFSET+1] == XID_EVENT) + { + net_flush(net); + } + }); + DBUG_PRINT("info", ("log event code %d", (*packet)[LOG_EVENT_OFFSET+1] )); if ((*packet)[LOG_EVENT_OFFSET+1] == LOAD_EVENT) From d33fbe44ffed64c54203aece512a7c2c6a7abece Mon Sep 17 00:00:00 2001 From: Mattias Jonsson Date: Tue, 18 Jan 2011 23:55:39 +0100 Subject: [PATCH 035/202] Bug#59418: parts suite have several failures with --embedded-server The test were using external tools not available for embedded. Fixed by rewriting the test to not rely on external tools like the mysql-client Also fixed some non portable --exec commands and replaced #p# to #P# to pass on windows. --- mysql-test/suite/parts/inc/partition_check_drop.inc | 4 ++-- .../suite/parts/inc/partition_layout_check1.inc | 13 +++++-------- .../suite/parts/inc/partition_layout_check2.inc | 7 +++---- .../suite/parts/r/partition_recover_myisam.result | 2 +- .../suite/parts/t/partition_debug_sync_innodb.test | 2 ++ .../suite/parts/t/partition_recover_myisam.test | 6 +++++- .../suite/parts/t/partition_special_innodb.test | 4 ++-- 7 files changed, 20 insertions(+), 18 deletions(-) diff --git a/mysql-test/suite/parts/inc/partition_check_drop.inc b/mysql-test/suite/parts/inc/partition_check_drop.inc index daaa5e541c7..137de4165a0 100644 --- a/mysql-test/suite/parts/inc/partition_check_drop.inc +++ b/mysql-test/suite/parts/inc/partition_check_drop.inc @@ -66,10 +66,10 @@ if ($found_garbage) } # Do a manual cleanup, because the following tests should not suffer from # remaining files - --exec rm -f $MYSQLD_DATADIR/test/t1* || true + --remove_files_wildcard $MYSQLD_DATADIR/test t1* if ($with_directories) { - --exec rm -f $MYSQLTEST_VARDIR/tmp/t1* || true + --remove_files_wildcard $MYSQLTEST_VARDIR/tmp t1* } } --enable_query_log diff --git a/mysql-test/suite/parts/inc/partition_layout_check1.inc b/mysql-test/suite/parts/inc/partition_layout_check1.inc index bca41b6f9c7..66a93d5d8d7 100644 --- a/mysql-test/suite/parts/inc/partition_layout_check1.inc +++ b/mysql-test/suite/parts/inc/partition_layout_check1.inc @@ -29,14 +29,10 @@ DELETE FROM t0_definition; let $MYSQLD_DATADIR= `select LEFT(@@datadir, LENGTH(@@datadir)-1)`; #echo MYSQLD_DATADIR: $MYSQLD_DATADIR; -# Dump the current definition of the table t1 to tmp1 -# This complicated method - let another mysqltest collect the output - is used -# because of two reasons +# Save the current definition of the table t1 # - SHOW CREATE TABLE t1 is at least currently most probably more reliable than # the corresponding SELECT on the INFORMATION_SCHEMA -# - SHOW CREATE TABLE .. cannot write its out put into a file like SELECT -let $show_file= $MYSQLD_DATADIR/test/tmp1; ---exec echo "SHOW CREATE TABLE t1; exit; " | $MYSQL_TEST > $show_file 2>&1 +let $show_create= `SHOW CREATE TABLE t1`; if ($do_file_tests) { # List the files belonging to the table t1 @@ -57,12 +53,13 @@ if (!$do_file_tests) # Insert the current definition of the table t1 into t0_definition eval INSERT INTO t0_definition SET state = 'old', - create_command = load_file('$show_file'), + create_command = "$show_create", file_list = @aux; # Print the create table statement into the protocol +# Added the concat to avoid changing the result files --replace_result $MYSQLTEST_VARDIR MYSQLTEST_VARDIR '\r' '' -SELECT create_command FROM t0_definition WHERE state = 'old'; +SELECT concat('SHOW CREATE TABLE t1;\nTable\tCreate Table\n',create_command,'\n') as `create_command` FROM t0_definition WHERE state = 'old'; if ($do_file_tests) { # We stored the list of files, therefore printing the content makes sense diff --git a/mysql-test/suite/parts/inc/partition_layout_check2.inc b/mysql-test/suite/parts/inc/partition_layout_check2.inc index 7ff871a4c45..2f74455a811 100644 --- a/mysql-test/suite/parts/inc/partition_layout_check2.inc +++ b/mysql-test/suite/parts/inc/partition_layout_check2.inc @@ -28,9 +28,8 @@ DELETE FROM t0_definition WHERE state = 'new'; let $MYSQLD_DATADIR= `select LEFT(@@datadir, LENGTH(@@datadir)-1)`; #echo MYSQLD_DATADIR: $MYSQLD_DATADIR; -# Dump the current definition of the table t1 to tmp1 -let $show_file= $MYSQLD_DATADIR/test/tmp1; ---exec echo "SHOW CREATE TABLE t1; exit; " | $MYSQL_TEST > $show_file 2>&1 +# Save the current definition of the table t1 +let $show_create= `SHOW CREATE TABLE t1`; if ($do_file_tests) { @@ -52,7 +51,7 @@ if (!$do_file_tests) # Insert the current definition of the table t1 into t0_definition eval INSERT INTO t0_definition SET state = 'new', - create_command = load_file('$show_file'), + create_command = "$show_create", file_list = @aux; # Print the old and new table layout, if they differ diff --git a/mysql-test/suite/parts/r/partition_recover_myisam.result b/mysql-test/suite/parts/r/partition_recover_myisam.result index 49775ee498e..cf3ccaa73b3 100644 --- a/mysql-test/suite/parts/r/partition_recover_myisam.result +++ b/mysql-test/suite/parts/r/partition_recover_myisam.result @@ -1,4 +1,4 @@ -call mtr.add_suppression("./test/t1_will_crash"); +call mtr.add_suppression("t1_will_crash"); call mtr.add_suppression("Got an error from unknown thread, ha_myisam.cc"); CREATE TABLE t1_will_crash (a INT, KEY (a)) ENGINE=MyISAM; INSERT INTO t1_will_crash VALUES (1), (2), (3), (4), (5), (6), (7), (8), (9), (10), (11); diff --git a/mysql-test/suite/parts/t/partition_debug_sync_innodb.test b/mysql-test/suite/parts/t/partition_debug_sync_innodb.test index 79ef3d537bf..e9abe134d84 100644 --- a/mysql-test/suite/parts/t/partition_debug_sync_innodb.test +++ b/mysql-test/suite/parts/t/partition_debug_sync_innodb.test @@ -14,6 +14,7 @@ partition by range (a) insert into t1 values (1), (11), (21), (33); SELECT * FROM t1; SHOW CREATE TABLE t1; +--replace_result #p# #P# --list_files $MYSQLD_DATADIR/test SET DEBUG_SYNC='before_open_in_get_all_tables SIGNAL parked WAIT_FOR open'; @@ -36,6 +37,7 @@ ALTER TABLE t1 REORGANIZE PARTITION p0 INTO disconnect con1; connection default; --reap +--replace_result #p# #P# --list_files $MYSQLD_DATADIR/test SHOW CREATE TABLE t1; SELECT * FROM t1; diff --git a/mysql-test/suite/parts/t/partition_recover_myisam.test b/mysql-test/suite/parts/t/partition_recover_myisam.test index 64bc821ac37..043ec16a9f4 100644 --- a/mysql-test/suite/parts/t/partition_recover_myisam.test +++ b/mysql-test/suite/parts/t/partition_recover_myisam.test @@ -1,6 +1,6 @@ # test the auto-recover (--myisam-recover) of partitioned myisam tables -call mtr.add_suppression("./test/t1_will_crash"); +call mtr.add_suppression("t1_will_crash"); call mtr.add_suppression("Got an error from unknown thread, ha_myisam.cc"); --source include/have_partition.inc @@ -20,6 +20,8 @@ FLUSH TABLES; let $MYSQLD_DATADIR= `select @@datadir`; --remove_file $MYSQLD_DATADIR/test/t1_will_crash.MYI --copy_file std_data/corrupt_t1.MYI $MYSQLD_DATADIR/test/t1_will_crash.MYI +--replace_result \\ / +--replace_regex /Table '.*data/Table './ SELECT * FROM t1_will_crash; DROP TABLE t1_will_crash; CREATE TABLE t1_will_crash (a INT, KEY (a)) @@ -33,5 +35,7 @@ FLUSH TABLES; --echo # head -c1024 t1#P#p1.MYI > corrupt_t1#P#p1.MYI --remove_file $MYSQLD_DATADIR/test/t1_will_crash#P#p1.MYI --copy_file std_data/corrupt_t1#P#p1.MYI $MYSQLD_DATADIR/test/t1_will_crash#P#p1.MYI +--replace_result \\ / +--replace_regex /Table '.*data/Table './ SELECT * FROM t1_will_crash; DROP TABLE t1_will_crash; diff --git a/mysql-test/suite/parts/t/partition_special_innodb.test b/mysql-test/suite/parts/t/partition_special_innodb.test index eac19f6d588..f237b02f331 100644 --- a/mysql-test/suite/parts/t/partition_special_innodb.test +++ b/mysql-test/suite/parts/t/partition_special_innodb.test @@ -58,8 +58,8 @@ ENGINE = InnoDB PARTITION BY HASH (a) PARTITIONS 2; -connect (con1,127.0.0.1,root,,test,$MASTER_MYPORT,); -connect (con2,127.0.0.1,root,,test,$MASTER_MYPORT,); +connect (con1, localhost, root,,); +connect (con2, localhost, root,,); --connection con1 SET autocommit=OFF; From 435289acd4b48e4e12c007f58cc317f4ea6a8ca7 Mon Sep 17 00:00:00 2001 From: Alexander Barkov Date: Wed, 19 Jan 2011 16:17:52 +0300 Subject: [PATCH 036/202] Updating Copyright information --- strings/bchange.c | 2 +- strings/bcopy-duff.c | 2 +- strings/bfill.c | 2 +- strings/bmove.c | 2 +- strings/bmove512.c | 2 +- strings/bmove_upp.c | 2 +- strings/conf_to_src.c | 4 ++-- strings/ctype-big5.c | 2 +- strings/ctype-bin.c | 2 +- strings/ctype-cp932.c | 2 +- strings/ctype-czech.c | 2 +- strings/ctype-euc_kr.c | 2 +- strings/ctype-eucjpms.c | 2 +- strings/ctype-extra.c | 2 +- strings/ctype-gb2312.c | 2 +- strings/ctype-gbk.c | 2 +- strings/ctype-latin1.c | 2 +- strings/ctype-mb.c | 2 +- strings/ctype-simple.c | 2 +- strings/ctype-sjis.c | 2 +- strings/ctype-tis620.c | 2 +- strings/ctype-uca.c | 2 +- strings/ctype-ucs2.c | 2 +- strings/ctype-ujis.c | 2 +- strings/ctype-utf8.c | 2 +- strings/ctype-win1250ch.c | 2 +- strings/ctype.c | 2 +- strings/decimal.c | 2 +- strings/do_ctype.c | 2 +- strings/dump_map.c | 2 +- strings/int2str.c | 2 +- strings/is_prefix.c | 2 +- strings/llstr.c | 2 +- strings/longlong2str.c | 2 +- strings/longlong2str_asm.c | 2 +- strings/memcmp.c | 2 +- strings/memcpy.c | 2 +- strings/memset.c | 2 +- strings/my_strchr.c | 2 +- strings/my_strtoll10.c | 2 +- strings/my_vsnprintf.c | 2 +- strings/r_strinstr.c | 2 +- strings/str2int.c | 2 +- strings/str_alloc.c | 2 +- strings/str_test.c | 2 +- strings/strappend.c | 2 +- strings/strcat.c | 2 +- strings/strcend.c | 2 +- strings/strchr.c | 2 +- strings/strcmp.c | 2 +- strings/strcont.c | 2 +- strings/strend.c | 2 +- strings/strfill.c | 2 +- strings/strinstr.c | 2 +- strings/strlen.c | 2 +- strings/strmake.c | 2 +- strings/strmov.c | 2 +- strings/strnlen.c | 2 +- strings/strnmov.c | 2 +- strings/strrchr.c | 2 +- strings/strstr.c | 2 +- strings/strto.c | 2 +- strings/strtod.c | 2 +- strings/strtol.c | 2 +- strings/strtoll.c | 2 +- strings/strtoul.c | 2 +- strings/strtoull.c | 2 +- strings/strxmov.c | 2 +- strings/strxnmov.c | 2 +- strings/uca-dump.c | 2 +- strings/uctypedump.c | 2 +- strings/udiv.c | 2 +- strings/utr11-dump.c | 2 +- strings/xml.c | 2 +- 74 files changed, 75 insertions(+), 75 deletions(-) diff --git a/strings/bchange.c b/strings/bchange.c index 0b2c62019b5..45eabacb767 100644 --- a/strings/bchange.c +++ b/strings/bchange.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/bcopy-duff.c b/strings/bcopy-duff.c index 215857715fd..640d11bfae8 100644 --- a/strings/bcopy-duff.c +++ b/strings/bcopy-duff.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/bfill.c b/strings/bfill.c index 2750553f48a..7afece4f9bd 100644 --- a/strings/bfill.c +++ b/strings/bfill.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2002 MySQL AB +/* Copyright (c) 2002, 2011, Oracle and/or its affiliates. All rights reserved. This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public diff --git a/strings/bmove.c b/strings/bmove.c index ae9641a5d58..b935f618950 100644 --- a/strings/bmove.c +++ b/strings/bmove.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2002 MySQL AB +/* Copyright (c) 2002, 2011, Oracle and/or its affiliates. All rights reserved. This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public diff --git a/strings/bmove512.c b/strings/bmove512.c index c3f0446ead6..2b2838d99e8 100644 --- a/strings/bmove512.c +++ b/strings/bmove512.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/bmove_upp.c b/strings/bmove_upp.c index fb47bda2d1d..44c1c120689 100644 --- a/strings/bmove_upp.c +++ b/strings/bmove_upp.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/conf_to_src.c b/strings/conf_to_src.c index 7e742050aa8..4ffbf115378 100644 --- a/strings/conf_to_src.c +++ b/strings/conf_to_src.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by @@ -249,7 +249,7 @@ static void fprint_copyright(FILE *file) { fprintf(file, -"/* Copyright 2000-2008 MySQL AB, 2008 Sun Microsystems, Inc.\n" +"/* Copyright (c) 2003, 2011, Oracle and/or its affiliates. All rights reserved.\n" "\n" " This program is free software; you can redistribute it and/or modify\n" " it under the terms of the GNU General Public License as published by\n" diff --git a/strings/ctype-big5.c b/strings/ctype-big5.c index 2cb40c266d2..67134f6b1a7 100644 --- a/strings/ctype-big5.c +++ b/strings/ctype-big5.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/ctype-bin.c b/strings/ctype-bin.c index 95d97af2bfb..8841bf45f35 100644 --- a/strings/ctype-bin.c +++ b/strings/ctype-bin.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2002 MySQL AB & tommy@valley.ne.jp. +/* Copyright (c) 2002, 2011, Oracle and/or its affiliates. All rights reserved. & tommy@valley.ne.jp. This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public diff --git a/strings/ctype-cp932.c b/strings/ctype-cp932.c index 238c6f61baa..e564e92ceec 100644 --- a/strings/ctype-cp932.c +++ b/strings/ctype-cp932.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/ctype-czech.c b/strings/ctype-czech.c index a5df86cc6b3..39ff1f5f7e9 100644 --- a/strings/ctype-czech.c +++ b/strings/ctype-czech.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/ctype-euc_kr.c b/strings/ctype-euc_kr.c index ee957304716..60180a2998f 100644 --- a/strings/ctype-euc_kr.c +++ b/strings/ctype-euc_kr.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/ctype-eucjpms.c b/strings/ctype-eucjpms.c index 615981b4d27..e4177d7b1f3 100644 --- a/strings/ctype-eucjpms.c +++ b/strings/ctype-eucjpms.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2002 MySQL AB & tommy@valley.ne.jp. +/* Copyright (c) 2002, 2011, Oracle and/or its affiliates. All rights reserved. & tommy@valley.ne.jp. This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public diff --git a/strings/ctype-extra.c b/strings/ctype-extra.c index bc8c5342a52..0fef4bd3708 100644 --- a/strings/ctype-extra.c +++ b/strings/ctype-extra.c @@ -6,7 +6,7 @@ ./conf_to_src ../sql/share/charsets/ > FILE */ -/* Copyright (C) 2000-2007 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/ctype-gb2312.c b/strings/ctype-gb2312.c index 84f67dbbc2e..78333535bba 100644 --- a/strings/ctype-gb2312.c +++ b/strings/ctype-gb2312.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/ctype-gbk.c b/strings/ctype-gbk.c index 89607823d34..4cd2cd0cf35 100644 --- a/strings/ctype-gbk.c +++ b/strings/ctype-gbk.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/ctype-latin1.c b/strings/ctype-latin1.c index e5333c4101b..1d835c5c34f 100644 --- a/strings/ctype-latin1.c +++ b/strings/ctype-latin1.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/ctype-mb.c b/strings/ctype-mb.c index e3788fc4dff..59ee3963ccd 100644 --- a/strings/ctype-mb.c +++ b/strings/ctype-mb.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/ctype-simple.c b/strings/ctype-simple.c index 4f3aaa6f668..cc2bb703391 100644 --- a/strings/ctype-simple.c +++ b/strings/ctype-simple.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2002 MySQL AB +/* Copyright (c) 2002, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/ctype-sjis.c b/strings/ctype-sjis.c index 3f479ffc102..e4d99c00415 100644 --- a/strings/ctype-sjis.c +++ b/strings/ctype-sjis.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/ctype-tis620.c b/strings/ctype-tis620.c index a8c05dc4fd0..3db0d97c68f 100644 --- a/strings/ctype-tis620.c +++ b/strings/ctype-tis620.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000-2003 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/ctype-uca.c b/strings/ctype-uca.c index 6ae0cc3a293..cbe558f740e 100644 --- a/strings/ctype-uca.c +++ b/strings/ctype-uca.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2004 MySQL AB +/* Copyright (c) 2004, 2011, Oracle and/or its affiliates. All rights reserved. This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public diff --git a/strings/ctype-ucs2.c b/strings/ctype-ucs2.c index 865a19b0828..73b8e9714a3 100644 --- a/strings/ctype-ucs2.c +++ b/strings/ctype-ucs2.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public diff --git a/strings/ctype-ujis.c b/strings/ctype-ujis.c index 4474bd0cf96..7fbb16db915 100644 --- a/strings/ctype-ujis.c +++ b/strings/ctype-ujis.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2002 MySQL AB & tommy@valley.ne.jp. +/* Copyright (c) 2002, 2011, Oracle and/or its affiliates. All rights reserved. & tommy@valley.ne.jp. This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public diff --git a/strings/ctype-utf8.c b/strings/ctype-utf8.c index ae942b59caa..849ba3fbeb6 100644 --- a/strings/ctype-utf8.c +++ b/strings/ctype-utf8.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public diff --git a/strings/ctype-win1250ch.c b/strings/ctype-win1250ch.c index b22b4364e8a..a904f08b816 100644 --- a/strings/ctype-win1250ch.c +++ b/strings/ctype-win1250ch.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2003 MySQL AB +/* Copyright (c) 2003, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/ctype.c b/strings/ctype.c index 17ad1256e74..41a9f8abfdb 100644 --- a/strings/ctype.c +++ b/strings/ctype.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/decimal.c b/strings/decimal.c index bda296ce832..e89669c3de5 100644 --- a/strings/decimal.c +++ b/strings/decimal.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/do_ctype.c b/strings/do_ctype.c index f33ddc5eb81..bd388457dd6 100644 --- a/strings/do_ctype.c +++ b/strings/do_ctype.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/dump_map.c b/strings/dump_map.c index e2b8b7db077..60bd91541c4 100644 --- a/strings/dump_map.c +++ b/strings/dump_map.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2003-2004 MySQL AB +/* Copyright (c) 2003, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/int2str.c b/strings/int2str.c index fba98aac3f1..f2ac32ede6a 100644 --- a/strings/int2str.c +++ b/strings/int2str.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/is_prefix.c b/strings/is_prefix.c index 451cd468b7e..370927a24cd 100644 --- a/strings/is_prefix.c +++ b/strings/is_prefix.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/llstr.c b/strings/llstr.c index 643cf36a311..283af4795dc 100644 --- a/strings/llstr.c +++ b/strings/llstr.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/longlong2str.c b/strings/longlong2str.c index d7de5bb0f7c..662de439924 100644 --- a/strings/longlong2str.c +++ b/strings/longlong2str.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/longlong2str_asm.c b/strings/longlong2str_asm.c index 637815e52c5..7c5edf18591 100644 --- a/strings/longlong2str_asm.c +++ b/strings/longlong2str_asm.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/memcmp.c b/strings/memcmp.c index 9471353f751..1dff18189e5 100644 --- a/strings/memcmp.c +++ b/strings/memcmp.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/memcpy.c b/strings/memcpy.c index f32d346e3ec..dc72b329818 100644 --- a/strings/memcpy.c +++ b/strings/memcpy.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/memset.c b/strings/memset.c index e07dc4ead85..2976c5f0495 100644 --- a/strings/memset.c +++ b/strings/memset.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/my_strchr.c b/strings/my_strchr.c index 08fa51ba17a..35f39d563c5 100644 --- a/strings/my_strchr.c +++ b/strings/my_strchr.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2005 MySQL AB +/* Copyright (c) 2005, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/my_strtoll10.c b/strings/my_strtoll10.c index 4f73b1f8e71..374a826ae92 100644 --- a/strings/my_strtoll10.c +++ b/strings/my_strtoll10.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2003 MySQL AB +/* Copyright (c) 2003, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/my_vsnprintf.c b/strings/my_vsnprintf.c index 920022aae91..019e1c7d9a1 100644 --- a/strings/my_vsnprintf.c +++ b/strings/my_vsnprintf.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/r_strinstr.c b/strings/r_strinstr.c index fb1e0c5a090..4a8aa091a6b 100644 --- a/strings/r_strinstr.c +++ b/strings/r_strinstr.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/str2int.c b/strings/str2int.c index c4a4c07eeff..7cf49982d76 100644 --- a/strings/str2int.c +++ b/strings/str2int.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/str_alloc.c b/strings/str_alloc.c index 615ad1ba1e2..fdf32b8ee15 100644 --- a/strings/str_alloc.c +++ b/strings/str_alloc.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/str_test.c b/strings/str_test.c index a476809e22d..8f0ed115761 100644 --- a/strings/str_test.c +++ b/strings/str_test.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000-2003 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/strappend.c b/strings/strappend.c index bb926f74665..e81a4d4301e 100644 --- a/strings/strappend.c +++ b/strings/strappend.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/strcat.c b/strings/strcat.c index e69369c357f..154ef850161 100644 --- a/strings/strcat.c +++ b/strings/strcat.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/strcend.c b/strings/strcend.c index 56e31d5f994..43c8e28e787 100644 --- a/strings/strcend.c +++ b/strings/strcend.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/strchr.c b/strings/strchr.c index 5ffe386c718..5818e5cd110 100644 --- a/strings/strchr.c +++ b/strings/strchr.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/strcmp.c b/strings/strcmp.c index 54bbe92279b..19a8e62b63d 100644 --- a/strings/strcmp.c +++ b/strings/strcmp.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/strcont.c b/strings/strcont.c index 5a518a3550f..ddf8f2c838f 100644 --- a/strings/strcont.c +++ b/strings/strcont.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/strend.c b/strings/strend.c index 4dadf0675dc..11ca454e1e4 100644 --- a/strings/strend.c +++ b/strings/strend.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2002 MySQL AB +/* Copyright (c) 2002, 2011, Oracle and/or its affiliates. All rights reserved. This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public diff --git a/strings/strfill.c b/strings/strfill.c index 4b1fe67b206..12d227f5805 100644 --- a/strings/strfill.c +++ b/strings/strfill.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/strinstr.c b/strings/strinstr.c index dce498d61e8..3f9f79b06a9 100644 --- a/strings/strinstr.c +++ b/strings/strinstr.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/strlen.c b/strings/strlen.c index 1469dd096ee..a5ee5ddd922 100644 --- a/strings/strlen.c +++ b/strings/strlen.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/strmake.c b/strings/strmake.c index 2d5fa5e36aa..296199b90be 100644 --- a/strings/strmake.c +++ b/strings/strmake.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/strmov.c b/strings/strmov.c index eedf22a4ef1..98f0e1b9a26 100644 --- a/strings/strmov.c +++ b/strings/strmov.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/strnlen.c b/strings/strnlen.c index 826cd5ae5dd..7c8f3c4a54e 100644 --- a/strings/strnlen.c +++ b/strings/strnlen.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/strnmov.c b/strings/strnmov.c index 7e26877637b..a826233bb17 100644 --- a/strings/strnmov.c +++ b/strings/strnmov.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/strrchr.c b/strings/strrchr.c index cdb0479ef90..e22b04c159e 100644 --- a/strings/strrchr.c +++ b/strings/strrchr.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/strstr.c b/strings/strstr.c index a5b50d12043..619fe8c8246 100644 --- a/strings/strstr.c +++ b/strings/strstr.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2002 MySQL AB +/* Copyright (c) 2002, 2011, Oracle and/or its affiliates. All rights reserved. This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public diff --git a/strings/strto.c b/strings/strto.c index fcb0d800b81..f94005a6cb0 100644 --- a/strings/strto.c +++ b/strings/strto.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/strtod.c b/strings/strtod.c index 44b9eae98ee..95cd5041e3e 100644 --- a/strings/strtod.c +++ b/strings/strtod.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000, 2007 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/strtol.c b/strings/strtol.c index 42476b0226a..f6dd0204f2d 100644 --- a/strings/strtol.c +++ b/strings/strtol.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/strtoll.c b/strings/strtoll.c index cfb6fbd75ee..0a7abb5307c 100644 --- a/strings/strtoll.c +++ b/strings/strtoll.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/strtoul.c b/strings/strtoul.c index 3e2b51bc982..f6c497fce2e 100644 --- a/strings/strtoul.c +++ b/strings/strtoul.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/strtoull.c b/strings/strtoull.c index 94bf6904f8d..11effebc487 100644 --- a/strings/strtoull.c +++ b/strings/strtoull.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/strxmov.c b/strings/strxmov.c index 9dd2c936620..c0b2449e66a 100644 --- a/strings/strxmov.c +++ b/strings/strxmov.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2002 MySQL AB +/* Copyright (c) 2002, 2011, Oracle and/or its affiliates. All rights reserved. This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public diff --git a/strings/strxnmov.c b/strings/strxnmov.c index 16469be6e45..dac6eab5d63 100644 --- a/strings/strxnmov.c +++ b/strings/strxnmov.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2002 MySQL AB +/* Copyright (c) 2002, 2011, Oracle and/or its affiliates. All rights reserved. This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public diff --git a/strings/uca-dump.c b/strings/uca-dump.c index 774e940c7da..3ba78163c2f 100644 --- a/strings/uca-dump.c +++ b/strings/uca-dump.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2004 MySQL AB +/* Copyright (c) 2004, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/uctypedump.c b/strings/uctypedump.c index 2e484604fd3..5b902843ee1 100644 --- a/strings/uctypedump.c +++ b/strings/uctypedump.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2006 MySQL AB +/* Copyright (c) 2006, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/udiv.c b/strings/udiv.c index 81ac01ee9c3..6f603b58823 100644 --- a/strings/udiv.c +++ b/strings/udiv.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/utr11-dump.c b/strings/utr11-dump.c index a15f63025f4..adbbdda1169 100644 --- a/strings/utr11-dump.c +++ b/strings/utr11-dump.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2004 MySQL AB +/* Copyright (c) 2004, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/strings/xml.c b/strings/xml.c index dee9da2864c..29ce74e36a0 100644 --- a/strings/xml.c +++ b/strings/xml.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by From 03db0de64f7faca1ff731b81c18595bd25c57d00 Mon Sep 17 00:00:00 2001 From: Martin Hansson Date: Wed, 19 Jan 2011 15:09:32 +0100 Subject: [PATCH 037/202] Bug#59173: Failure to handle DATE(TIME) values where Year, Month or Day is ZERO When dates are represented internally as strings, i.e. when a string constant is compared to a date value, both values are converted to long integers, ostensibly for fast comparisons. DATE typed integer values are converted to DATETIME by multiplying by 1,000,000 (each digit pair representing hour, minute and second, respectively). But the mechanism did not distuinguish cached INTEGER values, already in correct format, from newly converted strings. Fixed by marking the INTEGER cache as being of DATETIME format. --- mysql-test/r/type_datetime.result | 11 +++++++++++ mysql-test/t/type_datetime.test | 11 +++++++++++ sql/item_cmpfunc.cc | 2 +- 3 files changed, 23 insertions(+), 1 deletion(-) diff --git a/mysql-test/r/type_datetime.result b/mysql-test/r/type_datetime.result index 9b18f250d21..1f0965a105f 100644 --- a/mysql-test/r/type_datetime.result +++ b/mysql-test/r/type_datetime.result @@ -637,4 +637,15 @@ CAST(CAST('2008-07-29T10:42:51.1234567' AS DateTime) AS DECIMAL(30,7)) 20080729104251.1234560 Warnings: Warning 1292 Truncated incorrect datetime value: '2008-07-29T10:42:51.1234567' +# +# Bug#59173: Failure to handle DATE(TIME) values where Year, Month or +# Day is ZERO +# +CREATE TABLE t1 (dt1 DATETIME); +INSERT INTO t1 (dt1) VALUES ('0000-00-01 00:00:01'); +DELETE FROM t1 WHERE dt1 = '0000-00-01 00:00:01'; +# Should be empty +SELECT * FROM t1; +dt1 +DROP TABLE t1; End of 5.1 tests diff --git a/mysql-test/t/type_datetime.test b/mysql-test/t/type_datetime.test index d4fa6bed186..43dafc371dc 100644 --- a/mysql-test/t/type_datetime.test +++ b/mysql-test/t/type_datetime.test @@ -445,4 +445,15 @@ SELECT CAST(CAST('00000002006-000008-0000010 000010:0000011:00000012.012345' AS # show we truncate microseconds from the right SELECT CAST(CAST('2008-07-29T10:42:51.1234567' AS DateTime) AS DECIMAL(30,7)); +--echo # +--echo # Bug#59173: Failure to handle DATE(TIME) values where Year, Month or +--echo # Day is ZERO +--echo # +CREATE TABLE t1 (dt1 DATETIME); +INSERT INTO t1 (dt1) VALUES ('0000-00-01 00:00:01'); +DELETE FROM t1 WHERE dt1 = '0000-00-01 00:00:01'; +--echo # Should be empty +SELECT * FROM t1; +DROP TABLE t1; + --echo End of 5.1 tests diff --git a/sql/item_cmpfunc.cc b/sql/item_cmpfunc.cc index d2e1ebbb3a1..40056cfd1ef 100644 --- a/sql/item_cmpfunc.cc +++ b/sql/item_cmpfunc.cc @@ -913,7 +913,7 @@ int Arg_comparator::set_cmp_func(Item_result_field *owner_arg, cache_converted_constant can't be used here because it can't correctly convert a DATETIME value from string to int representation. */ - Item_cache_int *cache= new Item_cache_int(); + Item_cache_int *cache= new Item_cache_int(MYSQL_TYPE_DATETIME); /* Mark the cache as non-const to prevent re-caching. */ cache->set_used_tables(1); if (!(*a)->is_datetime()) From d43a3b38da4681d2f2af3265d85c08ff54a87643 Mon Sep 17 00:00:00 2001 From: Bjorn Munch Date: Fri, 21 Jan 2011 13:57:21 +0100 Subject: [PATCH 038/202] Bug #59063 rpl_migration_crash_safe fails on Windows Race condition may occur: mtr sees the .expect file but it's empty Fix: wait and try again if file is empty Addendum: try again if line isn't 'wait' or 'restart' Also added verbose printout of extra restart options --- mysql-test/mysql-test-run.pl | 9 +++++++-- 1 file changed, 7 insertions(+), 2 deletions(-) diff --git a/mysql-test/mysql-test-run.pl b/mysql-test/mysql-test-run.pl index ebf3976033b..388d2cd2672 100755 --- a/mysql-test/mysql-test-run.pl +++ b/mysql-test/mysql-test-run.pl @@ -4093,8 +4093,10 @@ sub check_expected_crash_and_restart { { mtr_verbose("Crash was expected, file '$expect_file' exists"); - for (my $waits = 0; $waits < 50; $waits++) + for (my $waits = 0; $waits < 50; mtr_milli_sleep(100), $waits++) { + # Race condition seen on Windows: try again until file not empty + next if -z $expect_file; # If last line in expect file starts with "wait" # sleep a little and try again, thus allowing the # test script to control when the server should start @@ -4103,10 +4105,11 @@ sub check_expected_crash_and_restart { if ($last_line =~ /^wait/ ) { mtr_verbose("Test says wait before restart") if $waits == 0; - mtr_milli_sleep(100); next; } + # Ignore any partial or unknown command + next unless $last_line =~ /^restart/; # If last line begins "restart:", the rest of the line is read as # extra command line options to add to the restarted mysqld. # Anything other than 'wait' or 'restart:' (with a colon) will @@ -4471,6 +4474,8 @@ sub mysqld_start ($$) { my @all_opts= @$extra_opts; if (exists $mysqld->{'restart_opts'}) { push (@all_opts, @{$mysqld->{'restart_opts'}}); + mtr_verbose(My::Options::toStr("mysqld_start restart", + @{$mysqld->{'restart_opts'}})); } mysqld_arguments($args,$mysqld,\@all_opts); From 49b7a1f48d4e263e572df825ab89004893963f87 Mon Sep 17 00:00:00 2001 From: unknown Date: Mon, 24 Jan 2011 11:48:54 +0800 Subject: [PATCH 039/202] Postfix BUG#58546 Updated Copyright. --- sql/slave.cc | 2 +- sql/sql_repl.cc | 2 +- 2 files changed, 2 insertions(+), 2 deletions(-) diff --git a/sql/slave.cc b/sql/slave.cc index 0e74d0ce3c0..6d266245460 100644 --- a/sql/slave.cc +++ b/sql/slave.cc @@ -1,4 +1,4 @@ -/* Copyright (C) 2000-2003 MySQL AB +/* Copyright (C) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/sql/sql_repl.cc b/sql/sql_repl.cc index 0ade0b759d5..8c769ce6acf 100644 --- a/sql/sql_repl.cc +++ b/sql/sql_repl.cc @@ -1,4 +1,4 @@ -/* Copyright (C) 2000-2006 MySQL AB & Sasha +/* Copyright (C) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by From e24398ee42c05f6e0589d2c27cb2ab4593b74ad4 Mon Sep 17 00:00:00 2001 From: Mattias Jonsson Date: Mon, 24 Jan 2011 13:41:44 +0100 Subject: [PATCH 040/202] Bug#59297: Can't find record in 'tablename' on update inner join Regression introduced in bug#52455. Problem was that the fixed function did not set the last used partition variable, resulting in wrong partition used when storing the position of the newly retrieved row. Fixed by setting the last used partition in ha_partition::index_read_idx_map. --- mysql-test/r/partition.result | 38 +++++++++++++++++++++++++++++++ mysql-test/t/partition.test | 43 +++++++++++++++++++++++++++++++++++ sql/ha_partition.cc | 1 + 3 files changed, 82 insertions(+) diff --git a/mysql-test/r/partition.result b/mysql-test/r/partition.result index 27ada9d1129..138264fd4e1 100644 --- a/mysql-test/r/partition.result +++ b/mysql-test/r/partition.result @@ -1,5 +1,43 @@ drop table if exists t1, t2; # +# Bug#59297: Can't find record in 'tablename' on update inner join +# +CREATE TABLE t1 ( +a char(2) NOT NULL, +b char(2) NOT NULL, +c int(10) unsigned NOT NULL, +d varchar(255) DEFAULT NULL, +e varchar(1000) DEFAULT NULL, +PRIMARY KEY (a, b, c), +KEY (a), +KEY (a, b) +) +/*!50100 PARTITION BY KEY (a) +PARTITIONS 20 */; +INSERT INTO t1 (a, b, c, d, e) VALUES +('07', '03', 343, '1', '07_03_343'), +('01', '04', 343, '2', '01_04_343'), +('01', '06', 343, '3', '01_06_343'), +('01', '07', 343, '4', '01_07_343'), +('01', '08', 343, '5', '01_08_343'), +('01', '09', 343, '6', '01_09_343'), +('03', '03', 343, '7', '03_03_343'), +('03', '06', 343, '8', '03_06_343'), +('03', '07', 343, '9', '03_07_343'), +('04', '03', 343, '10', '04_03_343'), +('04', '06', 343, '11', '04_06_343'), +('05', '03', 343, '12', '05_03_343'), +('11', '03', 343, '13', '11_03_343'), +('11', '04', 343, '14', '11_04_343') +; +UPDATE t1 AS A, +(SELECT '03' AS a, '06' AS b, 343 AS c, 'last' AS d) AS B +SET A.e = B.d +WHERE A.a = '03' +AND A.b = '06' +AND A.c = 343; +DROP TABLE t1; +# # Bug#57113: ha_partition::extra(ha_extra_function): # Assertion `m_extra_cache' failed CREATE TABLE t1 diff --git a/mysql-test/t/partition.test b/mysql-test/t/partition.test index 0151820cef9..7a0a5558d32 100644 --- a/mysql-test/t/partition.test +++ b/mysql-test/t/partition.test @@ -14,6 +14,49 @@ drop table if exists t1, t2; --enable_warnings +--echo # +--echo # Bug#59297: Can't find record in 'tablename' on update inner join +--echo # + +CREATE TABLE t1 ( +a char(2) NOT NULL, +b char(2) NOT NULL, +c int(10) unsigned NOT NULL, +d varchar(255) DEFAULT NULL, +e varchar(1000) DEFAULT NULL, +PRIMARY KEY (a, b, c), +KEY (a), +KEY (a, b) +) +/*!50100 PARTITION BY KEY (a) +PARTITIONS 20 */; + +INSERT INTO t1 (a, b, c, d, e) VALUES +('07', '03', 343, '1', '07_03_343'), +('01', '04', 343, '2', '01_04_343'), +('01', '06', 343, '3', '01_06_343'), +('01', '07', 343, '4', '01_07_343'), +('01', '08', 343, '5', '01_08_343'), +('01', '09', 343, '6', '01_09_343'), +('03', '03', 343, '7', '03_03_343'), +('03', '06', 343, '8', '03_06_343'), +('03', '07', 343, '9', '03_07_343'), +('04', '03', 343, '10', '04_03_343'), +('04', '06', 343, '11', '04_06_343'), +('05', '03', 343, '12', '05_03_343'), +('11', '03', 343, '13', '11_03_343'), +('11', '04', 343, '14', '11_04_343') +; + +UPDATE t1 AS A, +(SELECT '03' AS a, '06' AS b, 343 AS c, 'last' AS d) AS B +SET A.e = B.d +WHERE A.a = '03' +AND A.b = '06' +AND A.c = 343; + +DROP TABLE t1; + --echo # --echo # Bug#57113: ha_partition::extra(ha_extra_function): --echo # Assertion `m_extra_cache' failed diff --git a/sql/ha_partition.cc b/sql/ha_partition.cc index 7bcbd241541..f55c48189fe 100644 --- a/sql/ha_partition.cc +++ b/sql/ha_partition.cc @@ -4317,6 +4317,7 @@ int ha_partition::index_read_idx_map(uchar *buf, uint index, break; } } + m_last_part= part; } else { From a9d18719f639c61632ccc1feb059e927ab8e6b10 Mon Sep 17 00:00:00 2001 From: Sandeep Doddaballapur Date: Tue, 25 Jan 2011 12:14:28 +0530 Subject: [PATCH 041/202] --- mysql-test/r/csv_not_null.result | 3 +++ mysql-test/t/csv_not_null.test | 6 ++---- 2 files changed, 5 insertions(+), 4 deletions(-) diff --git a/mysql-test/r/csv_not_null.result b/mysql-test/r/csv_not_null.result index af583a36837..aed9bcb1587 100644 --- a/mysql-test/r/csv_not_null.result +++ b/mysql-test/r/csv_not_null.result @@ -19,13 +19,16 @@ INSERT INTO t1 VALUES(); SELECT * FROM t1; a b c d e f 0 foo 0000-00-00 +INSERT INTO t1 VALUES(default,default,default,default,default,default); SELECT * FROM t1; a b c d e f 0 foo 0000-00-00 +0 foo 0000-00-00 INSERT INTO t1 VALUES(0,'abc','def','ghi','bar','1999-12-31'); SELECT * FROM t1; a b c d e f 0 foo 0000-00-00 +0 foo 0000-00-00 0 abc def ghi bar 1999-12-31 # === insert failures === INSERT INTO t1 VALUES(NULL,'ab','a','b','foo','2007-01-01'); diff --git a/mysql-test/t/csv_not_null.test b/mysql-test/t/csv_not_null.test index 03ed566fb22..bebea53b2f7 100644 --- a/mysql-test/t/csv_not_null.test +++ b/mysql-test/t/csv_not_null.test @@ -55,10 +55,8 @@ INSERT INTO t1 VALUES(); SELECT * FROM t1; -- disable_warnings -# NOTE - Test disabled due to enum crash for this INSERT -# See Bug#33717 - INSERT...(default) fails for enum. -# Crashes CSV tables, loads spaces for MyISAM -#INSERT INTO t1 VALUES(default,default,default,default,default,default); +# Bug#33717 - INSERT...(default) fails for enum. +INSERT INTO t1 VALUES(default,default,default,default,default,default); -- enable_warnings SELECT * FROM t1; From 60a622d1c1940f80829a4df312ff49a6feae265e Mon Sep 17 00:00:00 2001 From: =?UTF-8?q?Marko=20M=C3=A4kel=C3=A4?= Date: Tue, 25 Jan 2011 09:56:18 +0200 Subject: [PATCH 042/202] Bug#59707 Unused compression-related parameters in buffer pool functions buf_block_alloc(): ulint zip_size is always 0. buf_LRU_get_free_block(): ulint zip_size is always 0. buf_LRU_free_block(): ibool* buf_pool_mutex_released is always NULL. Remove these parameters. buf_LRU_get_free_block(): Simplify the initialization of block->page.zip and release buf_pool_mutex() earlier. --- storage/innodb_plugin/ChangeLog | 9 +++++ storage/innodb_plugin/btr/btr0btr.c | 2 +- storage/innodb_plugin/btr/btr0cur.c | 5 ++- storage/innodb_plugin/btr/btr0sea.c | 2 +- storage/innodb_plugin/buf/buf0buddy.c | 2 +- storage/innodb_plugin/buf/buf0buf.c | 14 ++++---- storage/innodb_plugin/buf/buf0lru.c | 44 +++++------------------- storage/innodb_plugin/include/buf0buf.h | 6 ++-- storage/innodb_plugin/include/buf0buf.ic | 8 ++--- storage/innodb_plugin/include/buf0lru.h | 14 +++----- storage/innodb_plugin/mem/mem0mem.c | 2 +- storage/innodb_plugin/page/page0zip.c | 2 +- 12 files changed, 40 insertions(+), 70 deletions(-) diff --git a/storage/innodb_plugin/ChangeLog b/storage/innodb_plugin/ChangeLog index 4d35bcff4a1..24cac7ac2be 100644 --- a/storage/innodb_plugin/ChangeLog +++ b/storage/innodb_plugin/ChangeLog @@ -1,3 +1,12 @@ +2011-01-25 The InnoDB Team + + * btr/btr0btr.c, btr/btr0cur.c, btr/btr0sea.c, + buf/buf0buddy.c, buf/buf0buf.c, buf/buf0lru.c, + include/buf0buf.h, include/buf0buf.ic, include/buf0lru.h, + mem/mem0mem.c, page/page0zip.c: + Fix Bug#59707 Unused compression-related parameters + in buffer pool functions + 2011-01-18 The InnoDB Team * include/sync0rw.h, sync/sync0arr.c, sync/sync0rw.c: diff --git a/storage/innodb_plugin/btr/btr0btr.c b/storage/innodb_plugin/btr/btr0btr.c index 32e2caecdb8..3d8d6048603 100644 --- a/storage/innodb_plugin/btr/btr0btr.c +++ b/storage/innodb_plugin/btr/btr0btr.c @@ -979,7 +979,7 @@ btr_page_reorganize_low( log_mode = mtr_set_log_mode(mtr, MTR_LOG_NONE); #ifndef UNIV_HOTBACKUP - temp_block = buf_block_alloc(0); + temp_block = buf_block_alloc(); #else /* !UNIV_HOTBACKUP */ ut_ad(block == back_block1); temp_block = back_block2; diff --git a/storage/innodb_plugin/btr/btr0cur.c b/storage/innodb_plugin/btr/btr0cur.c index 1fb0bc39933..f41b125b281 100644 --- a/storage/innodb_plugin/btr/btr0cur.c +++ b/storage/innodb_plugin/btr/btr0cur.c @@ -3767,13 +3767,12 @@ btr_blob_free( && buf_block_get_space(block) == space && buf_block_get_page_no(block) == page_no) { - if (buf_LRU_free_block(&block->page, all, NULL) - != BUF_LRU_FREED + if (buf_LRU_free_block(&block->page, all) != BUF_LRU_FREED && all && block->page.zip.data) { /* Attempt to deallocate the uncompressed page if the whole block cannot be deallocted. */ - buf_LRU_free_block(&block->page, FALSE, NULL); + buf_LRU_free_block(&block->page, FALSE); } } diff --git a/storage/innodb_plugin/btr/btr0sea.c b/storage/innodb_plugin/btr/btr0sea.c index 035fdbb61d2..9835efcf712 100644 --- a/storage/innodb_plugin/btr/btr0sea.c +++ b/storage/innodb_plugin/btr/btr0sea.c @@ -141,7 +141,7 @@ btr_search_check_free_space_in_heap(void) be enough free space in the hash table. */ if (heap->free_block == NULL) { - buf_block_t* block = buf_block_alloc(0); + buf_block_t* block = buf_block_alloc(); rw_lock_x_lock(&btr_search_latch); diff --git a/storage/innodb_plugin/buf/buf0buddy.c b/storage/innodb_plugin/buf/buf0buddy.c index ee5a569c3ff..63c99571510 100644 --- a/storage/innodb_plugin/buf/buf0buddy.c +++ b/storage/innodb_plugin/buf/buf0buddy.c @@ -327,7 +327,7 @@ buf_buddy_alloc_low( /* Try replacing an uncompressed page in the buffer pool. */ buf_pool_mutex_exit(); - block = buf_LRU_get_free_block(0); + block = buf_LRU_get_free_block(); *lru = TRUE; buf_pool_mutex_enter(); diff --git a/storage/innodb_plugin/buf/buf0buf.c b/storage/innodb_plugin/buf/buf0buf.c index dac416f9472..6e76e4c65be 100644 --- a/storage/innodb_plugin/buf/buf0buf.c +++ b/storage/innodb_plugin/buf/buf0buf.c @@ -1283,7 +1283,7 @@ shrink_again: buf_LRU_make_block_old(&block->page); dirty++; - } else if (buf_LRU_free_block(&block->page, TRUE, NULL) + } else if (buf_LRU_free_block(&block->page, TRUE) != BUF_LRU_FREED) { nonfree++; } @@ -1729,8 +1729,7 @@ err_exit: mutex_enter(block_mutex); /* Discard the uncompressed page frame if possible. */ - if (buf_LRU_free_block(bpage, FALSE, NULL) - == BUF_LRU_FREED) { + if (buf_LRU_free_block(bpage, FALSE) == BUF_LRU_FREED) { mutex_exit(block_mutex); goto lookup; @@ -2165,7 +2164,7 @@ wait_until_unfixed: buf_pool_mutex_exit(); mutex_exit(&buf_pool_zip_mutex); - block = buf_LRU_get_free_block(0); + block = buf_LRU_get_free_block(); ut_a(block); buf_pool_mutex_enter(); @@ -2291,8 +2290,7 @@ wait_until_unfixed: /* Try to evict the block from the buffer pool, to use the insert buffer as much as possible. */ - if (buf_LRU_free_block(&block->page, TRUE, NULL) - == BUF_LRU_FREED) { + if (buf_LRU_free_block(&block->page, TRUE) == BUF_LRU_FREED) { buf_pool_mutex_exit(); mutex_exit(&block->mutex); fprintf(stderr, @@ -2829,7 +2827,7 @@ buf_page_init_for_read( && UNIV_LIKELY(!recv_recovery_is_on())) { block = NULL; } else { - block = buf_LRU_get_free_block(0); + block = buf_LRU_get_free_block(); ut_ad(block); } @@ -3001,7 +2999,7 @@ buf_page_create( ut_ad(mtr->state == MTR_ACTIVE); ut_ad(space || !zip_size); - free_block = buf_LRU_get_free_block(0); + free_block = buf_LRU_get_free_block(); buf_pool_mutex_enter(); diff --git a/storage/innodb_plugin/buf/buf0lru.c b/storage/innodb_plugin/buf/buf0lru.c index e4cf218bf2e..39feb06ff23 100644 --- a/storage/innodb_plugin/buf/buf0lru.c +++ b/storage/innodb_plugin/buf/buf0lru.c @@ -575,7 +575,7 @@ buf_LRU_free_from_unzip_LRU_list( ut_ad(block->page.in_LRU_list); mutex_enter(&block->mutex); - freed = buf_LRU_free_block(&block->page, FALSE, NULL); + freed = buf_LRU_free_block(&block->page, FALSE); mutex_exit(&block->mutex); switch (freed) { @@ -636,7 +636,7 @@ buf_LRU_free_from_common_LRU_list( mutex_enter(block_mutex); accessed = buf_page_is_accessed(bpage); - freed = buf_LRU_free_block(bpage, TRUE, NULL); + freed = buf_LRU_free_block(bpage, TRUE); mutex_exit(block_mutex); switch (freed) { @@ -798,10 +798,8 @@ LRU list to the free list. @return the free control block, in state BUF_BLOCK_READY_FOR_USE */ UNIV_INTERN buf_block_t* -buf_LRU_get_free_block( -/*===================*/ - ulint zip_size) /*!< in: compressed page size in bytes, - or 0 if uncompressed tablespace */ +buf_LRU_get_free_block(void) +/*========================*/ { buf_block_t* block = NULL; ibool freed; @@ -877,26 +875,10 @@ loop: /* If there is a block in the free list, take it */ block = buf_LRU_get_free_only(); + buf_pool_mutex_exit(); + if (block) { - -#ifdef UNIV_DEBUG - block->page.zip.m_start = -#endif /* UNIV_DEBUG */ - block->page.zip.m_end = - block->page.zip.m_nonempty = - block->page.zip.n_blobs = 0; - - if (UNIV_UNLIKELY(zip_size)) { - ibool lru; - page_zip_set_size(&block->page.zip, zip_size); - block->page.zip.data = buf_buddy_alloc(zip_size, &lru); - UNIV_MEM_DESC(block->page.zip.data, zip_size, block); - } else { - page_zip_set_size(&block->page.zip, 0); - block->page.zip.data = NULL; - } - - buf_pool_mutex_exit(); + memset(&block->page.zip, 0, sizeof block->page.zip); if (started_monitor) { srv_print_innodb_monitor = mon_value_was; @@ -908,8 +890,6 @@ loop: /* If no block was in the free list, search from the end of the LRU list and try to free a block there */ - buf_pool_mutex_exit(); - freed = buf_LRU_search_and_free_block(n_iterations); if (freed > 0) { @@ -1378,12 +1358,8 @@ enum buf_lru_free_block_status buf_LRU_free_block( /*===============*/ buf_page_t* bpage, /*!< in: block to be freed */ - ibool zip, /*!< in: TRUE if should remove also the + ibool zip) /*!< in: TRUE if should remove also the compressed page of an uncompressed page */ - ibool* buf_pool_mutex_released) - /*!< in: pointer to a variable that will - be assigned TRUE if buf_pool_mutex - was temporarily released, or NULL */ { buf_page_t* b = NULL; mutex_t* block_mutex = buf_page_get_mutex(bpage); @@ -1554,10 +1530,6 @@ alloc: b->io_fix = BUF_IO_READ; } - if (buf_pool_mutex_released) { - *buf_pool_mutex_released = TRUE; - } - buf_pool_mutex_exit(); mutex_exit(block_mutex); diff --git a/storage/innodb_plugin/include/buf0buf.h b/storage/innodb_plugin/include/buf0buf.h index cd4ee5906f0..d903b443920 100644 --- a/storage/innodb_plugin/include/buf0buf.h +++ b/storage/innodb_plugin/include/buf0buf.h @@ -165,10 +165,8 @@ Allocates a buffer block. @return own: the allocated block, in state BUF_BLOCK_MEMORY */ UNIV_INLINE buf_block_t* -buf_block_alloc( -/*============*/ - ulint zip_size); /*!< in: compressed page size in bytes, - or 0 if uncompressed tablespace */ +buf_block_alloc(void); +/*=================*/ /********************************************************************//** Frees a buffer block which does not contain a file page. */ UNIV_INLINE diff --git a/storage/innodb_plugin/include/buf0buf.ic b/storage/innodb_plugin/include/buf0buf.ic index 23db684806c..0025bef5aac 100644 --- a/storage/innodb_plugin/include/buf0buf.ic +++ b/storage/innodb_plugin/include/buf0buf.ic @@ -719,14 +719,12 @@ Allocates a buffer block. @return own: the allocated block, in state BUF_BLOCK_MEMORY */ UNIV_INLINE buf_block_t* -buf_block_alloc( -/*============*/ - ulint zip_size) /*!< in: compressed page size in bytes, - or 0 if uncompressed tablespace */ +buf_block_alloc(void) +/*=================*/ { buf_block_t* block; - block = buf_LRU_get_free_block(zip_size); + block = buf_LRU_get_free_block(); buf_block_set_state(block, BUF_BLOCK_MEMORY); diff --git a/storage/innodb_plugin/include/buf0lru.h b/storage/innodb_plugin/include/buf0lru.h index 5a9cfd059f3..d543bce53cd 100644 --- a/storage/innodb_plugin/include/buf0lru.h +++ b/storage/innodb_plugin/include/buf0lru.h @@ -110,12 +110,9 @@ enum buf_lru_free_block_status buf_LRU_free_block( /*===============*/ buf_page_t* bpage, /*!< in: block to be freed */ - ibool zip, /*!< in: TRUE if should remove also the + ibool zip) /*!< in: TRUE if should remove also the compressed page of an uncompressed page */ - ibool* buf_pool_mutex_released); - /*!< in: pointer to a variable that will - be assigned TRUE if buf_pool_mutex - was temporarily released, or NULL */ + __attribute__((nonnull)); /******************************************************************//** Try to free a replaceable block. @return TRUE if found and freed */ @@ -146,10 +143,9 @@ LRU list to the free list. @return the free control block, in state BUF_BLOCK_READY_FOR_USE */ UNIV_INTERN buf_block_t* -buf_LRU_get_free_block( -/*===================*/ - ulint zip_size); /*!< in: compressed page size in bytes, - or 0 if uncompressed tablespace */ +buf_LRU_get_free_block(void) +/*========================*/ + __attribute__((warn_unused_result)); /******************************************************************//** Puts a block back to the free list. */ diff --git a/storage/innodb_plugin/mem/mem0mem.c b/storage/innodb_plugin/mem/mem0mem.c index 1dd4db30841..86100b04fd6 100644 --- a/storage/innodb_plugin/mem/mem0mem.c +++ b/storage/innodb_plugin/mem/mem0mem.c @@ -347,7 +347,7 @@ mem_heap_create_block( return(NULL); } } else { - buf_block = buf_block_alloc(0); + buf_block = buf_block_alloc(); } block = (mem_block_t*) buf_block->frame; diff --git a/storage/innodb_plugin/page/page0zip.c b/storage/innodb_plugin/page/page0zip.c index d3b1edefc6b..bb9b0995c72 100644 --- a/storage/innodb_plugin/page/page0zip.c +++ b/storage/innodb_plugin/page/page0zip.c @@ -4439,7 +4439,7 @@ page_zip_reorganize( log_mode = mtr_set_log_mode(mtr, MTR_LOG_NONE); #ifndef UNIV_HOTBACKUP - temp_block = buf_block_alloc(0); + temp_block = buf_block_alloc(); btr_search_drop_page_hash_index(block); block->check_index_page_at_flush = TRUE; #else /* !UNIV_HOTBACKUP */ From 46b7ef69916635ca0575ea4898ed8980f4bf6f5a Mon Sep 17 00:00:00 2001 From: =?UTF-8?q?Marko=20M=C3=A4kel=C3=A4?= Date: Tue, 25 Jan 2011 11:54:50 +0200 Subject: [PATCH 043/202] Bug#59464 Race condition in row_vers_build_for_semi_consistent_read row_vers_build_for_semi_consistent_read(): Dereference version_trx before releasing kernel_mutex, but not thereafter. --- storage/innobase/row/row0vers.c | 10 +++++++--- storage/innodb_plugin/ChangeLog | 5 +++++ storage/innodb_plugin/row/row0vers.c | 10 +++++++--- 3 files changed, 19 insertions(+), 6 deletions(-) diff --git a/storage/innobase/row/row0vers.c b/storage/innobase/row/row0vers.c index f4adfa855df..23aca8c3f2e 100644 --- a/storage/innobase/row/row0vers.c +++ b/storage/innobase/row/row0vers.c @@ -593,11 +593,15 @@ row_vers_build_for_semi_consistent_read( mutex_enter(&kernel_mutex); version_trx = trx_get_on_id(version_trx_id); + if (version_trx + && (version_trx->conc_state == TRX_COMMITTED_IN_MEMORY + || version_trx->conc_state == TRX_NOT_STARTED)) { + + version_trx = NULL; + } mutex_exit(&kernel_mutex); - if (!version_trx - || version_trx->conc_state == TRX_NOT_STARTED - || version_trx->conc_state == TRX_COMMITTED_IN_MEMORY) { + if (!version_trx) { /* We found a version that belongs to a committed transaction: return it. */ diff --git a/storage/innodb_plugin/ChangeLog b/storage/innodb_plugin/ChangeLog index 24cac7ac2be..d5e9a6bc825 100644 --- a/storage/innodb_plugin/ChangeLog +++ b/storage/innodb_plugin/ChangeLog @@ -1,3 +1,8 @@ +2011-01-25 The InnoDB Team + + * row/row0vers.c: + Fix Bug#59464 Race condition in row_vers_build_for_semi_consistent_read + 2011-01-25 The InnoDB Team * btr/btr0btr.c, btr/btr0cur.c, btr/btr0sea.c, diff --git a/storage/innodb_plugin/row/row0vers.c b/storage/innodb_plugin/row/row0vers.c index b6d35363f08..d4fde0b939b 100644 --- a/storage/innodb_plugin/row/row0vers.c +++ b/storage/innodb_plugin/row/row0vers.c @@ -669,11 +669,15 @@ row_vers_build_for_semi_consistent_read( mutex_enter(&kernel_mutex); version_trx = trx_get_on_id(version_trx_id); + if (version_trx + && (version_trx->conc_state == TRX_COMMITTED_IN_MEMORY + || version_trx->conc_state == TRX_NOT_STARTED)) { + + version_trx = NULL; + } mutex_exit(&kernel_mutex); - if (!version_trx - || version_trx->conc_state == TRX_NOT_STARTED - || version_trx->conc_state == TRX_COMMITTED_IN_MEMORY) { + if (!version_trx) { /* We found a version that belongs to a committed transaction: return it. */ From 896e0ba4e0304fbd1b056022d8e27f6ce146a83e Mon Sep 17 00:00:00 2001 From: =?UTF-8?q?Marko=20M=C3=A4kel=C3=A4?= Date: Tue, 25 Jan 2011 12:17:28 +0200 Subject: [PATCH 044/202] Bug#59486 Incorrect usage of UNIV_UNLIKELY() in mlog_parse_string() mlog_parse_string(): Enclose the comparison in UNIV_UNLIKELY, not the comparand. --- storage/innodb_plugin/ChangeLog | 5 +++++ storage/innodb_plugin/mtr/mtr0log.c | 2 +- 2 files changed, 6 insertions(+), 1 deletion(-) diff --git a/storage/innodb_plugin/ChangeLog b/storage/innodb_plugin/ChangeLog index d5e9a6bc825..cac72fd3075 100644 --- a/storage/innodb_plugin/ChangeLog +++ b/storage/innodb_plugin/ChangeLog @@ -1,3 +1,8 @@ +2011-01-25 The InnoDB Team + + * mtr/mtr0log.c: + Bug#59486 Incorrect usage of UNIV_UNLIKELY() in mlog_parse_string() + 2011-01-25 The InnoDB Team * row/row0vers.c: diff --git a/storage/innodb_plugin/mtr/mtr0log.c b/storage/innodb_plugin/mtr/mtr0log.c index 3f3dab36b76..3349036b5b3 100644 --- a/storage/innodb_plugin/mtr/mtr0log.c +++ b/storage/innodb_plugin/mtr/mtr0log.c @@ -408,7 +408,7 @@ mlog_parse_string( ptr += 2; if (UNIV_UNLIKELY(offset >= UNIV_PAGE_SIZE) - || UNIV_UNLIKELY(len + offset) > UNIV_PAGE_SIZE) { + || UNIV_UNLIKELY(len + offset > UNIV_PAGE_SIZE)) { recv_sys->found_corrupt_log = TRUE; return(NULL); From e44703db76e87fccbcc2e51606f04b18b55a0544 Mon Sep 17 00:00:00 2001 From: =?UTF-8?q?Marko=20M=C3=A4kel=C3=A4?= Date: Tue, 25 Jan 2011 15:43:08 +0200 Subject: [PATCH 045/202] Bug#59585 Fix 58912 introduces compiler warning due to potentially uninitialized variable row_upd_changes_ord_field_binary(): Initialize dfield_len to suppress the warning. The compiler cannot know that row_ext_lookup() does initialize dfield_len for us, as it is defined in a different module. --- storage/innodb_plugin/ChangeLog | 6 ++++++ storage/innodb_plugin/row/row0upd.c | 4 ++++ 2 files changed, 10 insertions(+) diff --git a/storage/innodb_plugin/ChangeLog b/storage/innodb_plugin/ChangeLog index cac72fd3075..e2fdeecfcc1 100644 --- a/storage/innodb_plugin/ChangeLog +++ b/storage/innodb_plugin/ChangeLog @@ -1,3 +1,9 @@ +2011-01-25 The InnoDB Team + + * row/row0upd.c: + Bug#59585 Fix 58912 introduces compiler warning + due to potentially uninitialized variable + 2011-01-25 The InnoDB Team * mtr/mtr0log.c: diff --git a/storage/innodb_plugin/row/row0upd.c b/storage/innodb_plugin/row/row0upd.c index 4aa1474a25b..691d263e6ed 100644 --- a/storage/innodb_plugin/row/row0upd.c +++ b/storage/innodb_plugin/row/row0upd.c @@ -1252,6 +1252,10 @@ row_upd_changes_ord_field_binary( || dfield_is_null(dfield)) { /* do nothing special */ } else if (UNIV_LIKELY_NULL(ext)) { + /* Silence a compiler warning without + silencing a Valgrind error. */ + dfield_len = 0; + UNIV_MEM_INVALID(&dfield_len, sizeof dfield_len); /* See if the column is stored externally. */ buf = row_ext_lookup(ext, col_no, &dfield_len); From 8ec9bbaf598b2cf24c4720c994220eae122befc1 Mon Sep 17 00:00:00 2001 From: Libing Song Date: Wed, 26 Jan 2011 15:30:06 +0800 Subject: [PATCH 046/202] Postfix bug#49124 Updated the copyright. --- sql/mysql_priv.h | 2 +- sql/sql_lex.cc | 2 +- sql/sql_lex.h | 2 +- sql/sql_parse.cc | 2 +- 4 files changed, 4 insertions(+), 4 deletions(-) diff --git a/sql/mysql_priv.h b/sql/mysql_priv.h index 5f8458f4f1e..d88e629b91b 100644 --- a/sql/mysql_priv.h +++ b/sql/mysql_priv.h @@ -1,4 +1,4 @@ -/* Copyright (C) 2000-2003 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/sql/sql_lex.cc b/sql/sql_lex.cc index a013d5466c1..97d9fe99eb3 100644 --- a/sql/sql_lex.cc +++ b/sql/sql_lex.cc @@ -1,4 +1,4 @@ -/* Copyright (C) 2000-2006 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/sql/sql_lex.h b/sql/sql_lex.h index 7a315d81aa5..b3822f91afe 100644 --- a/sql/sql_lex.h +++ b/sql/sql_lex.h @@ -1,4 +1,4 @@ -/* Copyright (C) 2000-2006 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/sql/sql_parse.cc b/sql/sql_parse.cc index 0f75b835315..de67b99b172 100644 --- a/sql/sql_parse.cc +++ b/sql/sql_parse.cc @@ -1,4 +1,4 @@ -/* Copyright (c) 2000, 2010, Oracle and/or its affiliates. All rights reserved. +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by From e5a18c760f55565eafd207162b4ecac75fcce993 Mon Sep 17 00:00:00 2001 From: Alfranio Correia Date: Wed, 26 Jan 2011 12:37:24 +0000 Subject: [PATCH 047/202] Disabled rpl_row_until and rpl_stm_until due to BUG#59543. --- mysql-test/suite/rpl/t/disabled.def | 2 ++ 1 file changed, 2 insertions(+) diff --git a/mysql-test/suite/rpl/t/disabled.def b/mysql-test/suite/rpl/t/disabled.def index b5956a78371..3b3a55fe4cd 100644 --- a/mysql-test/suite/rpl/t/disabled.def +++ b/mysql-test/suite/rpl/t/disabled.def @@ -13,3 +13,5 @@ rpl_row_create_table : Bug#51574 Feb 27 2010 andrei failed different way than earlier with bug#45576 rpl_log_pos : BUG#55675 Sep 10 2010 27 2010 alfranio rpl.rpl_log_pos fails sporadically with error binlog truncated in the middle rpl_get_master_version_and_clock : Bug#59178 Jan 05 2011 joro Valgrind warnings rpl_get_master_version_and_clock +rpl_row_until : BUG#59543 Jan 26 2011 alfranio Replication test from eits suite rpl_row_until times out +rpl_stm_until : BUG#59543 Jan 26 2011 alfranio Replication test from eits suite rpl_row_until times out From 7083cb0bd99c352dfb37828bee1c9de1d1edb068 Mon Sep 17 00:00:00 2001 From: Ramil Kalimullin Date: Wed, 26 Jan 2011 15:49:09 +0300 Subject: [PATCH 048/202] Bug #47811 : remove the non-default alignment specification. Fix backported from to 5.0. "Remove the alignment option, let valgrind use its default" mysql-test/mysql-test-run-shell.sh: Bug #47811 : remove the non-default alignment specification. - backport from 5.1 "Remove the alignment option, let valgrind use its default" mysql-test/mysql-test-run.pl: Bug #47811 : remove the non-default alignment specification. - backport from 5.1 "Remove the alignment option, let valgrind use its default" --- mysql-test/mysql-test-run-shell.sh | 2 +- mysql-test/mysql-test-run.pl | 1 - 2 files changed, 1 insertion(+), 2 deletions(-) diff --git a/mysql-test/mysql-test-run-shell.sh b/mysql-test/mysql-test-run-shell.sh index d919246f2e1..d4d31506f23 100644 --- a/mysql-test/mysql-test-run-shell.sh +++ b/mysql-test/mysql-test-run-shell.sh @@ -150,7 +150,7 @@ find_valgrind() fi # >=2.1.2 requires the --tool option, some versions write to stdout, some to stderr valgrind --help 2>&1 | grep "\-\-tool" > /dev/null && FIND_VALGRIND="$FIND_VALGRIND --tool=memcheck" - FIND_VALGRIND="$FIND_VALGRIND --alignment=8 --leak-check=yes --num-callers=16 --suppressions=$MYSQL_TEST_DIR/valgrind.supp" + FIND_VALGRIND="$FIND_VALGRIND --leak-check=yes --num-callers=16 --suppressions=$MYSQL_TEST_DIR/valgrind.supp" } # No paths below as we can't be sure where the program is! diff --git a/mysql-test/mysql-test-run.pl b/mysql-test/mysql-test-run.pl index 2cfd689b0e7..f0100593516 100755 --- a/mysql-test/mysql-test-run.pl +++ b/mysql-test/mysql-test-run.pl @@ -5135,7 +5135,6 @@ sub valgrind_arguments { else { mtr_add_arg($args, "--tool=memcheck"); # From >= 2.1.2 needs this option - mtr_add_arg($args, "--alignment=8"); mtr_add_arg($args, "--leak-check=yes"); mtr_add_arg($args, "--num-callers=16"); mtr_add_arg($args, "--suppressions=%s/valgrind.supp", $glob_mysql_test_dir) From 786ac62c82038ed42278b3699b0661f0bb3c80ac Mon Sep 17 00:00:00 2001 From: =?UTF-8?q?Marko=20M=C3=A4kel=C3=A4?= Date: Thu, 27 Jan 2011 13:27:29 +0200 Subject: [PATCH 049/202] Bug#59440 Race condition in XA ROLLBACK and XA COMMIT after server restart trx_get_trx_by_xid(): Invalidate trx->xid after a successful lookup, so that subsequent callers will not find the same transaction. The only callers of trx_get_trx_by_xid() will be invoking innobase_commit_low() or innobase_rollback_trx(), and those code paths should not depend on trx->xid. rb://584 approved by Jimmy Yang --- storage/innobase/include/trx0trx.h | 5 +++-- storage/innobase/trx/trx0trx.c | 26 ++++++++++++------------- storage/innodb_plugin/ChangeLog | 6 ++++++ storage/innodb_plugin/include/trx0trx.h | 4 ++-- storage/innodb_plugin/trx/trx0trx.c | 25 +++++++++++------------- 5 files changed, 34 insertions(+), 32 deletions(-) diff --git a/storage/innobase/include/trx0trx.h b/storage/innobase/include/trx0trx.h index 97a47d9f46e..4652f45892e 100644 --- a/storage/innobase/include/trx0trx.h +++ b/storage/innobase/include/trx0trx.h @@ -198,8 +198,9 @@ which is in the prepared state */ trx_t * trx_get_trx_by_xid( /*===============*/ - /* out: trx or NULL */ - XID* xid); /* in: X/Open XA transaction identification */ + /* out: trx or NULL; + on match, the trx->xid will be invalidated */ + const XID* xid); /* in: X/Open XA transaction identifier */ /************************************************************************** If required, flushes the log to disk if we called trx_commit_for_mysql() with trx->flush_log_later == TRUE. */ diff --git a/storage/innobase/trx/trx0trx.c b/storage/innobase/trx/trx0trx.c index 21f75e0818f..a82d7f452fc 100644 --- a/storage/innobase/trx/trx0trx.c +++ b/storage/innobase/trx/trx0trx.c @@ -2041,14 +2041,15 @@ which is in the prepared state */ trx_t* trx_get_trx_by_xid( /*===============*/ - /* out: trx or NULL */ - XID* xid) /* in: X/Open XA transaction identification */ + /* out: trx or NULL; + on match, the trx->xid will be invalidated */ + const XID* xid) /* in: X/Open XA transaction identifier */ { trx_t* trx; if (xid == NULL) { - return (NULL); + return(NULL); } mutex_enter(&kernel_mutex); @@ -2061,10 +2062,16 @@ trx_get_trx_by_xid( of gtrid_lenght+bqual_length bytes should be the same */ - if (xid->gtrid_length == trx->xid.gtrid_length + if (trx->conc_state == TRX_PREPARED + && xid->gtrid_length == trx->xid.gtrid_length && xid->bqual_length == trx->xid.bqual_length && memcmp(xid->data, trx->xid.data, xid->gtrid_length + xid->bqual_length) == 0) { + + /* Invalidate the XID, so that subsequent calls + will not find it. */ + memset(&trx->xid, 0, sizeof(trx->xid)); + trx->xid.formatID = -1; break; } @@ -2073,14 +2080,5 @@ trx_get_trx_by_xid( mutex_exit(&kernel_mutex); - if (trx) { - if (trx->conc_state != TRX_PREPARED) { - - return(NULL); - } - - return(trx); - } else { - return(NULL); - } + return(trx); } diff --git a/storage/innodb_plugin/ChangeLog b/storage/innodb_plugin/ChangeLog index e2fdeecfcc1..3e14b0052e7 100644 --- a/storage/innodb_plugin/ChangeLog +++ b/storage/innodb_plugin/ChangeLog @@ -1,3 +1,9 @@ +2011-01-27 The InnoDB Team + + * include/trx0trx.h, trx/trx0trx.c: + Bug#59440 Race condition in XA ROLLBACK and XA COMMIT + after server restart + 2011-01-25 The InnoDB Team * row/row0upd.c: diff --git a/storage/innodb_plugin/include/trx0trx.h b/storage/innodb_plugin/include/trx0trx.h index abd175d365b..833bae4a4ff 100644 --- a/storage/innodb_plugin/include/trx0trx.h +++ b/storage/innodb_plugin/include/trx0trx.h @@ -214,12 +214,12 @@ trx_recover_for_mysql( /*******************************************************************//** This function is used to find one X/Open XA distributed transaction which is in the prepared state -@return trx or NULL */ +@return trx or NULL; on match, the trx->xid will be invalidated */ UNIV_INTERN trx_t * trx_get_trx_by_xid( /*===============*/ - XID* xid); /*!< in: X/Open XA transaction identification */ + const XID* xid); /*!< in: X/Open XA transaction identifier */ /**********************************************************************//** If required, flushes the log to disk if we called trx_commit_for_mysql() with trx->flush_log_later == TRUE. diff --git a/storage/innodb_plugin/trx/trx0trx.c b/storage/innodb_plugin/trx/trx0trx.c index ee744fd58b1..f0bbf220815 100644 --- a/storage/innodb_plugin/trx/trx0trx.c +++ b/storage/innodb_plugin/trx/trx0trx.c @@ -2010,18 +2010,18 @@ trx_recover_for_mysql( /*******************************************************************//** This function is used to find one X/Open XA distributed transaction which is in the prepared state -@return trx or NULL */ +@return trx or NULL; on match, the trx->xid will be invalidated */ UNIV_INTERN trx_t* trx_get_trx_by_xid( /*===============*/ - XID* xid) /*!< in: X/Open XA transaction identification */ + const XID* xid) /*!< in: X/Open XA transaction identifier */ { trx_t* trx; if (xid == NULL) { - return (NULL); + return(NULL); } mutex_enter(&kernel_mutex); @@ -2034,10 +2034,16 @@ trx_get_trx_by_xid( of gtrid_lenght+bqual_length bytes should be the same */ - if (xid->gtrid_length == trx->xid.gtrid_length + if (trx->conc_state == TRX_PREPARED + && xid->gtrid_length == trx->xid.gtrid_length && xid->bqual_length == trx->xid.bqual_length && memcmp(xid->data, trx->xid.data, xid->gtrid_length + xid->bqual_length) == 0) { + + /* Invalidate the XID, so that subsequent calls + will not find it. */ + memset(&trx->xid, 0, sizeof(trx->xid)); + trx->xid.formatID = -1; break; } @@ -2046,14 +2052,5 @@ trx_get_trx_by_xid( mutex_exit(&kernel_mutex); - if (trx) { - if (trx->conc_state != TRX_PREPARED) { - - return(NULL); - } - - return(trx); - } else { - return(NULL); - } + return(trx); } From 62ab20034300b0483c8d73387794d881f12b809d Mon Sep 17 00:00:00 2001 From: Mattias Jonsson Date: Thu, 27 Jan 2011 23:47:24 +0100 Subject: [PATCH 050/202] Update of copyright headers for files I changed this year. --- sql/item.h | 2 +- sql/item_func.h | 2 +- sql/item_timefunc.h | 2 +- sql/sql_partition.cc | 2 +- sql/table.cc | 2 +- 5 files changed, 5 insertions(+), 5 deletions(-) diff --git a/sql/item.h b/sql/item.h index 38b33bdf2fe..b187c1b6717 100644 --- a/sql/item.h +++ b/sql/item.h @@ -1,4 +1,4 @@ -/* Copyright (c) 2000, 2010, Oracle and/or its affiliates. All rights reserved. +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/sql/item_func.h b/sql/item_func.h index e9d91b56318..5dd68157e0b 100644 --- a/sql/item_func.h +++ b/sql/item_func.h @@ -1,4 +1,4 @@ -/* Copyright (c) 2000, 2010, Oracle and/or its affiliates. All rights reserved. +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/sql/item_timefunc.h b/sql/item_timefunc.h index f4299460abf..2d0a6217f0c 100644 --- a/sql/item_timefunc.h +++ b/sql/item_timefunc.h @@ -1,4 +1,4 @@ -/* Copyright (C) 2000-2006 MySQL AB +/* Copyright (c) 2000, 2011 Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/sql/sql_partition.cc b/sql/sql_partition.cc index cb55695d4c1..d10f695f535 100644 --- a/sql/sql_partition.cc +++ b/sql/sql_partition.cc @@ -1,4 +1,4 @@ -/* Copyright 2005-2008 MySQL AB, 2008 Sun Microsystems, Inc. +/* Copyright (c) 2005, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by diff --git a/sql/table.cc b/sql/table.cc index b43d29294a8..7dbf02027fa 100644 --- a/sql/table.cc +++ b/sql/table.cc @@ -1,4 +1,4 @@ -/* Copyright 2000-2008 MySQL AB, 2008 Sun Microsystems, Inc. +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by From 235e10d987222b8cc42e1f3a9a79834912d45026 Mon Sep 17 00:00:00 2001 From: Alfranio Correia Date: Fri, 28 Jan 2011 01:25:26 +0000 Subject: [PATCH 051/202] BUG#55675 rpl.rpl_log_pos fails sporadically with error binlog truncated in the middle There are two calls to read_log_event() on master in mysql_binlog_send(). Each call reads 19 bytes in this test case and the error of the second read_log_event() is reported to the slave. The second read_log_event() starts from position 94 (75 + 19) to 113 (75 + 19 + 19). Usually, there are two events in the binary log: . 0 - 3 - Header . 4 - 105 - Format Descriptor Event . 106 - 304 - Query Event and both reads fail because operations are reading from invalid positions as expected. However, mysql_binlog_send() does not use the same IO_CACHE that is used to write into binary log (i.e. mysql_bin_log.log_file) for the hot binary log. It opens the binary log file directly by calling open_binlog() and creates a separated IO_CACHE. So there is a possibly that after a master has flushed the binary log file, the content has been cached by the filesystem, and has not updated the disk file. If this happens, then a slave will only see part of the file, and thus the second read_log_event() will report event truncated error. To fix the problem, if the first read_log_event() has failed, we ensure that the second one will try to read from the same position. --- mysql-test/suite/rpl/t/disabled.def | 1 - sql/sql_repl.cc | 9 ++++++++- 2 files changed, 8 insertions(+), 2 deletions(-) diff --git a/mysql-test/suite/rpl/t/disabled.def b/mysql-test/suite/rpl/t/disabled.def index 3b3a55fe4cd..33f65ff3ecc 100644 --- a/mysql-test/suite/rpl/t/disabled.def +++ b/mysql-test/suite/rpl/t/disabled.def @@ -11,7 +11,6 @@ ############################################################################## rpl_row_create_table : Bug#51574 Feb 27 2010 andrei failed different way than earlier with bug#45576 -rpl_log_pos : BUG#55675 Sep 10 2010 27 2010 alfranio rpl.rpl_log_pos fails sporadically with error binlog truncated in the middle rpl_get_master_version_and_clock : Bug#59178 Jan 05 2011 joro Valgrind warnings rpl_get_master_version_and_clock rpl_row_until : BUG#59543 Jan 26 2011 alfranio Replication test from eits suite rpl_row_until times out rpl_stm_until : BUG#59543 Jan 26 2011 alfranio Replication test from eits suite rpl_row_until times out diff --git a/sql/sql_repl.cc b/sql/sql_repl.cc index 8c769ce6acf..2a1efab13a9 100644 --- a/sql/sql_repl.cc +++ b/sql/sql_repl.cc @@ -545,8 +545,10 @@ impossible position"; while (!net->error && net->vio != 0 && !thd->killed) { + my_off_t prev_pos= pos; while (!(error = Log_event::read_log_event(&log, packet, log_lock))) { + prev_pos= my_b_tell(&log); #ifndef DBUG_OFF if (max_binlog_dump_events && !left_events--) { @@ -613,8 +615,13 @@ impossible position"; here we were reading binlog that was not closed properly (as a result of a crash ?). treat any corruption as EOF */ - if (binlog_can_be_corrupted && error != LOG_READ_MEM) + if (binlog_can_be_corrupted && + error != LOG_READ_MEM && error != LOG_READ_EOF) + { + my_b_seek(&log, prev_pos); error=LOG_READ_EOF; + } + /* TODO: now that we are logging the offset, check to make sure the recorded offset and the actual match. From 71e8043bae2071ba875b18326504b1058b8deb98 Mon Sep 17 00:00:00 2001 From: Jimmy Yang Date: Fri, 28 Jan 2011 00:50:10 -0800 Subject: [PATCH 052/202] Fix Bug #59465 btr_estimate_number_of_different_key_vals use incorrect offset for external_size rb://581 approved by Marko --- storage/innobase/btr/btr0cur.c | 10 +++++----- storage/innodb_plugin/ChangeLog | 7 +++++++ storage/innodb_plugin/btr/btr0cur.c | 10 +++++----- 3 files changed, 17 insertions(+), 10 deletions(-) diff --git a/storage/innobase/btr/btr0cur.c b/storage/innobase/btr/btr0cur.c index 9f4babfaae6..6c0497cbd41 100644 --- a/storage/innobase/btr/btr0cur.c +++ b/storage/innobase/btr/btr0cur.c @@ -2981,6 +2981,9 @@ btr_estimate_number_of_different_key_vals( while (!page_rec_is_supremum(rec)) { rec_t* next_rec = page_rec_get_next(rec); if (page_rec_is_supremum(next_rec)) { + total_external_size += + btr_rec_get_externally_stored_len( + rec, offsets_rec); break; } @@ -2988,7 +2991,8 @@ btr_estimate_number_of_different_key_vals( matched_bytes = 0; offsets_next_rec = rec_get_offsets(next_rec, index, offsets_next_rec, - n_cols, &heap); + ULINT_UNDEFINED, + &heap); cmp_rec_rec_with_match(rec, next_rec, offsets_rec, offsets_next_rec, @@ -3043,10 +3047,6 @@ btr_estimate_number_of_different_key_vals( } } - offsets_rec = rec_get_offsets(rec, index, offsets_rec, - ULINT_UNDEFINED, &heap); - total_external_size += btr_rec_get_externally_stored_len( - rec, offsets_rec); mtr_commit(&mtr); } diff --git a/storage/innodb_plugin/ChangeLog b/storage/innodb_plugin/ChangeLog index 3e14b0052e7..7a901fc1fa1 100644 --- a/storage/innodb_plugin/ChangeLog +++ b/storage/innodb_plugin/ChangeLog @@ -1,3 +1,9 @@ +2011-01-27 The InnoDB Team + + * btr/btr0cur.c: + Bug#59465 btr_estimate_number_of_different_key_vals use + incorrect offset for external_size + 2011-01-27 The InnoDB Team * include/trx0trx.h, trx/trx0trx.c: @@ -29,6 +35,7 @@ Fix Bug#59707 Unused compression-related parameters in buffer pool functions +>>>>>>> MERGE-SOURCE 2011-01-18 The InnoDB Team * include/sync0rw.h, sync/sync0arr.c, sync/sync0rw.c: diff --git a/storage/innodb_plugin/btr/btr0cur.c b/storage/innodb_plugin/btr/btr0cur.c index f41b125b281..874db3066b5 100644 --- a/storage/innodb_plugin/btr/btr0cur.c +++ b/storage/innodb_plugin/btr/btr0cur.c @@ -3365,6 +3365,9 @@ btr_estimate_number_of_different_key_vals( while (!page_rec_is_supremum(rec)) { rec_t* next_rec = page_rec_get_next(rec); if (page_rec_is_supremum(next_rec)) { + total_external_size += + btr_rec_get_externally_stored_len( + rec, offsets_rec); break; } @@ -3372,7 +3375,8 @@ btr_estimate_number_of_different_key_vals( matched_bytes = 0; offsets_next_rec = rec_get_offsets(next_rec, index, offsets_next_rec, - n_cols, &heap); + ULINT_UNDEFINED, + &heap); cmp_rec_rec_with_match(rec, next_rec, offsets_rec, offsets_next_rec, @@ -3427,10 +3431,6 @@ btr_estimate_number_of_different_key_vals( } } - offsets_rec = rec_get_offsets(rec, index, offsets_rec, - ULINT_UNDEFINED, &heap); - total_external_size += btr_rec_get_externally_stored_len( - rec, offsets_rec); mtr_commit(&mtr); } From 8ce9b992462f0d2ef5e435e4ecda4700fa7db652 Mon Sep 17 00:00:00 2001 From: Alfranio Correia Date: Fri, 28 Jan 2011 12:09:15 +0000 Subject: [PATCH 053/202] BUG#59338 Inconsistency in binlog for statements that don't change any rows STATEMENT SBR In SBR, if a statement does not fail, it is always written to the binary log, regardless if rows are changed or not. If there is a failure, a statement is only written to the binary log if a non-transactional (.e.g. MyIsam) engine is updated. INSERT ON DUPLICATE KEY UPDATE and INSERT IGNORE were not following the rule above and were not written to the binary log, if then engine was Innodb. mysql-test/extra/rpl_tests/rpl_insert_duplicate.test: Added test case. mysql-test/extra/rpl_tests/rpl_insert_ignore.test: Updated test case. mysql-test/include/commit.inc: Updated test case as the calls to the binary log have changed for INSERT ON DUPLICATE and INSERT IGNORE. mysql-test/r/commit_1innodb.result: Updated result file. mysql-test/suite/rpl/r/rpl_insert_duplicate.result: Added test case. mysql-test/suite/rpl/r/rpl_insert_ignore.result: Updated result file. mysql-test/suite/rpl/t/rpl_insert_duplicate.test: Added test case. mysql-test/suite/rpl/t/rpl_insert_ignore.test: Improved test case. --- .../extra/rpl_tests/rpl_insert_duplicate.test | 64 +++++++++++++++++ .../extra/rpl_tests/rpl_insert_ignore.test | 70 +++++++++++-------- mysql-test/include/commit.inc | 8 +-- mysql-test/r/commit_1innodb.result | 8 +-- .../suite/rpl/r/rpl_insert_duplicate.result | 29 ++++++++ .../suite/rpl/r/rpl_insert_ignore.result | 64 +++++++---------- .../suite/rpl/t/rpl_insert_duplicate.test | 14 ++++ mysql-test/suite/rpl/t/rpl_insert_ignore.test | 8 ++- sql/sql_insert.cc | 2 +- 9 files changed, 189 insertions(+), 78 deletions(-) create mode 100644 mysql-test/extra/rpl_tests/rpl_insert_duplicate.test create mode 100644 mysql-test/suite/rpl/r/rpl_insert_duplicate.result create mode 100644 mysql-test/suite/rpl/t/rpl_insert_duplicate.test diff --git a/mysql-test/extra/rpl_tests/rpl_insert_duplicate.test b/mysql-test/extra/rpl_tests/rpl_insert_duplicate.test new file mode 100644 index 00000000000..77140174f4b --- /dev/null +++ b/mysql-test/extra/rpl_tests/rpl_insert_duplicate.test @@ -0,0 +1,64 @@ +# BUG#59338 Inconsistency in binlog for statements that don't change any rows STATEMENT SBR +# In SBR, if a statement does not fail, it is always written to the binary log, +# regardless if rows are changed or not. If there is a failure, a statement is +# only written to the binary log if a non-transactional (.e.g. MyIsam) engine +# is updated. INSERT ON DUPLICATE KEY UPDATE was not following the rule above +# and was not written to the binary log, if then engine was Innodb. +# +# In this test case, we check if INSERT ON DUPLICATE KEY UPDATE that does not +# change anything is still written to the binary log. + +# Prepare environment +--connection master + +eval CREATE TABLE t1 ( + a INT UNSIGNED NOT NULL PRIMARY KEY +) ENGINE=$engine_type; + +eval CREATE TABLE t2 ( + a INT UNSIGNED +) ENGINE=$engine_type; + +INSERT INTO t1 VALUES (1); +INSERT INTO t2 VALUES (1); + +# An insert duplicate that does not update anything must be written to the binary +# log in SBR and MIXED modes. We check this property by summing a before and after +# the update and comparing the binlog positions. The sum should be the same at both +# points and the statement should be in the binary log. +--let $binlog_file= query_get_value("SHOW MASTER STATUS", File, 1) +--let $binlog_start= query_get_value("SHOW MASTER STATUS", Position, 1) +--let $statement_file=INSERT INTO t1 SELECT t2.a FROM t2 ORDER BY t2.a ON DUPLICATE KEY UPDATE t1.a= t1.a +--eval $statement_file + +--let $assert_cond= SUM(a) = 1 FROM t1 +--let $assert_text= Sum of elements in t1 should be 1. +--source include/assert.inc + +if (`SELECT @@BINLOG_FORMAT = 'ROW'`) +{ + --let $binlog_position_cmp= = + --let $assert_cond= [SHOW MASTER STATUS, Position, 1] $binlog_position_cmp $binlog_start + --let $assert_text= In SBR or MIXED modes, the event in the binlog should be the same that was executed. In RBR mode, binlog position should stay unchanged. +} +if (`SELECT @@BINLOG_FORMAT != 'ROW' && UPPER('$engine_type') = UPPER('Innodb')`) +{ + --let $assert_cond= \'[\'SHOW BINLOG EVENTS IN "$binlog_file" FROM $binlog_start LIMIT 1, 1\', Info, 1]\' LIKE \'%$statement_file\' + --let $assert_text= In SBR or MIXED modes, the event in the binlog should be the same that was executed. In RBR mode, binlog position should stay unchanged. +} +if (`SELECT @@BINLOG_FORMAT != 'ROW' && UPPER('$engine_type') = UPPER('MyIsam')`) +{ + --let $assert_cond= \'[\'SHOW BINLOG EVENTS IN "$binlog_file" FROM $binlog_start LIMIT 0, 1\', Info, 1]\' LIKE \'%$statement_file\' + --let $assert_text= In SBR or MIXED modes, the event in the binlog should be the same that was executed. In RBR mode, binlog position should stay unchanged. +} +--source include/assert.inc + +# Compare master and slave +--sync_slave_with_master +--let $diff_tables= master:test.t1 , slave:test.t1 +--source include/diff_tables.inc + +# Clean up +--connection master +drop table t1, t2; +--sync_slave_with_master diff --git a/mysql-test/extra/rpl_tests/rpl_insert_ignore.test b/mysql-test/extra/rpl_tests/rpl_insert_ignore.test index 43d45ef6c60..1eb66358423 100644 --- a/mysql-test/extra/rpl_tests/rpl_insert_ignore.test +++ b/mysql-test/extra/rpl_tests/rpl_insert_ignore.test @@ -5,6 +5,7 @@ # Slave needs to be started with --innodb to store table in InnoDB. # Same test for MyISAM (which had no bug). +--connection master eval CREATE TABLE t1 ( a int unsigned not null auto_increment primary key, b int unsigned, @@ -32,38 +33,49 @@ INSERT INTO t2 VALUES (5, 4); INSERT INTO t2 VALUES (6, 6); INSERT IGNORE INTO t1 SELECT NULL, t2.b FROM t2 ORDER BY t2.a; +--let $assert_cond= COUNT(*) = 6 FROM t1 +--let $assert_text= Count of elements in t1 should be 6. +--source include/assert.inc -# Compare results +# Compare master and slave +--sync_slave_with_master +--let $diff_tables= master:test.t1 , slave:test.t1 +--source include/diff_tables.inc -SELECT * FROM t1 ORDER BY a; +# BUG#59338 Inconsistency in binlog for statements that don't change any rows STATEMENT SBR +# An insert ignore that does not update anything must be written to the binary log in SBR +# and MIXED modes. We check this property by counting occurrences in t1 before and after +# the insert and comparing the binlog positions. The count should be the same in both points +# and the statement should be in the binary log. +--connection master +--let $binlog_file= query_get_value("SHOW MASTER STATUS", File, 1) +--let $binlog_start= query_get_value("SHOW MASTER STATUS", Position, 1) +--let $statement_file=INSERT IGNORE INTO t1 SELECT NULL, t2.b FROM t2 ORDER BY t2.a +--eval $statement_file -sync_slave_with_master; -SELECT * FROM t1 ORDER BY a; +--let $assert_cond= COUNT(*) = 6 FROM t1 +--let $assert_text= Count of elements in t1 should be 6. +--source include/assert.inc -# Now do the same for MyISAM +if (`SELECT @@BINLOG_FORMAT = 'ROW'`) +{ + --let $binlog_position_cmp= = + --let $assert_cond= [SHOW MASTER STATUS, Position, 1] $binlog_position_cmp $binlog_start + --let $assert_text= In SBR or MIXED modes, the event in the binlog should be the same that was executed. In RBR mode, binlog position should stay unchanged. +} +if (`SELECT @@BINLOG_FORMAT != 'ROW' && UPPER('$engine_type') = UPPER('Innodb')`) +{ + --let $assert_cond= \'[\'SHOW BINLOG EVENTS IN "$binlog_file" FROM $binlog_start LIMIT 2, 1\', Info, 1]\' LIKE \'%$statement_file\' + --let $assert_text= In SBR or MIXED modes, the event in the binlog should be the same that was executed. In RBR mode, binlog position should stay unchanged. +} +if (`SELECT @@BINLOG_FORMAT != 'ROW' && UPPER('$engine_type') = UPPER('MyIsam')`) +{ + --let $assert_cond= \'[\'SHOW BINLOG EVENTS IN "$binlog_file" FROM $binlog_start LIMIT 1, 1\', Info, 1]\' LIKE \'%$statement_file\' + --let $assert_text= In SBR or MIXED modes, the event in the binlog should be the same that was executed. In RBR mode, binlog position should stay unchanged. +} +--source include/assert.inc -connection master; -drop table t1; -eval CREATE TABLE t1 ( - a int unsigned not null auto_increment primary key, - b int unsigned, - unique (b) -) ENGINE=$engine_type2; - -INSERT INTO t1 VALUES (1, 1); -INSERT INTO t1 VALUES (2, 2); -INSERT INTO t1 VALUES (3, 3); -INSERT INTO t1 VALUES (4, 4); - -INSERT IGNORE INTO t1 SELECT NULL, t2.b FROM t2 ORDER BY t2.a; - -SELECT * FROM t1 ORDER BY a; - -sync_slave_with_master; -SELECT * FROM t1 ORDER BY a; - -connection master; +# Clean up +--connection master drop table t1, t2; -sync_slave_with_master; - -# End of 4.1 tests +--sync_slave_with_master diff --git a/mysql-test/include/commit.inc b/mysql-test/include/commit.inc index d412eae8364..7924f9bc96f 100644 --- a/mysql-test/include/commit.inc +++ b/mysql-test/include/commit.inc @@ -502,16 +502,16 @@ call p_verify_status_increment(2, 2, 2, 2); --echo # 12. Read-write statement: IODKU, change 0 rows. --echo # insert t1 set a=2 on duplicate key update a=2; -call p_verify_status_increment(1, 0, 1, 0); +call p_verify_status_increment(2, 2, 1, 0); commit; -call p_verify_status_increment(1, 0, 1, 0); +call p_verify_status_increment(2, 2, 1, 0); --echo # 13. Read-write statement: INSERT IGNORE, change 0 rows. --echo # insert ignore t1 set a=2; -call p_verify_status_increment(1, 0, 1, 0); +call p_verify_status_increment(2, 2, 1, 0); commit; -call p_verify_status_increment(1, 0, 1, 0); +call p_verify_status_increment(2, 2, 1, 0); --echo # 14. Read-write statement: INSERT IGNORE, change 1 row. --echo # diff --git a/mysql-test/r/commit_1innodb.result b/mysql-test/r/commit_1innodb.result index 1f0b2c8019b..d21af5ef555 100644 --- a/mysql-test/r/commit_1innodb.result +++ b/mysql-test/r/commit_1innodb.result @@ -518,21 +518,21 @@ SUCCESS # 12. Read-write statement: IODKU, change 0 rows. # insert t1 set a=2 on duplicate key update a=2; -call p_verify_status_increment(1, 0, 1, 0); +call p_verify_status_increment(2, 2, 1, 0); SUCCESS commit; -call p_verify_status_increment(1, 0, 1, 0); +call p_verify_status_increment(2, 2, 1, 0); SUCCESS # 13. Read-write statement: INSERT IGNORE, change 0 rows. # insert ignore t1 set a=2; -call p_verify_status_increment(1, 0, 1, 0); +call p_verify_status_increment(2, 2, 1, 0); SUCCESS commit; -call p_verify_status_increment(1, 0, 1, 0); +call p_verify_status_increment(2, 2, 1, 0); SUCCESS # 14. Read-write statement: INSERT IGNORE, change 1 row. diff --git a/mysql-test/suite/rpl/r/rpl_insert_duplicate.result b/mysql-test/suite/rpl/r/rpl_insert_duplicate.result new file mode 100644 index 00000000000..61ebbaaa5a9 --- /dev/null +++ b/mysql-test/suite/rpl/r/rpl_insert_duplicate.result @@ -0,0 +1,29 @@ +include/master-slave.inc +[connection master] +CREATE TABLE t1 ( +a INT UNSIGNED NOT NULL PRIMARY KEY +) ENGINE=innodb; +CREATE TABLE t2 ( +a INT UNSIGNED +) ENGINE=innodb; +INSERT INTO t1 VALUES (1); +INSERT INTO t2 VALUES (1); +INSERT INTO t1 SELECT t2.a FROM t2 ORDER BY t2.a ON DUPLICATE KEY UPDATE t1.a= t1.a; +include/assert.inc [Sum of elements in t1 should be 1.] +include/assert.inc [In SBR or MIXED modes, the event in the binlog should be the same that was executed. In RBR mode, binlog position should stay unchanged.] +include/diff_tables.inc [master:test.t1 , slave:test.t1] +drop table t1, t2; +CREATE TABLE t1 ( +a INT UNSIGNED NOT NULL PRIMARY KEY +) ENGINE=myisam; +CREATE TABLE t2 ( +a INT UNSIGNED +) ENGINE=myisam; +INSERT INTO t1 VALUES (1); +INSERT INTO t2 VALUES (1); +INSERT INTO t1 SELECT t2.a FROM t2 ORDER BY t2.a ON DUPLICATE KEY UPDATE t1.a= t1.a; +include/assert.inc [Sum of elements in t1 should be 1.] +include/assert.inc [In SBR or MIXED modes, the event in the binlog should be the same that was executed. In RBR mode, binlog position should stay unchanged.] +include/diff_tables.inc [master:test.t1 , slave:test.t1] +drop table t1, t2; +include/rpl_end.inc diff --git a/mysql-test/suite/rpl/r/rpl_insert_ignore.result b/mysql-test/suite/rpl/r/rpl_insert_ignore.result index 6937c3d0987..5d9c4aec9f7 100644 --- a/mysql-test/suite/rpl/r/rpl_insert_ignore.result +++ b/mysql-test/suite/rpl/r/rpl_insert_ignore.result @@ -20,48 +20,36 @@ INSERT INTO t2 VALUES (4, 3); INSERT INTO t2 VALUES (5, 4); INSERT INTO t2 VALUES (6, 6); INSERT IGNORE INTO t1 SELECT NULL, t2.b FROM t2 ORDER BY t2.a; -SELECT * FROM t1 ORDER BY a; -a b -1 1 -2 2 -3 3 -4 4 -5 5 -6 6 -SELECT * FROM t1 ORDER BY a; -a b -1 1 -2 2 -3 3 -4 4 -5 5 -6 6 -drop table t1; +include/assert.inc [Count of elements in t1 should be 6.] +include/diff_tables.inc [master:test.t1 , slave:test.t1] +INSERT IGNORE INTO t1 SELECT NULL, t2.b FROM t2 ORDER BY t2.a; +include/assert.inc [Count of elements in t1 should be 6.] +include/assert.inc [In SBR or MIXED modes, the event in the binlog should be the same that was executed. In RBR mode, binlog position should stay unchanged.] +drop table t1, t2; CREATE TABLE t1 ( a int unsigned not null auto_increment primary key, b int unsigned, unique (b) -) ENGINE=myisam; -INSERT INTO t1 VALUES (1, 1); -INSERT INTO t1 VALUES (2, 2); -INSERT INTO t1 VALUES (3, 3); -INSERT INTO t1 VALUES (4, 4); +) ENGINE=innodb; +CREATE TABLE t2 ( +a int unsigned, # to force INSERT SELECT to have a certain order +b int unsigned +) ENGINE=innodb; +INSERT INTO t1 VALUES (NULL, 1); +INSERT INTO t1 VALUES (NULL, 2); +INSERT INTO t1 VALUES (NULL, 3); +INSERT INTO t1 VALUES (NULL, 4); +INSERT INTO t2 VALUES (1, 1); +INSERT INTO t2 VALUES (2, 2); +INSERT INTO t2 VALUES (3, 5); +INSERT INTO t2 VALUES (4, 3); +INSERT INTO t2 VALUES (5, 4); +INSERT INTO t2 VALUES (6, 6); INSERT IGNORE INTO t1 SELECT NULL, t2.b FROM t2 ORDER BY t2.a; -SELECT * FROM t1 ORDER BY a; -a b -1 1 -2 2 -3 3 -4 4 -5 5 -6 6 -SELECT * FROM t1 ORDER BY a; -a b -1 1 -2 2 -3 3 -4 4 -5 5 -6 6 +include/assert.inc [Count of elements in t1 should be 6.] +include/diff_tables.inc [master:test.t1 , slave:test.t1] +INSERT IGNORE INTO t1 SELECT NULL, t2.b FROM t2 ORDER BY t2.a; +include/assert.inc [Count of elements in t1 should be 6.] +include/assert.inc [In SBR or MIXED modes, the event in the binlog should be the same that was executed. In RBR mode, binlog position should stay unchanged.] drop table t1, t2; include/rpl_end.inc diff --git a/mysql-test/suite/rpl/t/rpl_insert_duplicate.test b/mysql-test/suite/rpl/t/rpl_insert_duplicate.test new file mode 100644 index 00000000000..7dd38a696ae --- /dev/null +++ b/mysql-test/suite/rpl/t/rpl_insert_duplicate.test @@ -0,0 +1,14 @@ +######################################### +# Wrapper for rpl_insert_duplicate.test # +######################################### +-- source include/master-slave.inc +-- source include/have_innodb.inc +#-- source include/have_binlog_format_mixed_or_statement.inc + +let $engine_type=innodb; +-- source extra/rpl_tests/rpl_insert_duplicate.test + +let $engine_type=myisam; +-- source extra/rpl_tests/rpl_insert_duplicate.test + +--source include/rpl_end.inc diff --git a/mysql-test/suite/rpl/t/rpl_insert_ignore.test b/mysql-test/suite/rpl/t/rpl_insert_ignore.test index 1d6c8e7168e..265a52fb51d 100644 --- a/mysql-test/suite/rpl/t/rpl_insert_ignore.test +++ b/mysql-test/suite/rpl/t/rpl_insert_ignore.test @@ -4,7 +4,11 @@ -- source include/not_ndb_default.inc -- source include/have_innodb.inc -- source include/master-slave.inc -let $engine_type=innodb; -let $engine_type2=myisam; + +-- let $engine_type=innodb -- source extra/rpl_tests/rpl_insert_ignore.test + +-- let $engine_type=innodb +-- source extra/rpl_tests/rpl_insert_ignore.test + --source include/rpl_end.inc diff --git a/sql/sql_insert.cc b/sql/sql_insert.cc index f0735a9e093..e2f93ee4de5 100644 --- a/sql/sql_insert.cc +++ b/sql/sql_insert.cc @@ -881,7 +881,7 @@ bool mysql_insert(THD *thd,TABLE_LIST *table_list, */ query_cache_invalidate3(thd, table_list, 1); } - if ((changed && error <= 0) || + if (error <= 0 || thd->transaction.stmt.modified_non_trans_table || was_insert_delayed) { From d83706bc74a5a53e9f4472e6846a73aa0d1df2d1 Mon Sep 17 00:00:00 2001 From: Mattias Jonsson Date: Fri, 28 Jan 2011 13:37:39 +0100 Subject: [PATCH 054/202] minor fix of copyright header --- sql/item_timefunc.h | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) diff --git a/sql/item_timefunc.h b/sql/item_timefunc.h index 2d0a6217f0c..9c1ac512bcb 100644 --- a/sql/item_timefunc.h +++ b/sql/item_timefunc.h @@ -1,4 +1,4 @@ -/* Copyright (c) 2000, 2011 Oracle and/or its affiliates. All rights reserved. +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by From 26528be7112fadd5f23994f96174d3c45bd741b5 Mon Sep 17 00:00:00 2001 From: "John H. Embretsen" Date: Sat, 29 Jan 2011 12:38:36 +0100 Subject: [PATCH 055/202] Fix for Bug#56817 - mysqlhotcopy tests fail when DBI and DBD-mysql perl modules are not found Third updated patch - this version also includes copyright notice in added Perl script. This patch implements a check for such modules at runtime. If modules are not found or unable to load, the test is skipped with the following message: [ skipped ] Test needs Perl modules DBI and DBD::mysql Checks are done via a helper Perl script which looks for the module in a runtime environment that is as similar to that of the mysqlhotcopy script as possible (thus not intended for Windows environments at this time). The helper script tells mysql-test about the result by writing information to a temporary file that is later read by mysql-test. See comments in added files (have_dbi_dbd-mysql.inc and checkDBI_DBD-mysql.pl) for details. The patch also removes the mysqlhotcopy tests from the list of disabled tests. --- mysql-test/include/have_dbi_dbd-mysql.inc | 78 ++++++++++++++++++ mysql-test/include/mysqlhotcopy.inc | 14 ++++ mysql-test/std_data/checkDBI_DBD-mysql.pl | 97 +++++++++++++++++++++++ mysql-test/t/disabled.def | 2 - 4 files changed, 189 insertions(+), 2 deletions(-) create mode 100644 mysql-test/include/have_dbi_dbd-mysql.inc create mode 100644 mysql-test/std_data/checkDBI_DBD-mysql.pl diff --git a/mysql-test/include/have_dbi_dbd-mysql.inc b/mysql-test/include/have_dbi_dbd-mysql.inc new file mode 100644 index 00000000000..212e36ac353 --- /dev/null +++ b/mysql-test/include/have_dbi_dbd-mysql.inc @@ -0,0 +1,78 @@ +# +# Originally created by John Embretsen, 2011-01-26. +# +# Checks for the existence of Perl modules DBI and DBD::mysql as seen from the +# perl installation used by "external" executable perl scripts, i.e. scripts +# that are executed as standalone scripts interpreted by the perl installation +# specified by the "shebang" line in the top of these scripts. +# +# If either module is not found, the test will be skipped. +# +# For use in tests that call perl scripts that require these modules. +# +# This file is intended to work on Unix. Windows may need different treatment. +# Reasoning: +# - "shebangs" are not relevant on Windows, but need to be handled here. +# - Perl scripts cannot be made executable on Windows, interpreter must be +# specified. +# +# Note that if there are multiple perl installations and not all have the +# required modules, this check may fail even if the perl in path does have +# the modules available. This may happen if the perl specified by the script's +# shebang (e.g. #!/usr/bin/perl) does not have these modules, and script is +# called without specifying the perl interpreter. However, this will be +# a correct result in cases where a test calls a script with a similar shebang. +# +################################################################################ + +--source include/not_windows.inc + +# We jump through some hoops since there is no direct way to check if an +# external command went OK or not from a mysql-test file: +# +# - In theory, we could do as simple as "exec perl -MDBI -MDBD::mysql -e 1", +# however we cannot check the result (exit code) from within a test script. +# Also, this may not yield the same result as other uses of perl due to the +# shebang issue mentioned above. +# - Instead we use a separate helper perl script that checks for the modules. +# - If the modules are found, the perl script leaves a file which sets a +# variable that can be read by this file. +# If the modules are not found, the perl script does not set this variable, +# but leaves an empty file instead. +# +# This is done because there is apparently no direct way to transfer +# information from perl to the test script itself. + +--disable_query_log +--disable_result_log +--disable_warnings + +# We do not use embedded perl in this script because that would not have yielded +# correct results for a situation where an external Perl script is called like +# "scriptname" instead of "perl scriptname" and the shebang in the script points +# to a specific perl that may be different than the perl in PATH. +# +# Instead, we call a separate helper script which checks for the modules in its +# own environment. We call it without "perl" in front. + +--let $perlChecker= $MYSQLTEST_VARDIR/std_data/checkDBI_DBD-mysql.pl +--let $resultFile= $MYSQL_TMP_DIR/dbidbd-mysql.txt + +# Make the script executable and execute it. +--chmod 0755 $perlChecker +--exec $perlChecker + +# Source the resulting temporary file and look for a variable being set. +--source $resultFile + +if (!$dbidbd) { + --skip Test needs Perl modules DBI and DBD::mysql +} + +# Clean up +--remove_file $resultFile + +--enable_query_log +--enable_result_log +--enable_warnings + diff --git a/mysql-test/include/mysqlhotcopy.inc b/mysql-test/include/mysqlhotcopy.inc index 91e0eff1e0f..110b0769ae1 100644 --- a/mysql-test/include/mysqlhotcopy.inc +++ b/mysql-test/include/mysqlhotcopy.inc @@ -4,12 +4,26 @@ --source include/not_windows.inc --source include/not_embedded.inc +--source include/have_dbi_dbd-mysql.inc if (!$MYSQLHOTCOPY) { + # Fail the test if the mysqlhotcopy script is missing. + # If the tool's location changes, mysql-test-run.pl must be updated to + # reflect this (look for "MYSQLHOTCOPY"). die due to missing mysqlhotcopy tool; } +# NOTE (johnemb, 2011-01-26): +# In this test mysqlhotcopy (a perl script) is executed as a standalone +# executable, i.e. not necessarily using the perl interpreter in PATH, +# because that is how the documentation demonstrates it. +# +# We include have_dbi_dbd-mysql.inc above so that the test will +# be skipped if Perl modules required by the mysqlhotcopy tool are not +# found when the script is run this way. + + let $MYSQLD_DATADIR= `SELECT @@datadir`; --disable_warnings DROP DATABASE IF EXISTS hotcopy_test; diff --git a/mysql-test/std_data/checkDBI_DBD-mysql.pl b/mysql-test/std_data/checkDBI_DBD-mysql.pl new file mode 100644 index 00000000000..f001e471081 --- /dev/null +++ b/mysql-test/std_data/checkDBI_DBD-mysql.pl @@ -0,0 +1,97 @@ +#!/usr/bin/perl + +# Copyright (c) 2011, Oracle and/or its affiliates. All rights reserved. +# +# This program is free software; you can redistribute it and/or +# modify it under the terms of the GNU Library General Public +# License as published by the Free Software Foundation; version 2 +# of the License. +# +# This program is distributed in the hope that it will be useful, +# but WITHOUT ANY WARRANTY; without even the implied warranty of +# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU +# Library General Public License for more details. +# +# You should have received a copy of the GNU General Public License +# along with this program; if not, write to the Free Software +# Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA + + +################################################################################ +# +# This perl script checks for availability of the Perl modules DBI and +# DBD::mysql using the "current" perl interpreter. +# +# Useful for test environment checking before testing executable perl scripts +# in the MySQL Server distribution. +# +# NOTE: The "shebang" on the first line of this script should always point to +# /usr/bin/perl, so that we can use this script to check whether or not we +# support running perl scripts with such a shebang without specifying the +# perl interpreter on the command line. Such a script is mysqlhotcopy. +# +# When run as "checkDBI_DBD-mysql.pl" the shebang line will be evaluated +# and used. When run as "perl checkDBI_DBD-mysql.pl" the shebang line is +# not used. +# +# NOTE: This script will create a temporary file in MTR's tmp dir. +# If modules are found, a mysql-test statement which sets a special +# variable is written to this file. If one of the modules is not found +# (or cannot be loaded), the file will remain empty. +# A test (or include file) which sources that file can then easily do +# an if-check on the special variable to determine success or failure. +# +# Example: +# +# --let $perlChecker= $MYSQLTEST_VARDIR/std_data/checkDBI_DBD-mysql.pl +# --let $resultFile= $MYSQL_TMP_DIR/dbidbd-mysql.txt +# --chmod 0755 $perlChecker +# --exec $perlChecker +# --source $resultFile +# if (!$dbidbd) { +# --skip Test needs Perl modules DBI and DBD::mysql +# } +# +# The calling script is also responsible for cleaning up after use: +# +# --remove_file $resultFile +# +# Windows notes: +# - shebangs may work differently - call this script with "perl " in front. +# +# See mysql-test/include/have_dbi_dbd-mysql.inc for example use of this script. +# This script should be executable for the user running MTR. +# +################################################################################ + +BEGIN { + # By using eval inside BEGIN we can suppress warnings and continue after. + # We need to catch "Can't locate" as well as "Can't load" errors. + eval{ + $FOUND_DBI=0; + $FOUND_DBD_MYSQL=0; + + # Check for DBI module: + $FOUND_DBI=1 if require DBI; + + # Check for DBD::mysql module + $FOUND_DBD_MYSQL=1 if require DBD::mysql; + }; +}; + +# Open a file to be used for transfer of result back to mysql-test. +# The file must be created whether we write to it or not, otherwise mysql-test +# will complain if trying to source it. +# An empty file indicates failure to load modules. +open(FILE, ">", $ENV{'MYSQL_TMP_DIR'}.'/dbidbd-mysql.txt'); + +if ($FOUND_DBI && $FOUND_DBD_MYSQL) { + # write a mysql-test command setting a variable to indicate success + print(FILE 'let $dbidbd= FOUND_DBI_DBD-MYSQL;'."\n"); +} + +# close the file. +close(FILE); + +1; + diff --git a/mysql-test/t/disabled.def b/mysql-test/t/disabled.def index 4510652b03f..c244d08e308 100644 --- a/mysql-test/t/disabled.def +++ b/mysql-test/t/disabled.def @@ -11,7 +11,5 @@ ############################################################################## kill : Bug#37780 2008-12-03 HHunger need some changes to be robust enough for pushbuild. query_cache_28249 : Bug#43861 2009-03-25 main.query_cache_28249 fails sporadically -main.mysqlhotcopy_myisam : Bug#56817 2010-10-21 anitha mysqlhotcopy* fails -main.mysqlhotcopy_archive: Bug#56817 2010-10-21 anitha mysqlhotcopy* fails log_tables-big : Bug#48646 2010-11-15 mattiasj report already exists read_many_rows_innodb : Bug#37635 2010-11-15 mattiasj report already exists From e952ee1158be7611f3443bf9e1919652eb3b4602 Mon Sep 17 00:00:00 2001 From: =?UTF-8?q?Marko=20M=C3=A4kel=C3=A4?= Date: Mon, 31 Jan 2011 09:56:51 +0200 Subject: [PATCH 056/202] Bug#59230 assert 0 row_upd_changes_ord_field_binary() in post-crash trx rollback or purge This patch does not relax the failing debug assertion during purge. That will be revisited once we have managed to repeat the assertion failure. row_upd_changes_ord_field_binary_func(): Renamed from row_upd_changes_ord_field_binary(). Add the parameter que_thr_t* in UNIV_DEBUG builds. When the off-page column cannot be retrieved, assert that the current transaction is a recovered one and that it is the one that is currently being rolled back. row_upd_changes_ord_field_binary(): A wrapper macro for row_upd_changes_ord_field_binary_func() that discards the que_thr_t* parameter unless UNIV_DEBUG is defined. row_purge_upd_exist_or_extern_func(): Renamed from row_purge_upd_exist_or_extern(). Add the parameter que_thr_t* in UNIV_DEBUG builds. row_purge_upd_exist_or_extern(): A wrapper macro for row_purge_upd_exist_or_extern_func() that discards the que_thr_t* parameter unless UNIV_DEBUG is defined. Make trx_roll_crash_recv_trx const. If there were a 'do not dereference' attribute, it would be appropriate as well. rb://588 approved by Jimmy Yang --- storage/innodb_plugin/ChangeLog | 7 +++++ storage/innodb_plugin/btr/btr0cur.c | 4 +-- storage/innodb_plugin/include/row0upd.h | 26 +++++++++++----- storage/innodb_plugin/row/row0purge.c | 21 ++++++++++--- storage/innodb_plugin/row/row0umod.c | 5 +-- storage/innodb_plugin/row/row0upd.c | 41 ++++++++++++++++--------- storage/innodb_plugin/trx/trx0roll.c | 4 +-- 7 files changed, 74 insertions(+), 34 deletions(-) diff --git a/storage/innodb_plugin/ChangeLog b/storage/innodb_plugin/ChangeLog index 18ab48f32a5..0cbdc8ed9d2 100644 --- a/storage/innodb_plugin/ChangeLog +++ b/storage/innodb_plugin/ChangeLog @@ -1,3 +1,10 @@ +2011-01-31 The InnoDB Team + + * btr/btr0cur.c, include/row0upd.h, + row/row0purge.c, row/row0umod.c, row/row0upd.c: + Bug#59230 assert 0 row_upd_changes_ord_field_binary() + in post-crash rollback or purge + 2011-01-27 The InnoDB Team * btr/btr0cur.c: diff --git a/storage/innodb_plugin/btr/btr0cur.c b/storage/innodb_plugin/btr/btr0cur.c index 874db3066b5..143135ef24c 100644 --- a/storage/innodb_plugin/btr/btr0cur.c +++ b/storage/innodb_plugin/btr/btr0cur.c @@ -1768,8 +1768,8 @@ btr_cur_update_in_place( NOT call it if index is secondary */ if (!dict_index_is_clust(index) - || row_upd_changes_ord_field_binary(NULL, NULL, - index, update)) { + || row_upd_changes_ord_field_binary(index, update, thr, + NULL, NULL)) { /* Remove possible hash index pointer to this record */ btr_search_update_hash_on_delete(cursor); diff --git a/storage/innodb_plugin/include/row0upd.h b/storage/innodb_plugin/include/row0upd.h index b61e6b6dca1..97b7ec49a17 100644 --- a/storage/innodb_plugin/include/row0upd.h +++ b/storage/innodb_plugin/include/row0upd.h @@ -280,19 +280,29 @@ NOTE: we compare the fields as binary strings! @return TRUE if update vector changes an ordering field in the index record */ UNIV_INTERN ibool -row_upd_changes_ord_field_binary( -/*=============================*/ +row_upd_changes_ord_field_binary_func( +/*==================================*/ + dict_index_t* index, /*!< in: index of the record */ + const upd_t* update, /*!< in: update vector for the row; NOTE: the + field numbers in this MUST be clustered index + positions! */ +#ifdef UNIV_DEBUG + const que_thr_t*thr, /*!< in: query thread */ +#endif /* UNIV_DEBUG */ const dtuple_t* row, /*!< in: old value of row, or NULL if the row and the data values in update are not known when this function is called, e.g., at compile time */ - const row_ext_t*ext, /*!< NULL, or prefixes of the externally + const row_ext_t*ext) /*!< NULL, or prefixes of the externally stored columns in the old row */ - dict_index_t* index, /*!< in: index of the record */ - const upd_t* update) /*!< in: update vector for the row; NOTE: the - field numbers in this MUST be clustered index - positions! */ - __attribute__((nonnull(3,4), warn_unused_result)); + __attribute__((nonnull(1,2), warn_unused_result)); +#ifdef UNIV_DEBUG +# define row_upd_changes_ord_field_binary(index,update,thr,row,ext) \ + row_upd_changes_ord_field_binary_func(index,update,thr,row,ext) +#else /* UNIV_DEBUG */ +# define row_upd_changes_ord_field_binary(index,update,thr,row,ext) \ + row_upd_changes_ord_field_binary_func(index,update,row,ext) +#endif /* UNIV_DEBUG */ /***********************************************************//** Checks if an update vector changes an ordering field of an index record. This function is fast if the update vector is short or the number of ordering diff --git a/storage/innodb_plugin/row/row0purge.c b/storage/innodb_plugin/row/row0purge.c index 8bf2ae0f458..c91ec2e8a3b 100644 --- a/storage/innodb_plugin/row/row0purge.c +++ b/storage/innodb_plugin/row/row0purge.c @@ -387,8 +387,11 @@ Purges an update of an existing record. Also purges an update of a delete marked record if that record contained an externally stored field. */ static void -row_purge_upd_exist_or_extern( -/*==========================*/ +row_purge_upd_exist_or_extern_func( +/*===============================*/ +#ifdef UNIV_DEBUG + const que_thr_t*thr, /*!< in: query thread */ +#endif /* UNIV_DEBUG */ purge_node_t* node) /*!< in: row purge node */ { mem_heap_t* heap; @@ -413,8 +416,8 @@ row_purge_upd_exist_or_extern( while (node->index != NULL) { index = node->index; - if (row_upd_changes_ord_field_binary(NULL, NULL, node->index, - node->update)) { + if (row_upd_changes_ord_field_binary(node->index, node->update, + thr, NULL, NULL)) { /* Build the older version of the index entry */ entry = row_build_index_entry(node->row, NULL, index, heap); @@ -496,6 +499,14 @@ skip_secondaries: } } +#ifdef UNIV_DEBUG +# define row_purge_upd_exist_or_extern(thr,node) \ + row_purge_upd_exist_or_extern_func(thr,node) +#else /* UNIV_DEBUG */ +# define row_purge_upd_exist_or_extern(thr,node) \ + row_purge_upd_exist_or_extern_func(node) +#endif /* UNIV_DEBUG */ + /***********************************************************//** Parses the row reference and other info in a modify undo log record. @return TRUE if purge operation required: NOTE that then the CALLER @@ -654,7 +665,7 @@ row_purge( } else if (updated_extern || node->rec_type == TRX_UNDO_UPD_EXIST_REC) { - row_purge_upd_exist_or_extern(node); + row_purge_upd_exist_or_extern(thr, node); } if (node->found_clust) { diff --git a/storage/innodb_plugin/row/row0umod.c b/storage/innodb_plugin/row/row0umod.c index 562f8093c38..f7736935489 100644 --- a/storage/innodb_plugin/row/row0umod.c +++ b/storage/innodb_plugin/row/row0umod.c @@ -668,8 +668,9 @@ row_undo_mod_upd_exist_sec( while (node->index != NULL) { index = node->index; - if (row_upd_changes_ord_field_binary( - node->row, node->ext, node->index, node->update)) { + if (row_upd_changes_ord_field_binary(node->index, node->update, + thr, + node->row, node->ext)) { /* Build the newest version of the index entry */ entry = row_build_index_entry(node->row, node->ext, diff --git a/storage/innodb_plugin/row/row0upd.c b/storage/innodb_plugin/row/row0upd.c index 691d263e6ed..b5d4aeb434e 100644 --- a/storage/innodb_plugin/row/row0upd.c +++ b/storage/innodb_plugin/row/row0upd.c @@ -1192,25 +1192,31 @@ NOTE: we compare the fields as binary strings! @return TRUE if update vector changes an ordering field in the index record */ UNIV_INTERN ibool -row_upd_changes_ord_field_binary( -/*=============================*/ +row_upd_changes_ord_field_binary_func( +/*==================================*/ + dict_index_t* index, /*!< in: index of the record */ + const upd_t* update, /*!< in: update vector for the row; NOTE: the + field numbers in this MUST be clustered index + positions! */ +#ifdef UNIV_DEBUG + const que_thr_t*thr, /*!< in: query thread */ +#endif /* UNIV_DEBUG */ const dtuple_t* row, /*!< in: old value of row, or NULL if the row and the data values in update are not known when this function is called, e.g., at compile time */ - const row_ext_t*ext, /*!< NULL, or prefixes of the externally + const row_ext_t*ext) /*!< NULL, or prefixes of the externally stored columns in the old row */ - dict_index_t* index, /*!< in: index of the record */ - const upd_t* update) /*!< in: update vector for the row; NOTE: the - field numbers in this MUST be clustered index - positions! */ { ulint n_unique; ulint i; const dict_index_t* clust_index; - ut_ad(update); ut_ad(index); + ut_ad(update); + ut_ad(thr); + ut_ad(thr->graph); + ut_ad(thr->graph->trx); n_unique = dict_index_get_n_unique(index); @@ -1263,9 +1269,14 @@ row_upd_changes_ord_field_binary( if (UNIV_LIKELY_NULL(buf)) { if (UNIV_UNLIKELY(buf == field_ref_zero)) { - /* This should never happen, but - we try to fail safe here. */ - ut_ad(0); + /* The externally stored field + was not written yet. This + record should only be seen by + recv_recovery_rollback_active(), + when the server had crashed before + storing the field. */ + ut_ad(thr->graph->trx->is_recovered); + ut_ad(trx_is_recv(thr->graph->trx)); return(TRUE); } @@ -1612,8 +1623,8 @@ row_upd_sec_step( ut_ad(!dict_index_is_clust(node->index)); if (node->state == UPD_NODE_UPDATE_ALL_SEC - || row_upd_changes_ord_field_binary(node->row, node->ext, - node->index, node->update)) { + || row_upd_changes_ord_field_binary(node->index, node->update, + thr, node->row, node->ext)) { return(row_upd_sec_index_entry(node, thr)); } @@ -2140,8 +2151,8 @@ exit_func: row_upd_store_row(node); - if (row_upd_changes_ord_field_binary(node->row, node->ext, index, - node->update)) { + if (row_upd_changes_ord_field_binary(index, node->update, thr, + node->row, node->ext)) { /* Update causes an ordering field (ordering fields within the B-tree) of the clustered index record to change: perform diff --git a/storage/innodb_plugin/trx/trx0roll.c b/storage/innodb_plugin/trx/trx0roll.c index 1a43e419214..a4bbf7fd652 100644 --- a/storage/innodb_plugin/trx/trx0roll.c +++ b/storage/innodb_plugin/trx/trx0roll.c @@ -48,8 +48,8 @@ Created 3/26/1996 Heikki Tuuri rollback */ #define TRX_ROLL_TRUNC_THRESHOLD 1 -/** In crash recovery, the current trx to be rolled back */ -static trx_t* trx_roll_crash_recv_trx = NULL; +/** In crash recovery, the current trx to be rolled back; NULL otherwise */ +static const trx_t* trx_roll_crash_recv_trx = NULL; /** In crash recovery we set this to the undo n:o of the current trx to be rolled back. Then we can print how many % the rollback has progressed. */ From 2d2f80e07e858f157a0823c5e886c3589cd1a435 Mon Sep 17 00:00:00 2001 From: Alfranio Correia Date: Mon, 31 Jan 2011 14:31:33 +0000 Subject: [PATCH 057/202] Post-fix for BUG#59338. --- mysql-test/suite/rpl/r/rpl_insert_ignore.result | 4 ++-- mysql-test/suite/rpl/t/rpl_insert_ignore.test | 2 +- 2 files changed, 3 insertions(+), 3 deletions(-) diff --git a/mysql-test/suite/rpl/r/rpl_insert_ignore.result b/mysql-test/suite/rpl/r/rpl_insert_ignore.result index 5d9c4aec9f7..63b9244a40d 100644 --- a/mysql-test/suite/rpl/r/rpl_insert_ignore.result +++ b/mysql-test/suite/rpl/r/rpl_insert_ignore.result @@ -30,11 +30,11 @@ CREATE TABLE t1 ( a int unsigned not null auto_increment primary key, b int unsigned, unique (b) -) ENGINE=innodb; +) ENGINE=myisam; CREATE TABLE t2 ( a int unsigned, # to force INSERT SELECT to have a certain order b int unsigned -) ENGINE=innodb; +) ENGINE=myisam; INSERT INTO t1 VALUES (NULL, 1); INSERT INTO t1 VALUES (NULL, 2); INSERT INTO t1 VALUES (NULL, 3); diff --git a/mysql-test/suite/rpl/t/rpl_insert_ignore.test b/mysql-test/suite/rpl/t/rpl_insert_ignore.test index 265a52fb51d..4129d4d553e 100644 --- a/mysql-test/suite/rpl/t/rpl_insert_ignore.test +++ b/mysql-test/suite/rpl/t/rpl_insert_ignore.test @@ -8,7 +8,7 @@ -- let $engine_type=innodb -- source extra/rpl_tests/rpl_insert_ignore.test --- let $engine_type=innodb +-- let $engine_type=myisam -- source extra/rpl_tests/rpl_insert_ignore.test --source include/rpl_end.inc From 59269b1da1552ae21e935c04588844c573e9c0c3 Mon Sep 17 00:00:00 2001 From: Ole John Aske Date: Tue, 1 Feb 2011 13:20:16 +0100 Subject: [PATCH 058/202] Fix for bug#57030: ('BETWEEN' evaluation is incorrect') Root cause for this bug is that the optimizer try to detect& optimize the special case: ' BETWEEN c1 AND c1' and handle this as the condition ' = c1' This was implemented inside add_key_field(.. *field, *value[]...) which assumed field to refer key Field, and value[] to refer a [low...high] constant pair. value[0] and value[1] was then compared for equality. In a 'normal' BETWEEN condition of the form ' BETWEEN val1 and val2' the BETWEEN operation is represented with an argementlist containing the values [, val1, val2] - add_key_field() is then called with parameters field=, *value=val1. However, if the BETWEEN predicate specified: 1) ' BETWEEN AND the 'field' and 'value' arguments to add_key_field() had to be swapped. This was implemented by trying to cheat add_key_field() to handle it like: 2) ' GE AND LE' As we didn't really replace the BETWEEN operation with 'ge' and 'le', add_key_field() still handled it as a 'BETWEEN' and compared the (swapped) arguments and for equality. If they was equal, the condition 1) was incorrectly 'optimized' to: 3) ' EQ ' This fix moves this optimization of ' BETWEEN c1 AND c1' into add_key_fields() which then calls add_key_equal_fields() to collect key equality / comparison for the key fields in the BETWEEN condition. --- mysql-test/r/range.result | 101 ++++++++++++++++++++++++++++++++++++++ mysql-test/t/range.test | 67 +++++++++++++++++++++++++ sql/sql_select.cc | 98 ++++++++++++++++++++++-------------- 3 files changed, 228 insertions(+), 38 deletions(-) diff --git a/mysql-test/r/range.result b/mysql-test/r/range.result index d989896514c..ae63edf87b9 100644 --- a/mysql-test/r/range.result +++ b/mysql-test/r/range.result @@ -1666,4 +1666,105 @@ c_key c_notkey 1 1 3 3 DROP TABLE t1; +# +# Bug #57030: 'BETWEEN' evaluation is incorrect +# +CREATE TABLE t1(pk INT PRIMARY KEY, i4 INT); +CREATE UNIQUE INDEX i4_uq ON t1(i4); +INSERT INTO t1 VALUES (1,10), (2,20), (3,30); +EXPLAIN +SELECT * FROM t1 WHERE i4 BETWEEN 10 AND 10; +id select_type table type possible_keys key key_len ref rows Extra +1 SIMPLE t1 const i4_uq i4_uq 5 const 1 +SELECT * FROM t1 WHERE i4 BETWEEN 10 AND 10; +pk i4 +1 10 +EXPLAIN +SELECT * FROM t1 WHERE 10 BETWEEN i4 AND i4; +id select_type table type possible_keys key key_len ref rows Extra +1 SIMPLE t1 const i4_uq i4_uq 5 const 1 +SELECT * FROM t1 WHERE 10 BETWEEN i4 AND i4; +pk i4 +1 10 +EXPLAIN +SELECT * FROM t1 WHERE 10 BETWEEN 10 AND i4; +id select_type table type possible_keys key key_len ref rows Extra +1 SIMPLE t1 range i4_uq i4_uq 5 NULL 3 Using where +SELECT * FROM t1 WHERE 10 BETWEEN 10 AND i4; +pk i4 +1 10 +2 20 +3 30 +EXPLAIN +SELECT * FROM t1 WHERE 10 BETWEEN i4 AND 10; +id select_type table type possible_keys key key_len ref rows Extra +1 SIMPLE t1 range i4_uq i4_uq 5 NULL 1 Using where +SELECT * FROM t1 WHERE 10 BETWEEN i4 AND 10; +pk i4 +1 10 +EXPLAIN +SELECT * FROM t1 WHERE 10 BETWEEN 10 AND 10; +id select_type table type possible_keys key key_len ref rows Extra +1 SIMPLE t1 ALL NULL NULL NULL NULL 3 +SELECT * FROM t1 WHERE 10 BETWEEN 10 AND 10; +pk i4 +1 10 +2 20 +3 30 +EXPLAIN +SELECT * FROM t1 WHERE 10 BETWEEN 11 AND 11; +id select_type table type possible_keys key key_len ref rows Extra +1 SIMPLE NULL NULL NULL NULL NULL NULL NULL Impossible WHERE +SELECT * FROM t1 WHERE 10 BETWEEN 11 AND 11; +pk i4 +EXPLAIN +SELECT * FROM t1 WHERE 10 BETWEEN 100 AND 0; +id select_type table type possible_keys key key_len ref rows Extra +1 SIMPLE NULL NULL NULL NULL NULL NULL NULL Impossible WHERE +SELECT * FROM t1 WHERE 10 BETWEEN 100 AND 0; +pk i4 +EXPLAIN +SELECT * FROM t1 WHERE i4 BETWEEN 100 AND 0; +id select_type table type possible_keys key key_len ref rows Extra +1 SIMPLE NULL NULL NULL NULL NULL NULL NULL Impossible WHERE noticed after reading const tables +SELECT * FROM t1 WHERE i4 BETWEEN 100 AND 0; +pk i4 +EXPLAIN +SELECT * FROM t1 WHERE i4 BETWEEN 10 AND 99999999999999999; +id select_type table type possible_keys key key_len ref rows Extra +1 SIMPLE t1 range i4_uq i4_uq 5 NULL 2 Using where +SELECT * FROM t1 WHERE i4 BETWEEN 10 AND 99999999999999999; +pk i4 +1 10 +2 20 +3 30 +EXPLAIN +SELECT * FROM t1 WHERE i4 BETWEEN 999999999999999 AND 30; +id select_type table type possible_keys key key_len ref rows Extra +1 SIMPLE NULL NULL NULL NULL NULL NULL NULL Impossible WHERE noticed after reading const tables +SELECT * FROM t1 WHERE i4 BETWEEN 999999999999999 AND 30; +pk i4 +EXPLAIN +SELECT * FROM t1 WHERE i4 BETWEEN 10 AND '20'; +id select_type table type possible_keys key key_len ref rows Extra +1 SIMPLE t1 range i4_uq i4_uq 5 NULL 1 Using where +SELECT * FROM t1 WHERE i4 BETWEEN 10 AND '20'; +pk i4 +1 10 +2 20 +EXPLAIN +SELECT * FROM t1, t1 as t2 WHERE t2.pk BETWEEN t1.i4 AND t1.i4; +id select_type table type possible_keys key key_len ref rows Extra +1 SIMPLE t1 ALL i4_uq NULL NULL NULL 3 +1 SIMPLE t2 eq_ref PRIMARY PRIMARY 4 test.t1.i4 1 Using where +SELECT * FROM t1, t1 as t2 WHERE t2.pk BETWEEN t1.i4 AND t1.i4; +pk i4 pk i4 +EXPLAIN +SELECT * FROM t1, t1 as t2 WHERE t1.i4 BETWEEN t2.pk AND t2.pk; +id select_type table type possible_keys key key_len ref rows Extra +1 SIMPLE t1 ALL i4_uq NULL NULL NULL 3 +1 SIMPLE t2 eq_ref PRIMARY PRIMARY 4 test.t1.i4 1 Using where +SELECT * FROM t1, t1 as t2 WHERE t1.i4 BETWEEN t2.pk AND t2.pk; +pk i4 pk i4 +DROP TABLE t1; End of 5.1 tests diff --git a/mysql-test/t/range.test b/mysql-test/t/range.test index 0ad3d3e8504..6c9320b708a 100644 --- a/mysql-test/t/range.test +++ b/mysql-test/t/range.test @@ -1325,4 +1325,71 @@ SELECT * FROM t1 WHERE 2 NOT BETWEEN c_notkey AND c_key; DROP TABLE t1; +--echo # +--echo # Bug #57030: 'BETWEEN' evaluation is incorrect +--echo # + +# Test some BETWEEN predicates which does *not* follow the +# 'normal' pattern of BETWEEN AND + +CREATE TABLE t1(pk INT PRIMARY KEY, i4 INT); +CREATE UNIQUE INDEX i4_uq ON t1(i4); + +INSERT INTO t1 VALUES (1,10), (2,20), (3,30); + +EXPLAIN +SELECT * FROM t1 WHERE i4 BETWEEN 10 AND 10; +SELECT * FROM t1 WHERE i4 BETWEEN 10 AND 10; + +EXPLAIN +SELECT * FROM t1 WHERE 10 BETWEEN i4 AND i4; +SELECT * FROM t1 WHERE 10 BETWEEN i4 AND i4; + +EXPLAIN +SELECT * FROM t1 WHERE 10 BETWEEN 10 AND i4; +SELECT * FROM t1 WHERE 10 BETWEEN 10 AND i4; + +EXPLAIN +SELECT * FROM t1 WHERE 10 BETWEEN i4 AND 10; +SELECT * FROM t1 WHERE 10 BETWEEN i4 AND 10; + +EXPLAIN +SELECT * FROM t1 WHERE 10 BETWEEN 10 AND 10; +SELECT * FROM t1 WHERE 10 BETWEEN 10 AND 10; + +EXPLAIN +SELECT * FROM t1 WHERE 10 BETWEEN 11 AND 11; +SELECT * FROM t1 WHERE 10 BETWEEN 11 AND 11; + +EXPLAIN +SELECT * FROM t1 WHERE 10 BETWEEN 100 AND 0; +SELECT * FROM t1 WHERE 10 BETWEEN 100 AND 0; + +EXPLAIN +SELECT * FROM t1 WHERE i4 BETWEEN 100 AND 0; +SELECT * FROM t1 WHERE i4 BETWEEN 100 AND 0; + +EXPLAIN +SELECT * FROM t1 WHERE i4 BETWEEN 10 AND 99999999999999999; +SELECT * FROM t1 WHERE i4 BETWEEN 10 AND 99999999999999999; + +EXPLAIN +SELECT * FROM t1 WHERE i4 BETWEEN 999999999999999 AND 30; +SELECT * FROM t1 WHERE i4 BETWEEN 999999999999999 AND 30; + +EXPLAIN +SELECT * FROM t1 WHERE i4 BETWEEN 10 AND '20'; +SELECT * FROM t1 WHERE i4 BETWEEN 10 AND '20'; + +#Should detect the EQ_REF 't2.pk=t1.i4' +EXPLAIN +SELECT * FROM t1, t1 as t2 WHERE t2.pk BETWEEN t1.i4 AND t1.i4; +SELECT * FROM t1, t1 as t2 WHERE t2.pk BETWEEN t1.i4 AND t1.i4; + +EXPLAIN +SELECT * FROM t1, t1 as t2 WHERE t1.i4 BETWEEN t2.pk AND t2.pk; +SELECT * FROM t1, t1 as t2 WHERE t1.i4 BETWEEN t2.pk AND t2.pk; + +DROP TABLE t1; + --echo End of 5.1 tests diff --git a/sql/sql_select.cc b/sql/sql_select.cc index 8cc2ec6a0f8..e080dc9370c 100644 --- a/sql/sql_select.cc +++ b/sql/sql_select.cc @@ -3349,26 +3349,7 @@ add_key_field(KEY_FIELD **key_fields,uint and_level, Item_func *cond, eq_func is NEVER true when num_values > 1 */ if (!eq_func) - { - /* - Additional optimization: if we're processing - "t.key BETWEEN c1 AND c1" then proceed as if we were processing - "t.key = c1". - TODO: This is a very limited fix. A more generic fix is possible. - There are 2 options: - A) Make equality propagation code be able to handle BETWEEN - (including cases like t1.key BETWEEN t2.key AND t3.key) - B) Make range optimizer to infer additional "t.key = c" equalities - and use them in equality propagation process (see details in - OptimizerKBAndTodo) - */ - if ((cond->functype() != Item_func::BETWEEN) || - ((Item_func_between*) cond)->negated || - !value[0]->eq(value[1], field->binary())) - return; - eq_func= TRUE; - } - + return; if (field->result_type() == STRING_RESULT) { if ((*value)->result_type() != STRING_RESULT) @@ -3564,9 +3545,65 @@ add_key_fields(JOIN *join, KEY_FIELD **key_fields, uint *and_level, case Item_func::OPTIMIZE_KEY: { Item **values; - // BETWEEN, IN, NE - if (is_local_field (cond_func->key_item()) && - !(cond_func->used_tables() & OUTER_REF_TABLE_BIT)) + /* + Build list of possible keys for 'a BETWEEN low AND high'. + It is handled similar to the equivalent condition + 'a >= low AND a <= high': + */ + if (cond_func->functype() == Item_func::BETWEEN) + { + Item_field *field_item; + bool equal_func= FALSE; + uint num_values= 2; + values= cond_func->arguments(); + + bool binary_cmp= (values[0]->real_item()->type() == Item::FIELD_ITEM) + ? ((Item_field*)values[0]->real_item())->field->binary() + : TRUE; + + /* + Additional optimization: If 'low = high': + Handle as if the condition was "t.key = low". + */ + if (!((Item_func_between*)cond_func)->negated && + values[1]->eq(values[2], binary_cmp)) + { + equal_func= TRUE; + num_values= 1; + } + + /* + Append keys for 'field value[]' if the + condition is of the form:: + ' BETWEEN value[1] AND value[2]' + */ + if (is_local_field (values[0])) + { + field_item= (Item_field *) (values[0]->real_item()); + add_key_equal_fields(key_fields, *and_level, cond_func, + field_item, equal_func, &values[1], + num_values, usable_tables, sargables); + } + /* + Append keys for 'value[0] field' if the + condition is of the form: + 'value[0] BETWEEN field1 AND field2' + */ + for (uint i= 1; i <= num_values; i++) + { + if (is_local_field (values[i])) + { + field_item= (Item_field *) (values[i]->real_item()); + add_key_equal_fields(key_fields, *and_level, cond_func, + field_item, equal_func, values, + 1, usable_tables, sargables); + } + } + } // if ( ... Item_func::BETWEEN) + + // IN, NE + else if (is_local_field (cond_func->key_item()) && + !(cond_func->used_tables() & OUTER_REF_TABLE_BIT)) { values= cond_func->arguments()+1; if (cond_func->functype() == Item_func::NE_FUNC && @@ -3580,21 +3617,6 @@ add_key_fields(JOIN *join, KEY_FIELD **key_fields, uint *and_level, cond_func->argument_count()-1, usable_tables, sargables); } - if (cond_func->functype() == Item_func::BETWEEN) - { - values= cond_func->arguments(); - for (uint i= 1 ; i < cond_func->argument_count() ; i++) - { - Item_field *field_item; - if (is_local_field (cond_func->arguments()[i])) - { - field_item= (Item_field *) (cond_func->arguments()[i]->real_item()); - add_key_equal_fields(key_fields, *and_level, cond_func, - field_item, 0, values, 1, usable_tables, - sargables); - } - } - } break; } case Item_func::OPTIMIZE_OP: From 1f796c2b646824aeac2927599ba3e51594cd3534 Mon Sep 17 00:00:00 2001 From: =?UTF-8?q?Marko=20M=C3=A4kel=C3=A4?= Date: Wed, 2 Feb 2011 14:05:12 +0200 Subject: [PATCH 059/202] Bug #55284 diagnostics: Enable UNIV_DEBUG_FILE_ACCESSES by UNIV_DEBUG It was the enabling of UNIV_DEBUG_FILE_ACCESSES that caught Bug #55284 in the first place. This is a very light piece of of debug code, and there really is no reason why it is not enabled in all debug builds. rb://551 approved by Jimmy Yang --- storage/innodb_plugin/buf/buf0buf.c | 30 +++++++++++++------------ storage/innodb_plugin/fsp/fsp0fsp.c | 8 +++---- storage/innodb_plugin/ibuf/ibuf0ibuf.c | 8 +++---- storage/innodb_plugin/include/buf0buf.h | 8 +++---- storage/innodb_plugin/include/univ.i | 5 ++--- 5 files changed, 30 insertions(+), 29 deletions(-) diff --git a/storage/innodb_plugin/buf/buf0buf.c b/storage/innodb_plugin/buf/buf0buf.c index 6e76e4c65be..6bbd5565c58 100644 --- a/storage/innodb_plugin/buf/buf0buf.c +++ b/storage/innodb_plugin/buf/buf0buf.c @@ -657,9 +657,9 @@ buf_block_init( block->modify_clock = 0; -#ifdef UNIV_DEBUG_FILE_ACCESSES +#if defined UNIV_DEBUG_FILE_ACCESSES || defined UNIV_DEBUG block->page.file_page_was_freed = FALSE; -#endif /* UNIV_DEBUG_FILE_ACCESSES */ +#endif /* UNIV_DEBUG_FILE_ACCESSES || UNIV_DEBUG */ block->check_index_page_at_flush = FALSE; block->index = NULL; @@ -1600,7 +1600,7 @@ buf_page_peek_if_search_hashed( return(is_hashed); } -#ifdef UNIV_DEBUG_FILE_ACCESSES +#if defined UNIV_DEBUG_FILE_ACCESSES || defined UNIV_DEBUG /********************************************************************//** Sets file_page_was_freed TRUE if the page is found in the buffer pool. This function should be called when we free a file page and want the @@ -1621,6 +1621,8 @@ buf_page_set_file_page_was_freed( bpage = buf_page_hash_get(space, offset); if (bpage) { + /* bpage->file_page_was_freed can already hold + when this code is invoked from dict_drop_index_tree() */ bpage->file_page_was_freed = TRUE; } @@ -1656,7 +1658,7 @@ buf_page_reset_file_page_was_freed( return(bpage); } -#endif /* UNIV_DEBUG_FILE_ACCESSES */ +#endif /* UNIV_DEBUG_FILE_ACCESSES || UNIV_DEBUG */ /********************************************************************//** Get read access to a compressed page (usually of type @@ -1753,7 +1755,7 @@ got_block: buf_page_set_accessed_make_young(bpage, access_time); -#ifdef UNIV_DEBUG_FILE_ACCESSES +#if defined UNIV_DEBUG_FILE_ACCESSES || defined UNIV_DEBUG ut_a(!bpage->file_page_was_freed); #endif @@ -2321,7 +2323,7 @@ wait_until_unfixed: buf_page_set_accessed_make_young(&block->page, access_time); -#ifdef UNIV_DEBUG_FILE_ACCESSES +#if defined UNIV_DEBUG_FILE_ACCESSES || defined UNIV_DEBUG ut_a(!block->page.file_page_was_freed); #endif @@ -2479,7 +2481,7 @@ buf_page_optimistic_get( ut_a(buf_block_get_state(block) == BUF_BLOCK_FILE_PAGE); #endif /* UNIV_DEBUG || UNIV_BUF_DEBUG */ -#ifdef UNIV_DEBUG_FILE_ACCESSES +#if defined UNIV_DEBUG_FILE_ACCESSES || defined UNIV_DEBUG ut_a(block->page.file_page_was_freed == FALSE); #endif if (UNIV_UNLIKELY(!access_time)) { @@ -2587,7 +2589,7 @@ buf_page_get_known_nowait( ut_a(block->page.buf_fix_count > 0); ut_a(buf_block_get_state(block) == BUF_BLOCK_FILE_PAGE); #endif /* UNIV_DEBUG || UNIV_BUF_DEBUG */ -#ifdef UNIV_DEBUG_FILE_ACCESSES +#if defined UNIV_DEBUG_FILE_ACCESSES || defined UNIV_DEBUG ut_a(block->page.file_page_was_freed == FALSE); #endif @@ -2670,9 +2672,9 @@ buf_page_try_get_func( ut_a(block->page.buf_fix_count > 0); ut_a(buf_block_get_state(block) == BUF_BLOCK_FILE_PAGE); #endif /* UNIV_DEBUG || UNIV_BUF_DEBUG */ -#ifdef UNIV_DEBUG_FILE_ACCESSES +#if defined UNIV_DEBUG_FILE_ACCESSES || defined UNIV_DEBUG ut_a(block->page.file_page_was_freed == FALSE); -#endif /* UNIV_DEBUG_FILE_ACCESSES */ +#endif /* UNIV_DEBUG_FILE_ACCESSES || UNIV_DEBUG */ buf_block_dbg_add_level(block, SYNC_NO_ORDER_CHECK); buf_pool->stat.n_page_gets++; @@ -2701,9 +2703,9 @@ buf_page_init_low( bpage->newest_modification = 0; bpage->oldest_modification = 0; HASH_INVALIDATE(bpage, hash); -#ifdef UNIV_DEBUG_FILE_ACCESSES +#if defined UNIV_DEBUG_FILE_ACCESSES || defined UNIV_DEBUG bpage->file_page_was_freed = FALSE; -#endif /* UNIV_DEBUG_FILE_ACCESSES */ +#endif /* UNIV_DEBUG_FILE_ACCESSES || UNIV_DEBUG */ } /********************************************************************//** @@ -3009,9 +3011,9 @@ buf_page_create( #ifdef UNIV_IBUF_COUNT_DEBUG ut_a(ibuf_count_get(space, offset) == 0); #endif -#ifdef UNIV_DEBUG_FILE_ACCESSES +#if defined UNIV_DEBUG_FILE_ACCESSES || defined UNIV_DEBUG block->page.file_page_was_freed = FALSE; -#endif /* UNIV_DEBUG_FILE_ACCESSES */ +#endif /* UNIV_DEBUG_FILE_ACCESSES || UNIV_DEBUG */ /* Page can be found in buf_pool */ buf_pool_mutex_exit(); diff --git a/storage/innodb_plugin/fsp/fsp0fsp.c b/storage/innodb_plugin/fsp/fsp0fsp.c index e9d24b8fdf6..d091a14c474 100644 --- a/storage/innodb_plugin/fsp/fsp0fsp.c +++ b/storage/innodb_plugin/fsp/fsp0fsp.c @@ -3444,9 +3444,9 @@ fseg_free_page( fseg_free_page_low(seg_inode, space, zip_size, page, mtr); -#ifdef UNIV_DEBUG_FILE_ACCESSES +#if defined UNIV_DEBUG_FILE_ACCESSES || defined UNIV_DEBUG buf_page_set_file_page_was_freed(space, page); -#endif +#endif /* UNIV_DEBUG_FILE_ACCESSES || UNIV_DEBUG */ } /**********************************************************************//** @@ -3513,13 +3513,13 @@ fseg_free_extent( fsp_free_extent(space, zip_size, page, mtr); -#ifdef UNIV_DEBUG_FILE_ACCESSES +#if defined UNIV_DEBUG_FILE_ACCESSES || defined UNIV_DEBUG for (i = 0; i < FSP_EXTENT_SIZE; i++) { buf_page_set_file_page_was_freed(space, first_page_in_extent + i); } -#endif +#endif /* UNIV_DEBUG_FILE_ACCESSES || UNIV_DEBUG */ } /**********************************************************************//** diff --git a/storage/innodb_plugin/ibuf/ibuf0ibuf.c b/storage/innodb_plugin/ibuf/ibuf0ibuf.c index 701e8f0ef04..23981ac388e 100644 --- a/storage/innodb_plugin/ibuf/ibuf0ibuf.c +++ b/storage/innodb_plugin/ibuf/ibuf0ibuf.c @@ -1878,9 +1878,9 @@ ibuf_remove_free_page(void) fseg_free_page(header_page + IBUF_HEADER + IBUF_TREE_SEG_HEADER, IBUF_SPACE_ID, page_no, &mtr); -#ifdef UNIV_DEBUG_FILE_ACCESSES +#if defined UNIV_DEBUG_FILE_ACCESSES || defined UNIV_DEBUG buf_page_reset_file_page_was_freed(IBUF_SPACE_ID, page_no); -#endif +#endif /* UNIV_DEBUG_FILE_ACCESSES || UNIV_DEBUG */ ibuf_enter(); @@ -1922,9 +1922,9 @@ ibuf_remove_free_page(void) ibuf_bitmap_page_set_bits( bitmap_page, page_no, zip_size, IBUF_BITMAP_IBUF, FALSE, &mtr); -#ifdef UNIV_DEBUG_FILE_ACCESSES +#if defined UNIV_DEBUG_FILE_ACCESSES || defined UNIV_DEBUG buf_page_set_file_page_was_freed(IBUF_SPACE_ID, page_no); -#endif +#endif /* UNIV_DEBUG_FILE_ACCESSES || UNIV_DEBUG */ mtr_commit(&mtr); mutex_exit(&ibuf_mutex); diff --git a/storage/innodb_plugin/include/buf0buf.h b/storage/innodb_plugin/include/buf0buf.h index d903b443920..a16de67aa3a 100644 --- a/storage/innodb_plugin/include/buf0buf.h +++ b/storage/innodb_plugin/include/buf0buf.h @@ -368,7 +368,7 @@ buf_reset_check_index_page_at_flush( /*================================*/ ulint space, /*!< in: space id */ ulint offset);/*!< in: page number */ -#ifdef UNIV_DEBUG_FILE_ACCESSES +#if defined UNIV_DEBUG_FILE_ACCESSES || defined UNIV_DEBUG /********************************************************************//** Sets file_page_was_freed TRUE if the page is found in the buffer pool. This function should be called when we free a file page and want the @@ -393,7 +393,7 @@ buf_page_reset_file_page_was_freed( /*===============================*/ ulint space, /*!< in: space id */ ulint offset); /*!< in: page number */ -#endif /* UNIV_DEBUG_FILE_ACCESSES */ +#endif /* UNIV_DEBUG_FILE_ACCESSES || UNIV_DEBUG */ /********************************************************************//** Reads the freed_page_clock of a buffer block. @return freed_page_clock */ @@ -1135,11 +1135,11 @@ struct buf_page_struct{ 0 if the block was never accessed in the buffer pool */ /* @} */ -# ifdef UNIV_DEBUG_FILE_ACCESSES +# if defined UNIV_DEBUG_FILE_ACCESSES || defined UNIV_DEBUG ibool file_page_was_freed; /*!< this is set to TRUE when fsp frees a page in buffer pool */ -# endif /* UNIV_DEBUG_FILE_ACCESSES */ +# endif /* UNIV_DEBUG_FILE_ACCESSES || UNIV_DEBUG */ #endif /* !UNIV_HOTBACKUP */ }; diff --git a/storage/innodb_plugin/include/univ.i b/storage/innodb_plugin/include/univ.i index 4425950748b..4ba48b10896 100644 --- a/storage/innodb_plugin/include/univ.i +++ b/storage/innodb_plugin/include/univ.i @@ -182,9 +182,8 @@ command. Not tested on Windows. */ #define UNIV_DEBUG_LOCK_VALIDATE /* Enable ut_ad(lock_rec_validate_page()) assertions. */ -#define UNIV_DEBUG_FILE_ACCESSES /* Debug .ibd file access - (field file_page_was_freed - in buf_page_t) */ +#define UNIV_DEBUG_FILE_ACCESSES /* Enable freed block access + debugging without UNIV_DEBUG */ #define UNIV_LRU_DEBUG /* debug the buffer pool LRU */ #define UNIV_HASH_DEBUG /* debug HASH_ macros */ #define UNIV_LIST_DEBUG /* debug UT_LIST_ macros */ From f2eacde4cd905303ff906d9e33308b8ba03c17f7 Mon Sep 17 00:00:00 2001 From: =?UTF-8?q?Marko=20M=C3=A4kel=C3=A4?= Date: Wed, 2 Feb 2011 14:10:12 +0200 Subject: [PATCH 060/202] Bug #55284 diagnostics: When UNIV_DEBUG, do not tolerate garbage in Antelope files in btr_check_blob_fil_page_type(). Unfortunately, we must keep the check in production builds, because InnoDB wrote uninitialized garbage to FIL_PAGE_TYPE until fairly recently (5.1.x). rb://546 approved by Jimmy Yang --- storage/innodb_plugin/btr/btr0cur.c | 2 ++ 1 file changed, 2 insertions(+) diff --git a/storage/innodb_plugin/btr/btr0cur.c b/storage/innodb_plugin/btr/btr0cur.c index 143135ef24c..46cd4a81ec5 100644 --- a/storage/innodb_plugin/btr/btr0cur.c +++ b/storage/innodb_plugin/btr/btr0cur.c @@ -4169,6 +4169,7 @@ btr_check_blob_fil_page_type( if (UNIV_UNLIKELY(type != FIL_PAGE_TYPE_BLOB)) { ulint flags = fil_space_get_flags(space_id); +#ifndef UNIV_DEBUG /* Improve debug test coverage */ if (UNIV_LIKELY ((flags & DICT_TF_FORMAT_MASK) == DICT_TF_FORMAT_51)) { /* Old versions of InnoDB did not initialize @@ -4177,6 +4178,7 @@ btr_check_blob_fil_page_type( a BLOB page that is in Antelope format.*/ return; } +#endif /* !UNIV_DEBUG */ ut_print_timestamp(stderr); fprintf(stderr, From 7c45708f5d29747da043aea144c2f8ba8c142c08 Mon Sep 17 00:00:00 2001 From: =?UTF-8?q?Marko=20M=C3=A4kel=C3=A4?= Date: Wed, 2 Feb 2011 14:12:49 +0200 Subject: [PATCH 061/202] Non-functional changes (cleanup) made while narrowing down Bug #55284: row_purge(): Change the return type to void. (The return value always was DB_SUCCESS.) Remove some local variables. row_undo_mod_remove_clust_low(): Remove some local variables. rb://547 approved by Jimmy Yang --- storage/innodb_plugin/row/row0purge.c | 47 +++++++-------------------- storage/innodb_plugin/row/row0umod.c | 30 +++++------------ 2 files changed, 19 insertions(+), 58 deletions(-) diff --git a/storage/innodb_plugin/row/row0purge.c b/storage/innodb_plugin/row/row0purge.c index c91ec2e8a3b..752a2ec9e83 100644 --- a/storage/innodb_plugin/row/row0purge.c +++ b/storage/innodb_plugin/row/row0purge.c @@ -613,47 +613,32 @@ err_exit: /***********************************************************//** Fetches an undo log record and does the purge for the recorded operation. If none left, or the current purge completed, returns the control to the -parent node, which is always a query thread node. -@return DB_SUCCESS if operation successfully completed, else error code */ -static -ulint +parent node, which is always a query thread node. */ +static __attribute__((nonnull)) +void row_purge( /*======*/ purge_node_t* node, /*!< in: row purge node */ que_thr_t* thr) /*!< in: query thread */ { - roll_ptr_t roll_ptr; - ibool purge_needed; ibool updated_extern; - trx_t* trx; - ut_ad(node && thr); + ut_ad(node); + ut_ad(thr); - trx = thr_get_trx(thr); - - node->undo_rec = trx_purge_fetch_next_rec(&roll_ptr, - &(node->reservation), + node->undo_rec = trx_purge_fetch_next_rec(&node->roll_ptr, + &node->reservation, node->heap); if (!node->undo_rec) { /* Purge completed for this query thread */ thr->run_node = que_node_get_parent(node); - return(DB_SUCCESS); + return; } - node->roll_ptr = roll_ptr; - - if (node->undo_rec == &trx_purge_dummy_rec) { - purge_needed = FALSE; - } else { - purge_needed = row_purge_parse_undo_rec(node, &updated_extern, - thr); - /* If purge_needed == TRUE, we must also remember to unfreeze - data dictionary! */ - } - - if (purge_needed) { + if (node->undo_rec != &trx_purge_dummy_rec + && row_purge_parse_undo_rec(node, &updated_extern, thr)) { node->found_clust = FALSE; node->index = dict_table_get_next_index( @@ -672,7 +657,7 @@ row_purge( btr_pcur_close(&(node->pcur)); } - row_mysql_unfreeze_data_dictionary(trx); + row_mysql_unfreeze_data_dictionary(thr_get_trx(thr)); } /* Do some cleanup */ @@ -680,8 +665,6 @@ row_purge( mem_heap_empty(node->heap); thr->run_node = node; - - return(DB_SUCCESS); } /***********************************************************//** @@ -695,9 +678,6 @@ row_purge_step( que_thr_t* thr) /*!< in: query thread */ { purge_node_t* node; -#ifdef UNIV_DEBUG - ulint err; -#endif /* UNIV_DEBUG */ ut_ad(thr); @@ -705,12 +685,7 @@ row_purge_step( ut_ad(que_node_get_type(node) == QUE_NODE_PURGE); -#ifdef UNIV_DEBUG - err = -#endif /* UNIV_DEBUG */ row_purge(node, thr); - ut_ad(err == DB_SUCCESS); - return(thr); } diff --git a/storage/innodb_plugin/row/row0umod.c b/storage/innodb_plugin/row/row0umod.c index f7736935489..5202a498eed 100644 --- a/storage/innodb_plugin/row/row0umod.c +++ b/storage/innodb_plugin/row/row0umod.c @@ -173,40 +173,26 @@ row_undo_mod_remove_clust_low( mtr_t* mtr, /*!< in: mtr */ ulint mode) /*!< in: BTR_MODIFY_LEAF or BTR_MODIFY_TREE */ { - btr_pcur_t* pcur; btr_cur_t* btr_cur; ulint err; - ibool success; ut_ad(node->rec_type == TRX_UNDO_UPD_DEL_REC); - pcur = &(node->pcur); - btr_cur = btr_pcur_get_btr_cur(pcur); - success = btr_pcur_restore_position(mode, pcur, mtr); + /* Find out if the record has been purged already + or if we can remove it. */ - if (!success) { + if (!btr_pcur_restore_position(mode, &node->pcur, mtr) + || row_vers_must_preserve_del_marked(node->new_trx_id, mtr)) { return(DB_SUCCESS); } - /* Find out if we can remove the whole clustered index record */ - - if (node->rec_type == TRX_UNDO_UPD_DEL_REC - && !row_vers_must_preserve_del_marked(node->new_trx_id, mtr)) { - - /* Ok, we can remove */ - } else { - return(DB_SUCCESS); - } + btr_cur = btr_pcur_get_btr_cur(&node->pcur); if (mode == BTR_MODIFY_LEAF) { - success = btr_cur_optimistic_delete(btr_cur, mtr); - - if (success) { - err = DB_SUCCESS; - } else { - err = DB_FAIL; - } + err = btr_cur_optimistic_delete(btr_cur, mtr) + ? DB_SUCCESS + : DB_FAIL; } else { ut_ad(mode == BTR_MODIFY_TREE); From e805a0fd9de24cf1a9a6fb7bd10a336dbcd46fe9 Mon Sep 17 00:00:00 2001 From: Dmitry Lenev Date: Wed, 2 Feb 2011 16:17:48 +0300 Subject: [PATCH 062/202] Fix for bug #58650 "Failing assertion: primary_key_no == -1 || primary_key_no == 0". Attempt to create InnoDB table with non-nullable column of geometry type having an unique key with length 12 on it and with some other candidate key led to server crash due to assertion failure in both non-debug and debug builds. The problem was that such a non-candidate key could have been sorted as the first key in table/.FRM, before any legit candidate keys. This resulted in assertion failure in InnoDB engine which assumes that primary key should either be the first key in table/.FRM or should not exist at all. The reason behind such an incorrect sorting was an wrong value of Create_field::key_length member for geometry field (which was set to its pack_length == 12) which confused code in mysql_prepare_create_table(), so it would skip marking such key as a key with partial segments. This patch fixes the problem by ensuring that this member gets the same value of Create_field::key_length member as for other blob fields (from which geometry field class is inherited), and as result unique keys on geometry fields are correctly marked as having partial segments. mysql-test/include/gis_keys.inc: Added test case for bug #58650 "Failing assertion: primary_key_no == -1 || primary_key_no == 0". mysql-test/r/gis.result: Added test case for bug #58650 "Failing assertion: primary_key_no == -1 || primary_key_no == 0". mysql-test/suite/innodb/r/innodb_gis.result: Added test case for bug #58650 "Failing assertion: primary_key_no == -1 || primary_key_no == 0". mysql-test/suite/innodb_plugin/r/innodb_gis.result: Added test case for bug #58650 "Failing assertion: primary_key_no == -1 || primary_key_no == 0". sql/field.cc: Changed Create_field::create_length_to_internal_length() to correctly set Create_field::key_length member for geometry fields. Similar to the blob types key_length for such fields should be the same as length and not field's packed length (which is always 12 for geometry). As result of this change code handling table creation now always correctly identifies btree/unique keys on geometry fields as partial keys, so such keys can't be erroneously treated as candidate keys and sorted in keys array in .FRM before legit candidate keys. This fixes bug #58650 "Failing assertion: primary_key_no == -1 || primary_key_no == 0" in which incorrect candidate key sorting led to assertion failure in InnoDB code. --- mysql-test/include/gis_keys.inc | 16 ++++++++++++++++ mysql-test/r/gis.result | 12 ++++++++++++ mysql-test/suite/innodb/r/innodb_gis.result | 12 ++++++++++++ .../suite/innodb_plugin/r/innodb_gis.result | 12 ++++++++++++ sql/field.cc | 1 + 5 files changed, 53 insertions(+) diff --git a/mysql-test/include/gis_keys.inc b/mysql-test/include/gis_keys.inc index c75311f062a..ad00c7e1ef9 100644 --- a/mysql-test/include/gis_keys.inc +++ b/mysql-test/include/gis_keys.inc @@ -44,3 +44,19 @@ SELECT COUNT(*) FROM t2 IGNORE INDEX(p) WHERE p=POINTFROMTEXT('POINT(1 2)'); DROP TABLE t1, t2; --echo End of 5.0 tests + + +--echo # +--echo # Test for bug #58650 "Failing assertion: primary_key_no == -1 || +--echo # primary_key_no == 0". +--echo # +--disable_warnings +drop table if exists t1; +--enable_warnings +--echo # The minimal test case. +create table t1 (a int not null, b linestring not null, unique key b (b(12)), unique key a (a)); +drop table t1; +--echo # The original test case. +create table t1 (a int not null, b linestring not null, unique key b (b(12))); +create unique index a on t1(a); +drop table t1; diff --git a/mysql-test/r/gis.result b/mysql-test/r/gis.result index f4aa361ffcf..a9beb9631ae 100644 --- a/mysql-test/r/gis.result +++ b/mysql-test/r/gis.result @@ -960,6 +960,18 @@ COUNT(*) 2 DROP TABLE t1, t2; End of 5.0 tests +# +# Test for bug #58650 "Failing assertion: primary_key_no == -1 || +# primary_key_no == 0". +# +drop table if exists t1; +# The minimal test case. +create table t1 (a int not null, b linestring not null, unique key b (b(12)), unique key a (a)); +drop table t1; +# The original test case. +create table t1 (a int not null, b linestring not null, unique key b (b(12))); +create unique index a on t1(a); +drop table t1; create table `t1` (`col002` point)engine=myisam; insert into t1 values (),(),(); select min(`col002`) from t1 union select `col002` from t1; diff --git a/mysql-test/suite/innodb/r/innodb_gis.result b/mysql-test/suite/innodb/r/innodb_gis.result index c6c775afc9f..a52a1387b6e 100644 --- a/mysql-test/suite/innodb/r/innodb_gis.result +++ b/mysql-test/suite/innodb/r/innodb_gis.result @@ -585,5 +585,17 @@ COUNT(*) 2 DROP TABLE t1, t2; End of 5.0 tests +# +# Test for bug #58650 "Failing assertion: primary_key_no == -1 || +# primary_key_no == 0". +# +drop table if exists t1; +# The minimal test case. +create table t1 (a int not null, b linestring not null, unique key b (b(12)), unique key a (a)); +drop table t1; +# The original test case. +create table t1 (a int not null, b linestring not null, unique key b (b(12))); +create unique index a on t1(a); +drop table t1; create table t1 (g geometry not null, spatial gk(g)) engine=innodb; ERROR HY000: The used table type doesn't support SPATIAL indexes diff --git a/mysql-test/suite/innodb_plugin/r/innodb_gis.result b/mysql-test/suite/innodb_plugin/r/innodb_gis.result index c6c775afc9f..a52a1387b6e 100644 --- a/mysql-test/suite/innodb_plugin/r/innodb_gis.result +++ b/mysql-test/suite/innodb_plugin/r/innodb_gis.result @@ -585,5 +585,17 @@ COUNT(*) 2 DROP TABLE t1, t2; End of 5.0 tests +# +# Test for bug #58650 "Failing assertion: primary_key_no == -1 || +# primary_key_no == 0". +# +drop table if exists t1; +# The minimal test case. +create table t1 (a int not null, b linestring not null, unique key b (b(12)), unique key a (a)); +drop table t1; +# The original test case. +create table t1 (a int not null, b linestring not null, unique key b (b(12))); +create unique index a on t1(a); +drop table t1; create table t1 (g geometry not null, spatial gk(g)) engine=innodb; ERROR HY000: The used table type doesn't support SPATIAL indexes diff --git a/sql/field.cc b/sql/field.cc index 11edd8bfc1a..1ad5e408e07 100644 --- a/sql/field.cc +++ b/sql/field.cc @@ -9476,6 +9476,7 @@ void Create_field::create_length_to_internal_length(void) case MYSQL_TYPE_MEDIUM_BLOB: case MYSQL_TYPE_LONG_BLOB: case MYSQL_TYPE_BLOB: + case MYSQL_TYPE_GEOMETRY: case MYSQL_TYPE_VAR_STRING: case MYSQL_TYPE_STRING: case MYSQL_TYPE_VARCHAR: From 5adf2313f713821841d979472eef0d7b07658965 Mon Sep 17 00:00:00 2001 From: =?UTF-8?q?Marko=20M=C3=A4kel=C3=A4?= Date: Wed, 2 Feb 2011 15:51:08 +0200 Subject: [PATCH 063/202] Bug #55284 diagnostics: Introduce UNIV_BLOB_LIGHT_DEBUG, enabled by UNIV_DEBUG btr_rec_get_field_ref_offs(), btr_rec_get_field_ref(): New functions. Get the pointer to an externally stored field. btr_cur_set_ownership_of_extern_field(): Assert that the BLOB has not already been disowned. btr_store_big_rec_extern_fields(): Rename to btr_store_big_rec_extern_fields_func() and add the debug parameter update_in_place. All pointers to externally stored columns in the record must either be zero or they must be pointers to inherited columns, owned by this record or an earlier record version. For any BLOB that is stored, the BLOB pointer must previously have been zero. When the function completes, all BLOB pointers must be nonzero and owned by the record. rb://549 approved by Jimmy Yang --- storage/innodb_plugin/btr/btr0cur.c | 150 ++++++++++++++++-------- storage/innodb_plugin/include/btr0cur.h | 42 ++++++- storage/innodb_plugin/include/univ.i | 2 + storage/innodb_plugin/row/row0ins.c | 2 +- storage/innodb_plugin/row/row0upd.c | 2 +- 5 files changed, 144 insertions(+), 54 deletions(-) diff --git a/storage/innodb_plugin/btr/btr0cur.c b/storage/innodb_plugin/btr/btr0cur.c index 46cd4a81ec5..704cc606a5f 100644 --- a/storage/innodb_plugin/btr/btr0cur.c +++ b/storage/innodb_plugin/btr/btr0cur.c @@ -186,7 +186,7 @@ static ulint btr_rec_get_externally_stored_len( /*==============================*/ - rec_t* rec, /*!< in: record */ + const rec_t* rec, /*!< in: record */ const ulint* offsets);/*!< in: array returned by rec_get_offsets() */ #endif /* !UNIV_HOTBACKUP */ @@ -3483,6 +3483,35 @@ btr_estimate_number_of_different_key_vals( /*================== EXTERNAL STORAGE OF BIG FIELDS ===================*/ +/***********************************************************//** +Gets the offset of the pointer to the externally stored part of a field. +@return offset of the pointer to the externally stored part */ +static +ulint +btr_rec_get_field_ref_offs( +/*=======================*/ + const ulint* offsets,/*!< in: array returned by rec_get_offsets() */ + ulint n) /*!< in: index of the external field */ +{ + ulint field_ref_offs; + ulint local_len; + + ut_a(rec_offs_nth_extern(offsets, n)); + field_ref_offs = rec_get_nth_field_offs(offsets, n, &local_len); + ut_a(local_len != UNIV_SQL_NULL); + ut_a(local_len >= BTR_EXTERN_FIELD_REF_SIZE); + + return(field_ref_offs + local_len - BTR_EXTERN_FIELD_REF_SIZE); +} + +/** Gets a pointer to the externally stored part of a field. +@param rec record +@param offsets rec_get_offsets(rec) +@param n index of the externally stored field +@return pointer to the externally stored part */ +#define btr_rec_get_field_ref(rec, offsets, n) \ + ((rec) + btr_rec_get_field_ref_offs(offsets, n)) + /***********************************************************//** Gets the externally stored size of a record, in units of a database page. @return externally stored part, in units of a database page */ @@ -3490,28 +3519,27 @@ static ulint btr_rec_get_externally_stored_len( /*==============================*/ - rec_t* rec, /*!< in: record */ + const rec_t* rec, /*!< in: record */ const ulint* offsets)/*!< in: array returned by rec_get_offsets() */ { ulint n_fields; - byte* data; - ulint local_len; - ulint extern_len; ulint total_extern_len = 0; ulint i; ut_ad(!rec_offs_comp(offsets) || !rec_get_node_ptr_flag(rec)); + + if (!rec_offs_any_extern(offsets)) { + return(0); + } + n_fields = rec_offs_n_fields(offsets); for (i = 0; i < n_fields; i++) { if (rec_offs_nth_extern(offsets, i)) { - data = rec_get_nth_field(rec, offsets, i, &local_len); - - local_len -= BTR_EXTERN_FIELD_REF_SIZE; - - extern_len = mach_read_from_4(data + local_len - + BTR_EXTERN_LEN + 4); + ulint extern_len = mach_read_from_4( + btr_rec_get_field_ref(rec, offsets, i) + + BTR_EXTERN_LEN + 4); total_extern_len += ut_calc_align(extern_len, UNIV_PAGE_SIZE); @@ -3541,7 +3569,7 @@ btr_cur_set_ownership_of_extern_field( ulint byte_val; data = rec_get_nth_field(rec, offsets, i, &local_len); - + ut_ad(rec_offs_nth_extern(offsets, i)); ut_a(local_len >= BTR_EXTERN_FIELD_REF_SIZE); local_len -= BTR_EXTERN_FIELD_REF_SIZE; @@ -3551,6 +3579,9 @@ btr_cur_set_ownership_of_extern_field( if (val) { byte_val = byte_val & (~BTR_EXTERN_OWNER_FLAG); } else { +#if defined UNIV_DEBUG || defined UNIV_BLOB_LIGHT_DEBUG + ut_a(!(byte_val & BTR_EXTERN_OWNER_FLAG)); +#endif /* UNIV_DEBUG || UNIV_BLOB_LIGHT_DEBUG */ byte_val = byte_val | BTR_EXTERN_OWNER_FLAG; } @@ -3788,8 +3819,8 @@ file segment of the index tree. @return DB_SUCCESS or DB_OUT_OF_FILE_SPACE */ UNIV_INTERN ulint -btr_store_big_rec_extern_fields( -/*============================*/ +btr_store_big_rec_extern_fields_func( +/*=================================*/ dict_index_t* index, /*!< in: index of rec; the index tree MUST be X-latched */ buf_block_t* rec_block, /*!< in/out: block containing rec */ @@ -3798,11 +3829,17 @@ btr_store_big_rec_extern_fields( the "external storage" flags in offsets will not correspond to rec when this function returns */ - big_rec_t* big_rec_vec, /*!< in: vector containing fields +#ifdef UNIV_DEBUG + mtr_t* local_mtr, /*!< in: mtr containing the + latch to rec and to the tree */ +#endif /* UNIV_DEBUG */ +#if defined UNIV_DEBUG || defined UNIV_BLOB_LIGHT_DEBUG + ibool update_in_place,/*! in: TRUE if the record is updated + in place (not delete+insert) */ +#endif /* UNIV_DEBUG || UNIV_BLOB_LIGHT_DEBUG */ + const big_rec_t*big_rec_vec) /*!< in: vector containing fields to be stored externally */ - mtr_t* local_mtr __attribute__((unused))) /*!< in: mtr - containing the latch to rec and to the - tree */ + { ulint rec_page_no; byte* field_ref; @@ -3820,6 +3857,7 @@ btr_store_big_rec_extern_fields( z_stream c_stream; ut_ad(rec_offs_validate(rec, index, offsets)); + ut_ad(rec_offs_any_extern(offsets)); ut_ad(mtr_memo_contains(local_mtr, dict_index_get_lock(index), MTR_MEMO_X_LOCK)); ut_ad(mtr_memo_contains(local_mtr, rec_block, MTR_MEMO_PAGE_X_FIX)); @@ -3851,21 +3889,37 @@ btr_store_big_rec_extern_fields( ut_a(err == Z_OK); } +#if defined UNIV_DEBUG || defined UNIV_BLOB_LIGHT_DEBUG + /* All pointers to externally stored columns in the record + must either be zero or they must be pointers to inherited + columns, owned by this record or an earlier record version. */ + for (i = 0; i < rec_offs_n_fields(offsets); i++) { + if (!rec_offs_nth_extern(offsets, i)) { + continue; + } + field_ref = btr_rec_get_field_ref(rec, offsets, i); + + ut_a(!(field_ref[BTR_EXTERN_LEN] & BTR_EXTERN_OWNER_FLAG)); + /* Either this must be an update in place, + or the BLOB must be inherited, or the BLOB pointer + must be zero (will be written in this function). */ + ut_a(update_in_place + || (field_ref[BTR_EXTERN_LEN] & BTR_EXTERN_INHERITED_FLAG) + || !memcmp(field_ref, field_ref_zero, + BTR_EXTERN_FIELD_REF_SIZE)); + } +#endif /* UNIV_DEBUG || UNIV_BLOB_LIGHT_DEBUG */ /* We have to create a file segment to the tablespace for each field and put the pointer to the field in rec */ for (i = 0; i < big_rec_vec->n_fields; i++) { - ut_ad(rec_offs_nth_extern(offsets, - big_rec_vec->fields[i].field_no)); - { - ulint local_len; - field_ref = rec_get_nth_field( - rec, offsets, big_rec_vec->fields[i].field_no, - &local_len); - ut_a(local_len >= BTR_EXTERN_FIELD_REF_SIZE); - local_len -= BTR_EXTERN_FIELD_REF_SIZE; - field_ref += local_len; - } + field_ref = btr_rec_get_field_ref( + rec, offsets, big_rec_vec->fields[i].field_no); +#if defined UNIV_DEBUG || defined UNIV_BLOB_LIGHT_DEBUG + /* A zero BLOB pointer should have been initially inserted. */ + ut_a(!memcmp(field_ref, field_ref_zero, + BTR_EXTERN_FIELD_REF_SIZE)); +#endif /* UNIV_DEBUG || UNIV_BLOB_LIGHT_DEBUG */ extern_len = big_rec_vec->fields[i].len; UNIV_MEM_ASSERT_RW(big_rec_vec->fields[i].data, extern_len); @@ -4147,6 +4201,23 @@ next_zip_page: mem_heap_free(heap); } +#if defined UNIV_DEBUG || defined UNIV_BLOB_LIGHT_DEBUG + /* All pointers to externally stored columns in the record + must be valid. */ + for (i = 0; i < rec_offs_n_fields(offsets); i++) { + if (!rec_offs_nth_extern(offsets, i)) { + continue; + } + + field_ref = btr_rec_get_field_ref(rec, offsets, i); + + /* The pointer must not be zero. */ + ut_a(0 != memcmp(field_ref, field_ref_zero, + BTR_EXTERN_FIELD_REF_SIZE)); + /* The column must not be disowned by this record. */ + ut_a(!(field_ref[BTR_EXTERN_LEN] & BTR_EXTERN_OWNER_FLAG)); + } +#endif /* UNIV_DEBUG || UNIV_BLOB_LIGHT_DEBUG */ return(DB_SUCCESS); } @@ -4228,23 +4299,13 @@ btr_free_externally_stored_field( ulint page_no; ulint next_page_no; mtr_t mtr; -#ifdef UNIV_DEBUG + ut_ad(mtr_memo_contains(local_mtr, dict_index_get_lock(index), MTR_MEMO_X_LOCK)); ut_ad(mtr_memo_contains_page(local_mtr, field_ref, MTR_MEMO_PAGE_X_FIX)); ut_ad(!rec || rec_offs_validate(rec, index, offsets)); - - if (rec) { - ulint local_len; - const byte* f = rec_get_nth_field(rec, offsets, - i, &local_len); - ut_a(local_len >= BTR_EXTERN_FIELD_REF_SIZE); - local_len -= BTR_EXTERN_FIELD_REF_SIZE; - f += local_len; - ut_ad(f == field_ref); - } -#endif /* UNIV_DEBUG */ + ut_ad(!rec || field_ref == btr_rec_get_field_ref(rec, offsets, i)); if (UNIV_UNLIKELY(!memcmp(field_ref, field_ref_zero, BTR_EXTERN_FIELD_REF_SIZE))) { @@ -4409,13 +4470,8 @@ btr_rec_free_externally_stored_fields( for (i = 0; i < n_fields; i++) { if (rec_offs_nth_extern(offsets, i)) { - ulint len; - byte* data - = rec_get_nth_field(rec, offsets, i, &len); - ut_a(len >= BTR_EXTERN_FIELD_REF_SIZE); - btr_free_externally_stored_field( - index, data + len - BTR_EXTERN_FIELD_REF_SIZE, + index, btr_rec_get_field_ref(rec, offsets, i), rec, offsets, page_zip, i, rb_ctx, mtr); } } diff --git a/storage/innodb_plugin/include/btr0cur.h b/storage/innodb_plugin/include/btr0cur.h index cb8cb399715..ece3621fa97 100644 --- a/storage/innodb_plugin/include/btr0cur.h +++ b/storage/innodb_plugin/include/btr0cur.h @@ -512,8 +512,8 @@ file segment of the index tree. @return DB_SUCCESS or DB_OUT_OF_FILE_SPACE */ UNIV_INTERN ulint -btr_store_big_rec_extern_fields( -/*============================*/ +btr_store_big_rec_extern_fields_func( +/*=================================*/ dict_index_t* index, /*!< in: index of rec; the index tree MUST be X-latched */ buf_block_t* rec_block, /*!< in/out: block containing rec */ @@ -522,10 +522,42 @@ btr_store_big_rec_extern_fields( the "external storage" flags in offsets will not correspond to rec when this function returns */ - big_rec_t* big_rec_vec, /*!< in: vector containing fields +#ifdef UNIV_DEBUG + mtr_t* local_mtr, /*!< in: mtr containing the + latch to rec and to the tree */ +#endif /* UNIV_DEBUG */ +#if defined UNIV_DEBUG || defined UNIV_BLOB_LIGHT_DEBUG + ibool update_in_place,/*! in: TRUE if the record is updated + in place (not delete+insert) */ +#endif /* UNIV_DEBUG || UNIV_BLOB_LIGHT_DEBUG */ + const big_rec_t*big_rec_vec) /*!< in: vector containing fields to be stored externally */ - mtr_t* local_mtr); /*!< in: mtr containing the latch to - rec and to the tree */ + __attribute__((nonnull)); + +/** Stores the fields in big_rec_vec to the tablespace and puts pointers to +them in rec. The extern flags in rec will have to be set beforehand. +The fields are stored on pages allocated from leaf node +file segment of the index tree. +@param index in: clustered index; MUST be X-latched by mtr +@param b in/out: block containing rec; MUST be X-latched by mtr +@param rec in/out: clustered index record +@param offsets in: rec_get_offsets(rec, index); + the "external storage" flags in offsets will not be adjusted +@param mtr in: mini-transaction that holds x-latch on index and b +@param upd in: TRUE if the record is updated in place (not delete+insert) +@param big in: vector containing fields to be stored externally +@return DB_SUCCESS or DB_OUT_OF_FILE_SPACE */ +#ifdef UNIV_DEBUG +# define btr_store_big_rec_extern_fields(index,b,rec,offsets,mtr,upd,big) \ + btr_store_big_rec_extern_fields_func(index,b,rec,offsets,mtr,upd,big) +#elif defined UNIV_BLOB_LIGHT_DEBUG +# define btr_store_big_rec_extern_fields(index,b,rec,offsets,mtr,upd,big) \ + btr_store_big_rec_extern_fields_func(index,b,rec,offsets,upd,big) +#else +# define btr_store_big_rec_extern_fields(index,b,rec,offsets,mtr,upd,big) \ + btr_store_big_rec_extern_fields_func(index,b,rec,offsets,big) +#endif + /*******************************************************************//** Frees the space in an externally stored field to the file space management if the field in data is owned the externally stored field, diff --git a/storage/innodb_plugin/include/univ.i b/storage/innodb_plugin/include/univ.i index 4ba48b10896..690bfd5d6a9 100644 --- a/storage/innodb_plugin/include/univ.i +++ b/storage/innodb_plugin/include/univ.i @@ -177,6 +177,8 @@ command. Not tested on Windows. */ debugging without UNIV_DEBUG */ #define UNIV_BUF_DEBUG /* Enable buffer pool debugging without UNIV_DEBUG */ +#define UNIV_BLOB_LIGHT_DEBUG /* Enable off-page column + debugging without UNIV_DEBUG */ #define UNIV_DEBUG /* Enable ut_ad() assertions and disable UNIV_INLINE */ #define UNIV_DEBUG_LOCK_VALIDATE /* Enable diff --git a/storage/innodb_plugin/row/row0ins.c b/storage/innodb_plugin/row/row0ins.c index 298c601c7e3..8050c099751 100644 --- a/storage/innodb_plugin/row/row0ins.c +++ b/storage/innodb_plugin/row/row0ins.c @@ -2130,7 +2130,7 @@ function_exit: err = btr_store_big_rec_extern_fields( index, btr_cur_get_block(&cursor), - rec, offsets, big_rec, &mtr); + rec, offsets, &mtr, FALSE, big_rec); if (modify) { dtuple_big_rec_free(big_rec); diff --git a/storage/innodb_plugin/row/row0upd.c b/storage/innodb_plugin/row/row0upd.c index b5d4aeb434e..9ded3d68018 100644 --- a/storage/innodb_plugin/row/row0upd.c +++ b/storage/innodb_plugin/row/row0upd.c @@ -1952,7 +1952,7 @@ row_upd_clust_rec( index, btr_cur_get_block(btr_cur), rec, rec_get_offsets(rec, index, offsets_, ULINT_UNDEFINED, &heap), - big_rec, mtr); + mtr, TRUE, big_rec); mtr_commit(mtr); } From a70c34bf0f34703fd330f8cb828e48b303c5296a Mon Sep 17 00:00:00 2001 From: Georgi Kodinov Date: Wed, 2 Feb 2011 18:51:35 +0200 Subject: [PATCH 064/202] Fixes for Bug #55755 and Bug #52315 part 2 Bug #55755 : Date STD variable signness breaks server on FreeBSD and OpenBSD * Added a check to configure on the size of time_t * Created a macro to check for a valid time_t that is safe to use with datetime functions and store in TIMESTAMP columns. * Used the macro consistently instead of the ad-hoc checks introduced by 52315 * Fixed compliation warnings on platforms where the size of time_t is smaller than the size of a long (e.g. OpenBSD 4.8 64 amd64). Bug #52315: utc_date() crashes when system time > year 2037 * Added a correct check for the timestamp range instead of just variable size check to SET TIMESTAMP. * Added overflow checking before converting to time_t. * Using a correct localized error message in this case instead of the generic error. * Added a test suite. * fixed the checks so that they check for unsigned time_t as well. Used the checks consistently across the source code. * fixed the original test case to expect the new error code. --- configure.in | 9 +++++++++ include/config-win.h | 5 +++++ include/my_time.h | 13 +++++++++++++ mysql-test/r/func_time.result | 17 +++++++++++++++++ mysql-test/t/func_time.test | 19 +++++++++++++++++++ mysql-test/t/variables.test | 2 +- sql-common/my_time.c | 2 +- sql/mysqld.cc | 14 +++++++------- sql/set_var.cc | 12 ++++++------ sql/sql_class.h | 2 +- 10 files changed, 79 insertions(+), 16 deletions(-) diff --git a/configure.in b/configure.in index fda56554879..523d36afaea 100644 --- a/configure.in +++ b/configure.in @@ -1956,6 +1956,15 @@ dnl MYSQL_CHECK_TIME_T +dnl +dnl check size of time_t +dnl + +AC_CHECK_SIZEOF(time_t, 8) +if test "$ac_cv_sizeof_time_t" -eq 0 +then + AC_MSG_ERROR("MySQL needs a time_t type.") +fi # do we need #pragma interface/#pragma implementation ? # yes if it's gcc 2.x, and not icc pretending to be gcc, and not cygwin diff --git a/include/config-win.h b/include/config-win.h index 84705809d7a..5e37d9e3a20 100644 --- a/include/config-win.h +++ b/include/config-win.h @@ -167,6 +167,11 @@ typedef uint rf_SetTimer; #define SIZEOF_LONG 4 #define SIZEOF_LONG_LONG 8 #define SIZEOF_OFF_T 8 +/* + The size of time_t depends on the compiler. + But it's 8 for all the supported VC versions. +*/ +#define SIZEOF_TIME_T 8 #ifdef _WIN64 #define SIZEOF_CHARP 8 #else diff --git a/include/my_time.h b/include/my_time.h index 014327d6fd8..5603535e0b7 100644 --- a/include/my_time.h +++ b/include/my_time.h @@ -53,6 +53,19 @@ typedef long my_time_t; #define YY_PART_YEAR 70 +/* + check for valid times only if the range of time_t is greater than + the range of my_time_t +*/ +#if SIZEOF_TIME_T > 4 || defined(TIME_T_UNSIGNED) +# define IS_TIME_T_VALID_FOR_TIMESTAMP(x) \ + ((x) <= TIMESTAMP_MAX_VALUE && \ + (x) >= TIMESTAMP_MIN_VALUE) +#else +# define IS_TIME_T_VALID_FOR_TIMESTAMP(x) \ + ((x) >= TIMESTAMP_MIN_VALUE) +#endif + /* Flags to str_to_datetime */ #define TIME_FUZZY_DATE 1 #define TIME_DATETIME_ONLY 2 diff --git a/mysql-test/r/func_time.result b/mysql-test/r/func_time.result index b3505795494..8638fb09e5a 100644 --- a/mysql-test/r/func_time.result +++ b/mysql-test/r/func_time.result @@ -1323,4 +1323,21 @@ SELECT '2008-02-18' + INTERVAL 1 FRAC_SECOND; ERROR 42000: You have an error in your SQL syntax; check the manual that corresponds to your MySQL server version for the right syntax to use near 'FRAC_SECOND' at line 1 SELECT '2008-02-18' - INTERVAL 1 FRAC_SECOND; ERROR 42000: You have an error in your SQL syntax; check the manual that corresponds to your MySQL server version for the right syntax to use near 'FRAC_SECOND' at line 1 +# +# Bug #52315 part 2 : utc_date() crashes when system time > year 2037 +# +SET TIMESTAMP=-147490000; +SELECT UTC_TIMESTAMP(); +SET TIMESTAMP=2147483648; +SELECT UTC_TIMESTAMP(); +SET TIMESTAMP=2147483646; +SELECT UTC_TIMESTAMP(); +SET TIMESTAMP=2147483647; +SELECT UTC_TIMESTAMP(); +SET TIMESTAMP=0; +SELECT UTC_TIMESTAMP(); +SET TIMESTAMP=-1; +SELECT UTC_TIMESTAMP(); +SET TIMESTAMP=1; +SELECT UTC_TIMESTAMP(); End of 5.0 tests diff --git a/mysql-test/t/func_time.test b/mysql-test/t/func_time.test index 65d8764f2ce..475938b4458 100644 --- a/mysql-test/t/func_time.test +++ b/mysql-test/t/func_time.test @@ -838,4 +838,23 @@ SELECT '2008-02-18' + INTERVAL 1 FRAC_SECOND; --error ER_PARSE_ERROR SELECT '2008-02-18' - INTERVAL 1 FRAC_SECOND; + +--echo # +--echo # Bug #52315 part 2 : utc_date() crashes when system time > year 2037 +--echo # + +--disable_result_log +--error ER_WRONG_VALUE_FOR_VAR +SET TIMESTAMP=-147490000; SELECT UTC_TIMESTAMP(); +--error ER_WRONG_VALUE_FOR_VAR +SET TIMESTAMP=2147483648; SELECT UTC_TIMESTAMP(); +SET TIMESTAMP=2147483646; SELECT UTC_TIMESTAMP(); +SET TIMESTAMP=2147483647; SELECT UTC_TIMESTAMP(); +SET TIMESTAMP=0; SELECT UTC_TIMESTAMP(); +--error ER_WRONG_VALUE_FOR_VAR +SET TIMESTAMP=-1; SELECT UTC_TIMESTAMP(); +SET TIMESTAMP=1; SELECT UTC_TIMESTAMP(); +--enable_result_log + + --echo End of 5.0 tests diff --git a/mysql-test/t/variables.test b/mysql-test/t/variables.test index 73e5bbd9d87..778fb133045 100644 --- a/mysql-test/t/variables.test +++ b/mysql-test/t/variables.test @@ -776,7 +776,7 @@ SET @@myisam_mmap_size= 500M; --echo # Bug #52315: utc_date() crashes when system time > year 2037 --echo # ---error 0, ER_UNKNOWN_ERROR +--error 0, ER_WRONG_VALUE_FOR_VAR SET TIMESTAMP=2*1024*1024*1024; --echo #Should not crash --disable_result_log diff --git a/sql-common/my_time.c b/sql-common/my_time.c index ed1279f7afb..07cb8b25c46 100644 --- a/sql-common/my_time.c +++ b/sql-common/my_time.c @@ -985,7 +985,7 @@ my_system_gmt_sec(const MYSQL_TIME *t_src, long *my_timezone, with unsigned time_t tmp+= shift*86400L might result in a number, larger then TIMESTAMP_MAX_VALUE, so another check will work. */ - if ((tmp < TIMESTAMP_MIN_VALUE) || (tmp > TIMESTAMP_MAX_VALUE)) + if (!IS_TIME_T_VALID_FOR_TIMESTAMP(tmp)) tmp= 0; return (my_time_t) tmp; diff --git a/sql/mysqld.cc b/sql/mysqld.cc index 5f84d15588d..f026bab1c32 100644 --- a/sql/mysqld.cc +++ b/sql/mysqld.cc @@ -2836,13 +2836,6 @@ static int init_common_variables(const char *conf_file_name, int argc, max_system_variables.pseudo_thread_id= (ulong)~0; server_start_time= flush_status_time= time((time_t*) 0); - /* TODO: remove this when my_time_t is 64 bit compatible */ - if (server_start_time >= (time_t) MY_TIME_T_MAX) - { - sql_print_error("This MySQL server doesn't support dates later then 2038"); - return 1; - } - if (init_thread_environment()) return 1; mysql_init_variables(); @@ -2882,6 +2875,13 @@ static int init_common_variables(const char *conf_file_name, int argc, mysql_slow_log.init_pthread_objects(); mysql_bin_log.init_pthread_objects(); + /* TODO: remove this when my_time_t is 64 bit compatible */ + if (!IS_TIME_T_VALID_FOR_TIMESTAMP(server_start_time)) + { + sql_print_error("This MySQL server doesn't support dates later then 2038"); + return 1; + } + if (gethostname(glob_hostname,sizeof(glob_hostname)) < 0) { strmake(glob_hostname, STRING_WITH_LEN("localhost")); diff --git a/sql/set_var.cc b/sql/set_var.cc index 9c327504577..fbc7cdbc232 100644 --- a/sql/set_var.cc +++ b/sql/set_var.cc @@ -2714,14 +2714,14 @@ int set_var_collation_client::update(THD *thd) bool sys_var_timestamp::check(THD *thd, set_var *var) { - time_t val; + longlong val; var->save_result.ulonglong_value= var->value->val_int(); - val= (time_t) var->save_result.ulonglong_value; - if (val < (time_t) MY_TIME_T_MIN || val > (time_t) MY_TIME_T_MAX) + val= (longlong) var->save_result.ulonglong_value; + if (val != 0 && // this is how you set the default value + (val < TIMESTAMP_MIN_VALUE || val > TIMESTAMP_MAX_VALUE)) { - my_message(ER_UNKNOWN_ERROR, - "This version of MySQL doesn't support dates later than 2038", - MYF(0)); + char buf[64]; + my_error(ER_WRONG_VALUE_FOR_VAR, MYF(0), "timestamp", llstr(val, buf)); return TRUE; } return FALSE; diff --git a/sql/sql_class.h b/sql/sql_class.h index 2f4af15c02d..70086e2d944 100644 --- a/sql/sql_class.h +++ b/sql/sql_class.h @@ -1710,7 +1710,7 @@ public: /*TODO: this will be obsolete when we have support for 64 bit my_time_t */ inline bool is_valid_time() { - return (start_time < (time_t) MY_TIME_T_MAX); + return (IS_TIME_T_VALID_FOR_TIMESTAMP(start_time)); } inline void insert_id(ulonglong id_arg) { From 0a8419dfdd6d80b6029c354fb0a82683b2fef617 Mon Sep 17 00:00:00 2001 From: Georgi Kodinov Date: Wed, 2 Feb 2011 20:10:57 +0200 Subject: [PATCH 065/202] Bug #52315 part 2 addendum : reset back the timestamp --- mysql-test/r/func_time.result | 1 + mysql-test/t/func_time.test | 3 +++ 2 files changed, 4 insertions(+) diff --git a/mysql-test/r/func_time.result b/mysql-test/r/func_time.result index 8638fb09e5a..0bca06a55e2 100644 --- a/mysql-test/r/func_time.result +++ b/mysql-test/r/func_time.result @@ -1340,4 +1340,5 @@ SET TIMESTAMP=-1; SELECT UTC_TIMESTAMP(); SET TIMESTAMP=1; SELECT UTC_TIMESTAMP(); +SET TIMESTAMP=0; End of 5.0 tests diff --git a/mysql-test/t/func_time.test b/mysql-test/t/func_time.test index 475938b4458..7ec07dd786a 100644 --- a/mysql-test/t/func_time.test +++ b/mysql-test/t/func_time.test @@ -856,5 +856,8 @@ SET TIMESTAMP=-1; SELECT UTC_TIMESTAMP(); SET TIMESTAMP=1; SELECT UTC_TIMESTAMP(); --enable_result_log +#reset back the timestamp value +SET TIMESTAMP=0; + --echo End of 5.0 tests From cb10771fd820be7f6c28b689b9f93b78baa991af Mon Sep 17 00:00:00 2001 From: Luis Soares Date: Thu, 3 Feb 2011 16:09:33 +0000 Subject: [PATCH 066/202] BUG#59147: rpl_circular_for_4_hosts fails sporadically There is one part of the test case that needs to break and re-establish the circular topology. For this the test stops the slave threads on a couple of servers and restarts them with START SLAVE. However, no check is done on the status of the IO or SQL threads before proceeding with the subsequent commands. Because rpl_only_running_threads is set to 1 this can lead to silently not syncing all slave threads as expected, ultimately resulting in unexpected results (and consequently on a failing test run). We fix this by replacing the START SLAVE instructions with calls to --source include/start_slave.inc, which will wait for the slave threads to be running (show 'Yes' in Slave_IO|SQL_Running fields of SHOW SLAVE STATUS) before proceeding. Additionally, we change rpl_sync.inc to make the IO thread report that it is running when its running status is any other than 'No'. --- mysql-test/include/rpl_sync.inc | 2 +- mysql-test/suite/rpl/r/rpl_circular_for_4_hosts.result | 4 ++-- mysql-test/suite/rpl/t/rpl_circular_for_4_hosts.test | 4 ++-- 3 files changed, 5 insertions(+), 5 deletions(-) diff --git a/mysql-test/include/rpl_sync.inc b/mysql-test/include/rpl_sync.inc index a05bee23981..be2904528ff 100644 --- a/mysql-test/include/rpl_sync.inc +++ b/mysql-test/include/rpl_sync.inc @@ -88,7 +88,7 @@ while ($_rpl_i) { { --echo Sync IO: $_rpl_slave_io_running; Sync SQL: $_rpl_slave_sql_running } - --let $_rpl_slave_io_running= `SELECT IF('$_rpl_slave_io_running' = 'Yes', 1, '')` + --let $_rpl_slave_io_running= `SELECT IF('$_rpl_slave_io_running' != 'No', 1, '')` --let $_rpl_slave_sql_running= `SELECT IF('$_rpl_slave_sql_running' = 'Yes', 1, '')` if ($_rpl_slave_io_running) { diff --git a/mysql-test/suite/rpl/r/rpl_circular_for_4_hosts.result b/mysql-test/suite/rpl/r/rpl_circular_for_4_hosts.result index fb1d3f8258e..6981e549918 100644 --- a/mysql-test/suite/rpl/r/rpl_circular_for_4_hosts.result +++ b/mysql-test/suite/rpl/r/rpl_circular_for_4_hosts.result @@ -121,11 +121,11 @@ Master D 12 D * Remove wrong event from C and restore B->C->D * include/stop_slave.inc DELETE FROM t1 WHERE a = 6; -START SLAVE; +include/start_slave.inc RESET MASTER; RESET SLAVE; include/rpl_change_topology.inc [new topology=1->2->3->4->1] -START SLAVE; +include/start_slave.inc include/rpl_sync.inc * Check data inserted before restoring schema A->B->C->D->A * diff --git a/mysql-test/suite/rpl/t/rpl_circular_for_4_hosts.test b/mysql-test/suite/rpl/t/rpl_circular_for_4_hosts.test index 6099637e3e9..820ffc42933 100644 --- a/mysql-test/suite/rpl/t/rpl_circular_for_4_hosts.test +++ b/mysql-test/suite/rpl/t/rpl_circular_for_4_hosts.test @@ -175,7 +175,7 @@ SELECT 'Master D',a,b FROM t1 WHERE c = 3 ORDER BY a,b; source include/stop_slave.inc; --connection server_3 DELETE FROM t1 WHERE a = 6; -START SLAVE; +--source include/start_slave.inc --connection server_2 --sync_slave_with_master server_3 RESET MASTER; @@ -189,7 +189,7 @@ RESET SLAVE; --source include/rpl_change_topology.inc #--replace_result $SERVER_MYPORT_3 SERVER_MYPORT_3 $file_d LOG_FILE $pos_d LOG_POS #--eval CHANGE MASTER TO master_host='127.0.0.1',master_port=$SERVER_MYPORT_3,master_user='root',master_log_file='$file_d',master_log_pos=$pos_d -START SLAVE; +--source include/start_slave.inc --connection server_3 --sync_slave_with_master server_4 --source include/rpl_sync.inc From 106e590086e3a02b89822e1ca258f9be5dc14127 Mon Sep 17 00:00:00 2001 From: Joerg Bruehe Date: Thu, 3 Feb 2011 18:16:22 +0100 Subject: [PATCH 067/202] Fix Bug #56581 RPM scripts use hardcoded datadir location When fixing the 27072 bug, the shell snippets running before/after a RPM upgrade got expanded to look at files in the data directory and at the PID file. In this expansion, the standard locations were used. There are users who configure their installations to use non-standard locations for the data directory, the PID file, and other objects. For these users, the fix of 27072 did not work. As a result, the fact that a server was running at upgrade start was not noticed, and the new server was not started after the upgrade. With this patch, the shell snippets now try to get these locations from "my_print_defaults" before falling back to the defaults. Now, the fact that the old server is running is again noticed (even with non-standard locations), and the new server is started. Also, the upgrade log is written to the correct data directory. support-files/mysql.spec.sh: See the global comment for the purpose of this change. In tests on SuSE 11, it was found necessary to use the full path name of "my_print_defaults", it seems $PATH die not include "/usr/bin". --- support-files/mysql.spec.sh | 58 ++++++++++++++++++++++++++++++------- 1 file changed, 48 insertions(+), 10 deletions(-) diff --git a/support-files/mysql.spec.sh b/support-files/mysql.spec.sh index c69ae6afce0..33c1254bc15 100644 --- a/support-files/mysql.spec.sh +++ b/support-files/mysql.spec.sh @@ -1,4 +1,4 @@ -# Copyright (c) 2000, 2010, Oracle and/or its affiliates. All rights reserved. +# Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. # # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by @@ -610,7 +610,25 @@ touch $RBR%{_sysconfdir}/mysqlmanager.passwd ############################################################################## %pre server -mysql_datadir=%{mysqldatadir} +# This is the code running at the beginning of a RPM upgrade action, +# before replacing the old files with the new ones. + +# There are users who deviate from the default file system layout. +# Check local settings to support them. +if [ -x %{_bindir}/my_print_defaults ] +then + mysql_datadir=`%{_bindir}/my_print_defaults server mysqld | grep '^--datadir=' | sed -n 's/--datadir=//p'` + PID_FILE_PATT=`%{_bindir}/my_print_defaults server mysqld | grep '^--pid-file=' | sed -n 's/--pid-file=//p'` +fi +if [ -z "$mysql_datadir" ] +then + mysql_datadir=%{mysqldatadir} +fi +if [ -z "$PID_FILE_PATT" ] +then + PID_FILE_PATT="$mysql_datadir/*.pid" +fi + # Check if we can safely upgrade. An upgrade is only safe if it's from one # of our RPMs in the same version family. @@ -681,7 +699,7 @@ fi # We assume that if there is exactly one ".pid" file, # it contains the valid PID of a running MySQL server. -NR_PID_FILES=`ls $mysql_datadir/*.pid 2>/dev/null | wc -l` +NR_PID_FILES=`ls $PID_FILE_PATT 2>/dev/null | wc -l` case $NR_PID_FILES in 0 ) SERVER_TO_START='' ;; # No "*.pid" file == no running server 1 ) SERVER_TO_START='true' ;; @@ -703,8 +721,8 @@ if [ -f $STATUS_FILE ]; then echo "before repeating the MySQL upgrade." exit 1 elif [ -n "$SEVERAL_PID_FILES" ] ; then - echo "Your MySQL directory '$mysql_datadir' has more than one PID file:" - ls -ld $mysql_datadir/*.pid + echo "You have more than one PID file:" + ls -ld $PID_FILE_PATT echo "Please check which one (if any) corresponds to a running server" echo "and delete all others before repeating the MySQL upgrade." exit 1 @@ -729,17 +747,17 @@ if [ -d $mysql_datadir ] ; then if [ -n "$SERVER_TO_START" ] ; then # There is only one PID file, race possibility ignored echo "PID file:" >> $STATUS_FILE - ls -l $mysql_datadir/*.pid >> $STATUS_FILE - cat $mysql_datadir/*.pid >> $STATUS_FILE + ls -l $PID_FILE_PATT >> $STATUS_FILE + cat $PID_FILE_PATT >> $STATUS_FILE echo >> $STATUS_FILE echo "Server process:" >> $STATUS_FILE - ps -fp `cat $mysql_datadir/*.pid` >> $STATUS_FILE + ps -fp `cat $PID_FILE_PATT` >> $STATUS_FILE echo >> $STATUS_FILE echo "SERVER_TO_START=$SERVER_TO_START" >> $STATUS_FILE else # Take a note we checked it ... echo "PID file:" >> $STATUS_FILE - ls -l $mysql_datadir/*.pid >> $STATUS_FILE 2>&1 + ls -l $PID_FILE_PATT >> $STATUS_FILE 2>&1 fi fi @@ -754,7 +772,20 @@ if [ -x %{_sysconfdir}/init.d/mysql ] ; then fi %post server -mysql_datadir=%{mysqldatadir} +# This is the code running at the end of a RPM install or upgrade action, +# after the (new) files have been written. + +# There are users who deviate from the default file system layout. +# Check local settings to support them. +if [ -x %{_bindir}/my_print_defaults ] +then + mysql_datadir=`%{_bindir}/my_print_defaults server mysqld | grep '^--datadir=' | sed -n 's/--datadir=//p'` +fi +if [ -z "$mysql_datadir" ] +then + mysql_datadir=%{mysqldatadir} +fi + NEW_VERSION=%{mysql_version}-%{release} STATUS_FILE=$mysql_datadir/RPM_UPGRADE_MARKER @@ -1133,6 +1164,13 @@ fi ############################################################################## %changelog +* Thu Feb 03 2011 Joerg Bruehe + +- Fix bug#56581: If an installation deviates from the default file locations + ("datadir" and "pid-file"), the mechanism to detect a running server (on upgrade) + should still work, and use these locations. + The problem was that the fix for bug#27072 did not check for local settings. + * Wed Nov 24 2010 Alexander Nozdrin - EXCEPTIONS-CLIENT has been deleted, remove it from here too. From 378091e434d66dcc7081f991a07db2244dbb8cda Mon Sep 17 00:00:00 2001 From: Dmitry Shulga Date: Fri, 4 Feb 2011 10:47:46 +0600 Subject: [PATCH 068/202] Fixed bug#58026 - massive recursion and crash in regular expression handling. The problem was that parsing of nested regular expression involved recursive calls. Such recursion didn't take into account the amount of available stack space, which ended up leading to stack overflow crashes. mysql-test/t/not_embedded_server.test: Added test for bug#58026. regex/my_regex.h: added pointer to function as last argument of my_regex_init() for check enough memory in stack. regex/regcomp.c: p_ere() was modified: added call to function for check enough memory in stack. Function for check available stack space specified by global variable my_regex_enough_mem_in_stack. This variable set to NULL for embedded mysqld and to a pointer to function check_enough_stack_size otherwise. regex/reginit.c: my_regex_init was modified: pass a pointer to a function for check enough memory in stack space. Reset this pointer to NULL in my_regex_end. sql/mysqld.cc: Added function check_enough_stack_size() for check enough memory in stack. Passed this function as second argument to my_regex_init. For embedded mysqld passed NULL as second argument. --- mysql-test/r/not_embedded_server.result | 4 ++++ mysql-test/t/not_embedded_server.test | 10 ++++++++++ regex/my_regex.h | 4 +++- regex/regcomp.c | 15 +++++++++++++-- regex/reginit.c | 6 +++++- sql/mysqld.cc | 19 ++++++++++++++++++- 6 files changed, 53 insertions(+), 5 deletions(-) diff --git a/mysql-test/r/not_embedded_server.result b/mysql-test/r/not_embedded_server.result index 60c92bd0196..7219e29b2a6 100644 --- a/mysql-test/r/not_embedded_server.result +++ b/mysql-test/r/not_embedded_server.result @@ -4,3 +4,7 @@ select 1; SHOW VARIABLES like 'slave_skip_errors'; Variable_name Value slave_skip_errors OFF +# +# Bug#58026: massive recursion and crash in regular expression handling +# +SELECT '1' RLIKE RPAD('1', 10000, '('); diff --git a/mysql-test/t/not_embedded_server.test b/mysql-test/t/not_embedded_server.test index fa2b659ec57..43cdb977386 100644 --- a/mysql-test/t/not_embedded_server.test +++ b/mysql-test/t/not_embedded_server.test @@ -42,4 +42,14 @@ select 1; SHOW VARIABLES like 'slave_skip_errors'; +--echo # +--echo # Bug#58026: massive recursion and crash in regular expression handling +--echo # + +--disable_result_log +--error ER_STACK_OVERRUN_NEED_MORE +SELECT '1' RLIKE RPAD('1', 10000, '('); +--enable_result_log + + # End of 5.1 tests diff --git a/regex/my_regex.h b/regex/my_regex.h index 0d1cedf5430..30896e29b91 100644 --- a/regex/my_regex.h +++ b/regex/my_regex.h @@ -28,6 +28,7 @@ typedef struct { /* === regcomp.c === */ +typedef int (*my_regex_stack_check_t)(); extern int my_regcomp(my_regex_t *, const char *, int, CHARSET_INFO *charset); #define REG_BASIC 0000 #define REG_EXTENDED 0001 @@ -76,7 +77,8 @@ extern void my_regfree(my_regex_t *); /* === reginit.c === */ -extern void my_regex_init(CHARSET_INFO *cs); /* Should be called for multithread progs */ +/* Should be called for multithread progs */ +extern void my_regex_init(CHARSET_INFO *cs, my_regex_stack_check_t func); extern void my_regex_end(void); /* If one wants a clean end */ #ifdef __cplusplus diff --git a/regex/regcomp.c b/regex/regcomp.c index 81c435ed552..e163a9ba7f4 100644 --- a/regex/regcomp.c +++ b/regex/regcomp.c @@ -31,6 +31,9 @@ struct parse { CHARSET_INFO *charset; /* for ctype things */ }; +/* Check if there is enough stack space for recursion. */ +my_regex_stack_check_t my_regex_enough_mem_in_stack= NULL; + #include "regcomp.ih" static char nuls[10]; /* place to point scanner in event of error */ @@ -117,7 +120,7 @@ CHARSET_INFO *charset; # define GOODFLAGS(f) ((f)&~REG_DUMP) #endif - my_regex_init(charset); /* Init cclass if neaded */ + my_regex_init(charset, NULL); /* Init cclass if neaded */ preg->charset=charset; cflags = GOODFLAGS(cflags); if ((cflags®_EXTENDED) && (cflags®_NOSPEC)) @@ -222,7 +225,15 @@ int stop; /* character this ERE should end at */ /* do a bunch of concatenated expressions */ conc = HERE(); while (MORE() && (c = PEEK()) != '|' && c != stop) - p_ere_exp(p); + { + if (my_regex_enough_mem_in_stack && + my_regex_enough_mem_in_stack()) + { + SETERROR(REG_ESPACE); + return; + } + p_ere_exp(p); + } if(REQUIRE(HERE() != conc, REG_EMPTY)) {}/* require nonempty */ if (!EAT('|')) diff --git a/regex/reginit.c b/regex/reginit.c index 5980de24030..3d2cd64d1e7 100644 --- a/regex/reginit.c +++ b/regex/reginit.c @@ -4,10 +4,12 @@ #include #include #include "cclass.h" +#include "my_regex.h" static my_bool regex_inited=0; +extern my_regex_stack_check_t my_regex_enough_mem_in_stack; -void my_regex_init(CHARSET_INFO *cs) +void my_regex_init(CHARSET_INFO *cs, my_regex_stack_check_t func) { char buff[CCLASS_LAST][256]; int count[CCLASS_LAST]; @@ -16,6 +18,7 @@ void my_regex_init(CHARSET_INFO *cs) if (!regex_inited) { regex_inited=1; + my_regex_enough_mem_in_stack= func; bzero((uchar*) &count,sizeof(count)); for (i=1 ; i<= 255; i++) @@ -74,6 +77,7 @@ void my_regex_end() int i; for (i=0; i < CCLASS_LAST ; i++) free((char*) cclasses[i].chars); + my_regex_enough_mem_in_stack= NULL; regex_inited=0; } } diff --git a/sql/mysqld.cc b/sql/mysqld.cc index 54f93cccd5d..694d64c81df 100644 --- a/sql/mysqld.cc +++ b/sql/mysqld.cc @@ -3034,6 +3034,19 @@ sizeof(load_default_groups)/sizeof(load_default_groups[0]); #endif +#ifndef EMBEDDED_LIBRARY +static +int +check_enough_stack_size() +{ + uchar stack_top; + + return check_stack_overrun(current_thd, STACK_MIN_SIZE, + &stack_top); +} +#endif + + /** Initialize one of the global date/time format variables. @@ -3415,7 +3428,11 @@ static int init_common_variables(const char *conf_file_name, int argc, #endif mysys_uses_curses=0; #ifdef USE_REGEX - my_regex_init(&my_charset_latin1); +#ifndef EMBEDDED_LIBRARY + my_regex_init(&my_charset_latin1, check_enough_stack_size); +#else + my_regex_init(&my_charset_latin1, NULL); +#endif #endif /* Process a comma-separated character set list and choose From 5082c4d1de5d9fb70fef89f6e89e00097ce9374e Mon Sep 17 00:00:00 2001 From: Vasil Dimov Date: Fri, 4 Feb 2011 12:46:47 +0200 Subject: [PATCH 069/202] Fix Bug#59874 Valgrind warning in InnoDB compression code Add suppressions for a bogus valgrind warnings. --- mysql-test/valgrind.supp | 34 ++++++++++++++++++++++++++++++++++ 1 file changed, 34 insertions(+) diff --git a/mysql-test/valgrind.supp b/mysql-test/valgrind.supp index 1016923a360..367dc62898a 100644 --- a/mysql-test/valgrind.supp +++ b/mysql-test/valgrind.supp @@ -744,3 +744,37 @@ Memcheck:Addr1 fun:buf_buddy_relocate } + +{ + Bug 59874 Valgrind warning in InnoDB compression code + Memcheck:Cond + obj:*/libz.so* + obj:*/libz.so* + fun:deflate + fun:btr_store_big_rec_extern_fields_func + fun:row_ins_index_entry_low + fun:row_ins_index_entry + fun:row_ins_index_entry_step + fun:row_ins + fun:row_ins_step + fun:row_insert_for_mysql +} + +{ + In page0zip.c we have already checked that the memory is initialized before calling deflate() + Memcheck:Cond + obj:*/libz.so* + obj:*/libz.so* + fun:deflate + fun:page_zip_compress + fun:page_cur_insert_rec_zip_reorg + fun:page_cur_insert_rec_zip + fun:page_cur_tuple_insert + fun:btr_cur_optimistic_insert + fun:row_ins_index_entry_low + fun:row_ins_index_entry + fun:row_ins_index_entry_step + fun:row_ins + fun:row_ins_step + fun:row_insert_for_mysql +} From cd51cbf1e53c01424d270c6a41bf6f2166949a31 Mon Sep 17 00:00:00 2001 From: Bjorn Munch Date: Fri, 4 Feb 2011 12:33:45 +0100 Subject: [PATCH 070/202] Bug #47141 "mysqltest" breaks because it tries to act on a debug option which is disabled Replace --debug with --loose-debug to prevent failure exit Update: added workaround for 50627, skip all debugging of mysqlbinlog --- mysql-test/mysql-test-run.pl | 5 ++++- 1 file changed, 4 insertions(+), 1 deletion(-) diff --git a/mysql-test/mysql-test-run.pl b/mysql-test/mysql-test-run.pl index 03dd3e5bd3f..27e52d814e4 100755 --- a/mysql-test/mysql-test-run.pl +++ b/mysql-test/mysql-test-run.pl @@ -1783,9 +1783,12 @@ sub executable_setup () { sub client_debug_arg($$) { my ($args, $client_name)= @_; + # Workaround for Bug #50627: drop any debug opt + return if $client_name =~ /^mysqlbinlog/; + if ( $opt_debug ) { mtr_add_arg($args, - "--debug=d:t:A,%s/log/%s.trace", + "--loose-debug=d:t:A,%s/log/%s.trace", $path_vardir_trace, $client_name) } } From 980868eb4e4db550497ba40674b5b64f2e062cd9 Mon Sep 17 00:00:00 2001 From: Dmitry Shulga Date: Sat, 5 Feb 2011 11:02:00 +0600 Subject: [PATCH 071/202] Fixed bug#57450 - mysql client enter in an infinite loop if the standard input is a directory. The problem is that mysql monitor try to read from stdin without checking input source type. The solution is to stop reading data from standard input if a call to read(2) failed. A new test case was added into mysql.test. client/my_readline.h: Data members error and truncated was added to LINE_BUFFER structure. These data members used instead of out parameters in functions batch_readline, intern_read_line. client/mysql.cc: read_and_execute() was modified: set status.exit_status to 1 when the error occured while reading the next command line in non-interactive mode. Also the value of the truncated attribute of structure LINE_BUFF is taken into account only for non-iteractive mode. client/readline.cc: intern_read_line() was modified: cancel reading from input if fill_buffer() returns -1, e.g. if call to read failed. batch_readline was modified: set the error data member of LINE_BUFFER structure to value of my_errno when system error happened during call to my_read/my_realloc. mysql-test/t/mysql.test: Test for bug#57450 was added. --- client/my_readline.h | 4 +++- client/mysql.cc | 16 ++++++++++------ client/readline.cc | 33 ++++++++++++++++++++------------- mysql-test/t/mysql.test | 6 ++++++ 4 files changed, 39 insertions(+), 20 deletions(-) diff --git a/client/my_readline.h b/client/my_readline.h index 62ad19bece9..3376fc81761 100644 --- a/client/my_readline.h +++ b/client/my_readline.h @@ -25,9 +25,11 @@ typedef struct st_line_buffer uint eof; ulong max_size; ulong read_length; /* Length of last read string */ + int error; + bool truncated; } LINE_BUFFER; extern LINE_BUFFER *batch_readline_init(ulong max_size,FILE *file); extern LINE_BUFFER *batch_readline_command(LINE_BUFFER *buffer, char * str); -extern char *batch_readline(LINE_BUFFER *buffer, bool *truncated); +extern char *batch_readline(LINE_BUFFER *buffer); extern void batch_readline_end(LINE_BUFFER *buffer); diff --git a/client/mysql.cc b/client/mysql.cc index dafe76a2401..b19aaf61e58 100644 --- a/client/mysql.cc +++ b/client/mysql.cc @@ -1872,14 +1872,13 @@ static int read_and_execute(bool interactive) ulong line_number=0; bool ml_comment= 0; COMMANDS *com; - bool truncated= 0; status.exit_status=1; - + for (;;) { if (!interactive) { - line=batch_readline(status.line_buff, &truncated); + line=batch_readline(status.line_buff); /* Skip UTF8 Byte Order Marker (BOM) 0xEFBBBF. Editors like "notepad" put this marker in @@ -1953,9 +1952,13 @@ static int read_and_execute(bool interactive) if (opt_outfile && line) fprintf(OUTFILE, "%s\n", line); } - if (!line) // End of file + // End of file or system error + if (!line) { - status.exit_status=0; + if (status.line_buff && status.line_buff->error) + status.exit_status= 1; + else + status.exit_status= 0; break; } @@ -1976,7 +1979,8 @@ static int read_and_execute(bool interactive) #endif continue; } - if (add_line(glob_buffer,line,&in_string,&ml_comment, truncated)) + if (add_line(glob_buffer, line, &in_string, &ml_comment, + status.line_buff ? status.line_buff->truncated : 0)) break; } /* if in batch mode, send last query even if it doesn't end with \g or go */ diff --git a/client/readline.cc b/client/readline.cc index b32cb71b0de..7f283502ecb 100644 --- a/client/readline.cc +++ b/client/readline.cc @@ -24,7 +24,7 @@ static bool init_line_buffer(LINE_BUFFER *buffer,File file,ulong size, ulong max_size); static bool init_line_buffer_from_string(LINE_BUFFER *buffer,char * str); static size_t fill_buffer(LINE_BUFFER *buffer); -static char *intern_read_line(LINE_BUFFER *buffer, ulong *out_length, bool *truncated); +static char *intern_read_line(LINE_BUFFER *buffer, ulong *out_length); LINE_BUFFER *batch_readline_init(ulong max_size,FILE *file) @@ -42,13 +42,12 @@ LINE_BUFFER *batch_readline_init(ulong max_size,FILE *file) } -char *batch_readline(LINE_BUFFER *line_buff, bool *truncated) +char *batch_readline(LINE_BUFFER *line_buff) { char *pos; ulong out_length; - DBUG_ASSERT(truncated != NULL); - if (!(pos=intern_read_line(line_buff,&out_length, truncated))) + if (!(pos=intern_read_line(line_buff, &out_length))) return 0; if (out_length && pos[out_length-1] == '\n') if (--out_length && pos[out_length-1] == '\r') /* Remove '\n' */ @@ -162,7 +161,10 @@ static size_t fill_buffer(LINE_BUFFER *buffer) if (!(buffer->buffer = (char*) my_realloc(buffer->buffer, buffer->bufread+1, MYF(MY_WME | MY_FAE)))) - return (uint) -1; + { + buffer->error= my_errno; + return (size_t) -1; + } buffer->start_of_line=buffer->buffer+start_offset; buffer->end=buffer->buffer+bufbytes; } @@ -177,7 +179,10 @@ static size_t fill_buffer(LINE_BUFFER *buffer) /* Read in new stuff. */ if ((read_count= my_read(buffer->file, (uchar*) buffer->end, read_count, MYF(MY_WME))) == MY_FILE_ERROR) + { + buffer->error= my_errno; return (size_t) -1; + } DBUG_PRINT("fill_buff", ("Got %lu bytes", (ulong) read_count)); @@ -198,8 +203,7 @@ static size_t fill_buffer(LINE_BUFFER *buffer) } - -char *intern_read_line(LINE_BUFFER *buffer, ulong *out_length, bool *truncated) +char *intern_read_line(LINE_BUFFER *buffer, ulong *out_length) { char *pos; size_t length; @@ -214,22 +218,25 @@ char *intern_read_line(LINE_BUFFER *buffer, ulong *out_length, bool *truncated) if (pos == buffer->end) { /* - fill_buffer() can return 0 either on EOF in which case we abort - or when the internal buffer has hit the size limit. In the latter case - return what we have read so far and signal string truncation. + fill_buffer() can return NULL on EOF (in which case we abort), + on error, or when the internal buffer has hit the size limit. + In the latter case return what we have read so far and signal + string truncation. */ - if (!(length=fill_buffer(buffer)) || length == (uint) -1) + if (!(length= fill_buffer(buffer))) { if (buffer->eof) DBUG_RETURN(0); } + else if (length == (size_t) -1) + DBUG_RETURN(NULL); else continue; pos--; /* break line here */ - *truncated= 1; + buffer->truncated= 1; } else - *truncated= 0; + buffer->truncated= 0; buffer->end_of_line=pos+1; *out_length=(ulong) (pos + 1 - buffer->eof - buffer->start_of_line); DBUG_RETURN(buffer->start_of_line); diff --git a/mysql-test/t/mysql.test b/mysql-test/t/mysql.test index 2dcc77a16c2..aa774036d10 100644 --- a/mysql-test/t/mysql.test +++ b/mysql-test/t/mysql.test @@ -412,6 +412,12 @@ drop table t1; --echo --exec $MYSQL --skip-column-names --vertical test -e "select 1 as a" +# +# Bug#57450: mysql client enter in an infinite loop if the standard input is a directory +# +--error 1 +--exec $MYSQL < . + --echo --echo # From e29b40f86fcd75c72eb622f3219fbe386d81b8aa Mon Sep 17 00:00:00 2001 From: Vinay Fisrekar Date: Mon, 7 Feb 2011 11:10:35 +0530 Subject: [PATCH 072/202] Bug#59955 - engines/funcs/ps_string_not_null test needs better cleanup Correcting clean up command at the start of test. --- .../engines/funcs/r/ps_string_not_null.result | Bin 11681 -> 11681 bytes .../engines/funcs/t/ps_string_not_null.test | 2 +- 2 files changed, 1 insertion(+), 1 deletion(-) diff --git a/mysql-test/suite/engines/funcs/r/ps_string_not_null.result b/mysql-test/suite/engines/funcs/r/ps_string_not_null.result index 859fab8b49074619ac3d54a1bf72e5754c120deb..5f2a630811ccb413f7685d39eaa7a6d43c8408b7 100644 GIT binary patch delta 14 VcmZ1&y)b%$*koo2v5h*Vx&SF)1mXYy delta 12 TcmZ1&y)b%$7^Bff@h)8eA7TVi diff --git a/mysql-test/suite/engines/funcs/t/ps_string_not_null.test b/mysql-test/suite/engines/funcs/t/ps_string_not_null.test index f9e937cb24d..662adfd7a88 100644 --- a/mysql-test/suite/engines/funcs/t/ps_string_not_null.test +++ b/mysql-test/suite/engines/funcs/t/ps_string_not_null.test @@ -1,5 +1,5 @@ --disable_warnings -DROP TABLE IF EXISTS t2; +DROP TABLE IF EXISTS t1; --enable_warnings CREATE TABLE t1(c1 CHAR(100) NOT NULL); PREPARE stmt1 FROM 'INSERT INTO t1 (c1) VALUES(?)'; From 165ed4f1a853568d7c4605434bae762a53dffdb3 Mon Sep 17 00:00:00 2001 From: Vasil Dimov Date: Mon, 7 Feb 2011 11:13:54 +0200 Subject: [PATCH 073/202] Use fun:* instead of obj:*/libz.so* because when the bundled zlib is used (--with-zlib-dir=bundled) then there is no libz.so involved. --- mysql-test/valgrind.supp | 8 ++++---- 1 file changed, 4 insertions(+), 4 deletions(-) diff --git a/mysql-test/valgrind.supp b/mysql-test/valgrind.supp index 367dc62898a..6078006abd7 100644 --- a/mysql-test/valgrind.supp +++ b/mysql-test/valgrind.supp @@ -748,8 +748,8 @@ { Bug 59874 Valgrind warning in InnoDB compression code Memcheck:Cond - obj:*/libz.so* - obj:*/libz.so* + fun:* + fun:* fun:deflate fun:btr_store_big_rec_extern_fields_func fun:row_ins_index_entry_low @@ -763,8 +763,8 @@ { In page0zip.c we have already checked that the memory is initialized before calling deflate() Memcheck:Cond - obj:*/libz.so* - obj:*/libz.so* + fun:* + fun:* fun:deflate fun:page_zip_compress fun:page_cur_insert_rec_zip_reorg From 221ce9223da6c386c4b904cd7b79ef02e7845882 Mon Sep 17 00:00:00 2001 From: Ole John Aske Date: Mon, 7 Feb 2011 10:36:21 +0100 Subject: [PATCH 074/202] Fix for bug#59308: Incorrect result for SELECT DISTINCT ... ORDER BY DESC. MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit Also fix bug#59110: Memory leak of QUICK_SELECT_I allocated memory. Includes Jørgen Lølands review comments. Root cause of these bugs are that test_if_skip_sort_order() decided to revert the 'skip_sort_order' descision (and use filesort) after the query plan has been updated to reflect a 'skip' of the sort order. This might happen in 'check_reverse_order:' if we have a select->quick which could not be made descending by appending a QUICK_SELECT_DESC. (). The original 'save_quick' was then restored after the QEP has been modified, which caused: - An incorrect 'precomputed_group_by= TRUE' may have been set, and not reverted, as part of the already modifified QEP (Bug#59308) - A 'select->quick' might have been created which we fail to delete (bug#59110). This fix is a refactorication of test_if_skip_sort_order() where all logic related to modification of QEP (controlled by argument 'bool no_changes'), is moved to the end of test_if_skip_sort_order(), and done after *all* 'test_if_skip' checks has been performed - including the 'check_reverse_order:' checks. The refactorication above contains now intentional changes to the logic which has been moved to the end of the function. Furthermore, a smaller part of the fix address the handling of the select->quick objects which may already exists when we call 'test_if_skip_sort_order()' (save_quick) -and new select->quick's created during test_if_skip_sort_order(): - Before new select->quick may be created by calling ::test_quick_select(), we set 'select->quick= 0' to avoid that ::test_quick_select() prematurely delete the save_quick's. (After this call we may have both a 'save_quick' and 'select->quick') - All returns from ::test_if_skip_sort_order() where we may have both a 'save_quick' and a 'select->quick' has been changed to goto's to the exit points 'skiped_sort_order:' or 'need_filesort:' where we decide which of the QUICK_SELECT's to keep, and delete the other. --- mysql-test/r/order_by.result | 25 ++++ mysql-test/t/order_by.test | 17 +++ sql/sql_select.cc | 231 +++++++++++++++++++++-------------- 3 files changed, 181 insertions(+), 92 deletions(-) diff --git a/mysql-test/r/order_by.result b/mysql-test/r/order_by.result index ba639fa9763..30879af418a 100644 --- a/mysql-test/r/order_by.result +++ b/mysql-test/r/order_by.result @@ -1638,4 +1638,29 @@ id select_type table type possible_keys key key_len ref rows Extra 1 SIMPLE t1 index NULL a 8 NULL 10 Using index; Using temporary; Using filesort 1 SIMPLE t2 eq_ref PRIMARY PRIMARY 4 test.t1.b 1 Using where DROP TABLE t1, t2; +# +# Bug #59110: Memory leak of QUICK_SELECT_I allocated memory +# and +# Bug #59308: Incorrect result for +SELECT DISTINCT ... ORDER BY DESC + +# Use Valgrind to detect #59110! +# +CREATE TABLE t1 (a INT,KEY (a)); +INSERT INTO t1 VALUES (1),(2),(3),(4),(5),(6),(7),(8),(9),(10); +EXPLAIN SELECT DISTINCT a,1 FROM t1 WHERE a <> 1 ORDER BY a DESC; +id select_type table type possible_keys key key_len ref rows Extra +1 SIMPLE t1 index a a 5 NULL 10 Using where; Using index; Using filesort +SELECT DISTINCT a,1 FROM t1 WHERE a <> 1 ORDER BY a DESC; +a 1 +10 1 +9 1 +8 1 +7 1 +6 1 +5 1 +4 1 +3 1 +2 1 +DROP TABLE t1; End of 5.1 tests diff --git a/mysql-test/t/order_by.test b/mysql-test/t/order_by.test index a8a6ad00648..1064320b65c 100644 --- a/mysql-test/t/order_by.test +++ b/mysql-test/t/order_by.test @@ -1492,4 +1492,21 @@ LIMIT 2; DROP TABLE t1, t2; +--echo # +--echo # Bug #59110: Memory leak of QUICK_SELECT_I allocated memory +--echo # and +--echo # Bug #59308: Incorrect result for +--echo SELECT DISTINCT ... ORDER BY DESC +--echo +--echo # Use Valgrind to detect #59110! +--echo # + +CREATE TABLE t1 (a INT,KEY (a)); +INSERT INTO t1 VALUES (1),(2),(3),(4),(5),(6),(7),(8),(9),(10); + +EXPLAIN SELECT DISTINCT a,1 FROM t1 WHERE a <> 1 ORDER BY a DESC; +SELECT DISTINCT a,1 FROM t1 WHERE a <> 1 ORDER BY a DESC; + +DROP TABLE t1; + --echo End of 5.1 tests diff --git a/sql/sql_select.cc b/sql/sql_select.cc index e080dc9370c..ba3008e0c38 100644 --- a/sql/sql_select.cc +++ b/sql/sql_select.cc @@ -13364,12 +13364,14 @@ test_if_skip_sort_order(JOIN_TAB *tab,ORDER *order,ha_rows select_limit, { int ref_key; uint ref_key_parts; - int order_direction; + int order_direction= 0; uint used_key_parts; TABLE *table=tab->table; SQL_SELECT *select=tab->select; key_map usable_keys; QUICK_SELECT_I *save_quick= 0; + int best_key= -1; + DBUG_ENTER("test_if_skip_sort_order"); LINT_INIT(ref_key_parts); @@ -13473,13 +13475,14 @@ test_if_skip_sort_order(JOIN_TAB *tab,ORDER *order,ha_rows select_limit, new_ref_key_map.clear_all(); // Force the creation of quick select new_ref_key_map.set_bit(new_ref_key); // only for new_ref_key. + select->quick= 0; if (select->test_quick_select(tab->join->thd, new_ref_key_map, 0, (tab->join->select_options & OPTION_FOUND_ROWS) ? HA_POS_ERROR : tab->join->unit->select_limit_cnt,0) <= 0) - DBUG_RETURN(0); + goto use_filesort; } ref_key= new_ref_key; } @@ -13504,7 +13507,6 @@ test_if_skip_sort_order(JOIN_TAB *tab,ORDER *order,ha_rows select_limit, int best_key_direction= 0; ha_rows best_records= 0; double read_time; - int best_key= -1; bool is_best_covering= FALSE; double fanout= 1; JOIN *join= tab->join; @@ -13681,72 +13683,21 @@ test_if_skip_sort_order(JOIN_TAB *tab,ORDER *order,ha_rows select_limit, tab->join->tables > tab->join->const_tables + 1) && ((unsigned) best_key != table->s->primary_key || !table->file->primary_key_is_clustered())) - DBUG_RETURN(0); + goto use_filesort; if (best_key >= 0) { - bool quick_created= FALSE; if (table->quick_keys.is_set(best_key) && best_key != ref_key) { key_map map; map.clear_all(); // Force the creation of quick select map.set_bit(best_key); // only best_key. - quick_created= - select->test_quick_select(join->thd, map, 0, - join->select_options & OPTION_FOUND_ROWS ? - HA_POS_ERROR : - join->unit->select_limit_cnt, - 0) > 0; - } - if (!no_changes) - { - /* - If ref_key used index tree reading only ('Using index' in EXPLAIN), - and best_key doesn't, then revert the decision. - */ - if (!table->covering_keys.is_set(best_key)) - table->set_keyread(FALSE); - if (!quick_created) - { - tab->index= best_key; - tab->read_first_record= best_key_direction > 0 ? - join_read_first:join_read_last; - tab->type=JT_NEXT; // Read with index_first(), index_next() - if (select && select->quick) - { - delete select->quick; - select->quick= 0; - } - if (table->covering_keys.is_set(best_key)) - table->set_keyread(TRUE); - table->file->ha_index_or_rnd_end(); - if (join->select_options & SELECT_DESCRIBE) - { - tab->ref.key= -1; - tab->ref.key_parts= 0; - if (select_limit < table_records) - tab->limit= select_limit; - } - } - else if (tab->type != JT_ALL) - { - /* - We're about to use a quick access to the table. - We need to change the access method so as the quick access - method is actually used. - */ - DBUG_ASSERT(tab->select->quick); - tab->type=JT_ALL; - tab->use_quick=1; - tab->ref.key= -1; - tab->ref.key_parts=0; // Don't use ref key. - tab->read_first_record= join_init_read_record; - if (tab->is_using_loose_index_scan()) - join->tmp_table_param.precomputed_group_by= TRUE; - /* - TODO: update the number of records in join->best_positions[tablenr] - */ - } + select->quick= 0; + select->test_quick_select(join->thd, map, 0, + join->select_options & OPTION_FOUND_ROWS ? + HA_POS_ERROR : + join->unit->select_limit_cnt, + 0); } order_direction= best_key_direction; /* @@ -13759,10 +13710,12 @@ test_if_skip_sort_order(JOIN_TAB *tab,ORDER *order,ha_rows select_limit, saved_best_key_parts : best_key_parts; } else - DBUG_RETURN(0); + goto use_filesort; } check_reverse_order: + DBUG_ASSERT(order_direction != 0); + if (order_direction == -1) // If ORDER BY ... DESC { if (select && select->quick) @@ -13771,9 +13724,10 @@ check_reverse_order: Don't reverse the sort order, if it's already done. (In some cases test_if_order_by_key() can be called multiple times */ - if (!select->quick->reverse_sorted()) + if (select->quick->reverse_sorted()) + goto skipped_filesort; + else { - QUICK_SELECT_DESC *tmp; int quick_type= select->quick->get_type(); if (quick_type == QUICK_SELECT_I::QS_TYPE_INDEX_MERGE || quick_type == QUICK_SELECT_I::QS_TYPE_ROR_INTERSECT || @@ -13781,39 +13735,132 @@ check_reverse_order: quick_type == QUICK_SELECT_I::QS_TYPE_GROUP_MIN_MAX) { tab->limit= 0; - select->quick= save_quick; - DBUG_RETURN(0); // Use filesort + goto use_filesort; // Use filesort } - - /* ORDER BY range_key DESC */ - tmp= new QUICK_SELECT_DESC((QUICK_RANGE_SELECT*)(select->quick), - used_key_parts); - if (!tmp || tmp->error) - { - delete tmp; - select->quick= save_quick; - tab->limit= 0; - DBUG_RETURN(0); // Reverse sort not supported - } - select->quick=tmp; } } - else if (tab->type != JT_NEXT && tab->type != JT_REF_OR_NULL && - tab->ref.key >= 0 && tab->ref.key_parts <= used_key_parts) - { - /* - SELECT * FROM t1 WHERE a=1 ORDER BY a DESC,b DESC - - Use a traversal function that starts by reading the last row - with key part (A) and then traverse the index backwards. - */ - tab->read_first_record= join_read_last_key; - tab->read_record.read_record= join_read_prev_same; - } } - else if (select && select->quick) - select->quick->sorted= 1; + + /* + Update query plan with access pattern for doing + ordered access according to what we have decided + above. + */ + if (!no_changes) // We are allowed to update QEP + { + if (best_key >= 0) + { + bool quick_created= + (select && select->quick && select->quick!=save_quick); + + /* + If ref_key used index tree reading only ('Using index' in EXPLAIN), + and best_key doesn't, then revert the decision. + */ + if (!table->covering_keys.is_set(best_key)) + table->set_keyread(FALSE); + if (!quick_created) + { + if (select) // Throw any existing quick select + select->quick= 0; // Cleanup either reset to save_quick, + // or 'delete save_quick' + tab->index= best_key; + tab->read_first_record= order_direction > 0 ? + join_read_first:join_read_last; + tab->type=JT_NEXT; // Read with index_first(), index_next() + + if (table->covering_keys.is_set(best_key)) + table->set_keyread(TRUE); + table->file->ha_index_or_rnd_end(); + if (tab->join->select_options & SELECT_DESCRIBE) + { + tab->ref.key= -1; + tab->ref.key_parts= 0; + if (select_limit < table->file->stats.records) + tab->limit= select_limit; + } + } + else if (tab->type != JT_ALL) + { + /* + We're about to use a quick access to the table. + We need to change the access method so as the quick access + method is actually used. + */ + DBUG_ASSERT(tab->select->quick); + tab->type=JT_ALL; + tab->use_quick=1; + tab->ref.key= -1; + tab->ref.key_parts=0; // Don't use ref key. + tab->read_first_record= join_init_read_record; + if (tab->is_using_loose_index_scan()) + tab->join->tmp_table_param.precomputed_group_by= TRUE; + /* + TODO: update the number of records in join->best_positions[tablenr] + */ + } + } // best_key >= 0 + + if (order_direction == -1) // If ORDER BY ... DESC + { + if (select && select->quick) + { + QUICK_SELECT_DESC *tmp; + /* ORDER BY range_key DESC */ + tmp= new QUICK_SELECT_DESC((QUICK_RANGE_SELECT*)(select->quick), + used_key_parts); + if (tmp && select->quick == save_quick) + save_quick= 0; // ::QUICK_SELECT_DESC consumed it + + if (!tmp || tmp->error) + { + delete tmp; + tab->limit= 0; + goto use_filesort; // Reverse sort failed -> filesort + } + select->quick= tmp; + } + else if (tab->type != JT_NEXT && tab->type != JT_REF_OR_NULL && + tab->ref.key >= 0 && tab->ref.key_parts <= used_key_parts) + { + /* + SELECT * FROM t1 WHERE a=1 ORDER BY a DESC,b DESC + + Use a traversal function that starts by reading the last row + with key part (A) and then traverse the index backwards. + */ + tab->read_first_record= join_read_last_key; + tab->read_record.read_record= join_read_prev_same; + } + } + else if (select && select->quick) + select->quick->sorted= 1; + + } // QEP has been modified + + /* + Cleanup: + We may have both a 'select->quick' and 'save_quick' (original) + at this point. Delete the one that we wan't use. + */ + +skipped_filesort: + // Keep current (ordered) select->quick + if (select && save_quick != select->quick) + { + delete save_quick; + save_quick= NULL; + } DBUG_RETURN(1); + +use_filesort: + // Restore original save_quick + if (select && select->quick != save_quick) + { + delete select->quick; + select->quick= save_quick; + } + DBUG_RETURN(0); } From b169b8d8530208f7655782841fdbe92a1b61f56d Mon Sep 17 00:00:00 2001 From: Dmitry Lenev Date: Mon, 7 Feb 2011 14:01:19 +0300 Subject: [PATCH 075/202] Fix for bug#36544 "DROP USER does not remove stored function privileges". The first problem was that DROP USER didn't properly remove privileges on stored functions from in-memory structures. So the dropped user could have called stored functions on which he had privileges before being dropped while his connection was still around. Even worse if a new user with the same name was created he would inherit privileges on stored functions from the dropped user. Similar thing happened with old user name and function privileges during RENAME USER. This problem stemmed from the fact that the handle_grant_data() function which handled DROP/RENAME USER didn't take any measures to update in-memory hash with information about function privileges after updating them on disk. This patch solves this problem by adding code doing just that. The second problem was that RENAME USER didn't properly update in-memory structures describing table-level privileges and privileges on stored procedures. As result such privileges could have been lost after a rename (i.e. not associated with the new name of user) and inherited by a new user with the same name as the old name of the original user. This problem was caused by code handling RENAME USER in handle_grant_struct() which [sic!]: a) tried to update wrong (tables) hash when updating stored procedure privileges for new user name. b) passed wrong arguments to function performing the hash update and didn't take into account the way in which such update could have changed the order of the hash elements. This patch solves this problem by ensuring that a) the correct hash is updated, b) correct arguments are used for the hash_update() function and c) we take into account possible changes in the order of hash elements. mysql-test/r/grant.result: Added test coverage for bug#36544 "DROP USER does not remove stored function privileges". mysql-test/suite/funcs_1/r/innodb_storedproc_06.result: Since after fixing bug#36544 "DROP USER does not remove stored function privileges" in-memory structures are correctly updated by DROP USER, DROP FUNCTION performed after DROP USER for its definer no longer produces unwarranted warning/error messages. mysql-test/suite/funcs_1/r/memory_storedproc_06.result: Since after fixing bug#36544 "DROP USER does not remove stored function privileges" in-memory structures are correctly updated by DROP USER, DROP FUNCTION performed after DROP USER for its definer no longer produces unwarranted warning/error messages. mysql-test/suite/funcs_1/r/myisam_storedproc_06.result: Since after fixing bug#36544 "DROP USER does not remove stored function privileges" in-memory structures are correctly updated by DROP USER, DROP FUNCTION performed after DROP USER for its definer no longer produces unwarranted warning/error messages. mysql-test/t/grant.test: Added test coverage for bug#36544 "DROP USER does not remove stored function privileges". sql/sql_acl.cc: Changed handle_grant_data() to also update hash with function privileges. This allows DROP/RENAME USER correctly keep this in-memory structure up-to-date. To do this extended handle_grant_struct() to support updating of this hash. In addition fixed code in this function which is responsible for handling of column and routine hashes during RENAME USER, ensured that we correctly update these hashes after changing user name and that we don't skip elements while iterating through the hash and doing updates. --- mysql-test/r/grant.result | 193 ++++++++++++++++++ .../funcs_1/r/innodb_storedproc_06.result | 4 - .../funcs_1/r/memory_storedproc_06.result | 4 - .../funcs_1/r/myisam_storedproc_06.result | 4 - mysql-test/t/grant.test | 177 ++++++++++++++++ sql/sql_acl.cc | 122 +++++++---- 6 files changed, 451 insertions(+), 53 deletions(-) diff --git a/mysql-test/r/grant.result b/mysql-test/r/grant.result index e7ae6612746..bce330d380f 100644 --- a/mysql-test/r/grant.result +++ b/mysql-test/r/grant.result @@ -1230,4 +1230,197 @@ DROP DATABASE mysqltest2; DROP USER testuser@localhost; use test; +# +# Test for bug #36544 "DROP USER does not remove stored function +# privileges". +# +create database mysqltest1; +create function mysqltest1.f1() returns int return 0; +create procedure mysqltest1.p1() begin end; +# +# 1) Check that DROP USER properly removes privileges on both +# stored procedures and functions. +# +create user mysqluser1@localhost; +grant execute on function mysqltest1.f1 to mysqluser1@localhost; +grant execute on procedure mysqltest1.p1 to mysqluser1@localhost; +# Quick test that granted privileges are properly reflected +# in privilege tables and in in-memory structures. +show grants for mysqluser1@localhost; +Grants for mysqluser1@localhost +GRANT USAGE ON *.* TO 'mysqluser1'@'localhost' +GRANT EXECUTE ON PROCEDURE `mysqltest1`.`p1` TO 'mysqluser1'@'localhost' +GRANT EXECUTE ON FUNCTION `mysqltest1`.`f1` TO 'mysqluser1'@'localhost' +select db, routine_name, routine_type, proc_priv from mysql.procs_priv where user='mysqluser1' and host='localhost'; +db routine_name routine_type proc_priv +mysqltest1 f1 FUNCTION Execute +mysqltest1 p1 PROCEDURE Execute +# +# Create connection 'bug_36544_con1' as 'mysqluser1@localhost'. +call mysqltest1.p1(); +select mysqltest1.f1(); +mysqltest1.f1() +0 +# +# Switch to connection 'default'. +drop user mysqluser1@localhost; +# +# Test that dropping of user is properly reflected in +# both privilege tables and in in-memory structures. +# +# Switch to connection 'bug36544_con1'. +# The connection cold be alive but should not be able to +# access to any of the stored routines. +call mysqltest1.p1(); +ERROR 42000: execute command denied to user 'mysqluser1'@'localhost' for routine 'mysqltest1.p1' +select mysqltest1.f1(); +ERROR 42000: execute command denied to user 'mysqluser1'@'localhost' for routine 'mysqltest1.f1' +# +# Switch to connection 'default'. +# +# Now create user with the same name and check that he +# has not inherited privileges. +create user mysqluser1@localhost; +show grants for mysqluser1@localhost; +Grants for mysqluser1@localhost +GRANT USAGE ON *.* TO 'mysqluser1'@'localhost' +select db, routine_name, routine_type, proc_priv from mysql.procs_priv where user='mysqluser1' and host='localhost'; +db routine_name routine_type proc_priv +# +# Create connection 'bug_36544_con2' as 'mysqluser1@localhost'. +# Newly created user should not be able to access any of the routines. +call mysqltest1.p1(); +ERROR 42000: execute command denied to user 'mysqluser1'@'localhost' for routine 'mysqltest1.p1' +select mysqltest1.f1(); +ERROR 42000: execute command denied to user 'mysqluser1'@'localhost' for routine 'mysqltest1.f1' +# +# Switch to connection 'default'. +# +# 2) Check that RENAME USER properly updates privileges on both +# stored procedures and functions. +# +grant execute on function mysqltest1.f1 to mysqluser1@localhost; +grant execute on procedure mysqltest1.p1 to mysqluser1@localhost; +# +# Create one more user to make in-memory hashes non-trivial. +# User names 'mysqluser11' and 'mysqluser10' were selected +# to trigger bug discovered during code inspection. +create user mysqluser11@localhost; +grant execute on function mysqltest1.f1 to mysqluser11@localhost; +grant execute on procedure mysqltest1.p1 to mysqluser11@localhost; +# Also create a couple of tables to test for another bug +# discovered during code inspection (again table names were +# chosen especially to trigger the bug). +create table mysqltest1.t11 (i int); +create table mysqltest1.t22 (i int); +grant select on mysqltest1.t22 to mysqluser1@localhost; +grant select on mysqltest1.t11 to mysqluser1@localhost; +# Quick test that granted privileges are properly reflected +# in privilege tables and in in-memory structures. +show grants for mysqluser1@localhost; +Grants for mysqluser1@localhost +GRANT USAGE ON *.* TO 'mysqluser1'@'localhost' +GRANT SELECT ON `mysqltest1`.`t11` TO 'mysqluser1'@'localhost' +GRANT SELECT ON `mysqltest1`.`t22` TO 'mysqluser1'@'localhost' +GRANT EXECUTE ON PROCEDURE `mysqltest1`.`p1` TO 'mysqluser1'@'localhost' +GRANT EXECUTE ON FUNCTION `mysqltest1`.`f1` TO 'mysqluser1'@'localhost' +select db, routine_name, routine_type, proc_priv from mysql.procs_priv where user='mysqluser1' and host='localhost'; +db routine_name routine_type proc_priv +mysqltest1 f1 FUNCTION Execute +mysqltest1 p1 PROCEDURE Execute +select db, table_name, table_priv from mysql.tables_priv where user='mysqluser1' and host='localhost'; +db table_name table_priv +mysqltest1 t11 Select +mysqltest1 t22 Select +# +# Switch to connection 'bug36544_con2'. +call mysqltest1.p1(); +select mysqltest1.f1(); +mysqltest1.f1() +0 +select * from mysqltest1.t11; +i +select * from mysqltest1.t22; +i +# +# Switch to connection 'default'. +rename user mysqluser1@localhost to mysqluser10@localhost; +# +# Test that there are no privileges left for mysqluser1. +# +# Switch to connection 'bug36544_con2'. +# The connection cold be alive but should not be able to +# access to any of the stored routines or tables. +call mysqltest1.p1(); +ERROR 42000: execute command denied to user 'mysqluser1'@'localhost' for routine 'mysqltest1.p1' +select mysqltest1.f1(); +ERROR 42000: execute command denied to user 'mysqluser1'@'localhost' for routine 'mysqltest1.f1' +select * from mysqltest1.t11; +ERROR 42000: SELECT command denied to user 'mysqluser1'@'localhost' for table 't11' +select * from mysqltest1.t22; +ERROR 42000: SELECT command denied to user 'mysqluser1'@'localhost' for table 't22' +# +# Switch to connection 'default'. +# +# Now create user with the old name and check that he +# has not inherited privileges. +create user mysqluser1@localhost; +show grants for mysqluser1@localhost; +Grants for mysqluser1@localhost +GRANT USAGE ON *.* TO 'mysqluser1'@'localhost' +select db, routine_name, routine_type, proc_priv from mysql.procs_priv where user='mysqluser1' and host='localhost'; +db routine_name routine_type proc_priv +select db, table_name, table_priv from mysql.tables_priv where user='mysqluser1' and host='localhost'; +db table_name table_priv +# +# Create connection 'bug_36544_con3' as 'mysqluser1@localhost'. +# Newly created user should not be able to access to any of the +# stored routines or tables. +call mysqltest1.p1(); +ERROR 42000: execute command denied to user 'mysqluser1'@'localhost' for routine 'mysqltest1.p1' +select mysqltest1.f1(); +ERROR 42000: execute command denied to user 'mysqluser1'@'localhost' for routine 'mysqltest1.f1' +select * from mysqltest1.t11; +ERROR 42000: SELECT command denied to user 'mysqluser1'@'localhost' for table 't11' +select * from mysqltest1.t22; +ERROR 42000: SELECT command denied to user 'mysqluser1'@'localhost' for table 't22' +# +# Switch to connection 'default'. +# +# Now check that privileges became associated with a new user +# name - mysqluser10. +# +show grants for mysqluser10@localhost; +Grants for mysqluser10@localhost +GRANT USAGE ON *.* TO 'mysqluser10'@'localhost' +GRANT SELECT ON `mysqltest1`.`t22` TO 'mysqluser10'@'localhost' +GRANT SELECT ON `mysqltest1`.`t11` TO 'mysqluser10'@'localhost' +GRANT EXECUTE ON PROCEDURE `mysqltest1`.`p1` TO 'mysqluser10'@'localhost' +GRANT EXECUTE ON FUNCTION `mysqltest1`.`f1` TO 'mysqluser10'@'localhost' +select db, routine_name, routine_type, proc_priv from mysql.procs_priv where user='mysqluser10' and host='localhost'; +db routine_name routine_type proc_priv +mysqltest1 f1 FUNCTION Execute +mysqltest1 p1 PROCEDURE Execute +select db, table_name, table_priv from mysql.tables_priv where user='mysqluser10' and host='localhost'; +db table_name table_priv +mysqltest1 t11 Select +mysqltest1 t22 Select +# +# Create connection 'bug_36544_con4' as 'mysqluser10@localhost'. +call mysqltest1.p1(); +select mysqltest1.f1(); +mysqltest1.f1() +0 +select * from mysqltest1.t11; +i +select * from mysqltest1.t22; +i +# +# Switch to connection 'default'. +# +# Clean-up. +drop user mysqluser1@localhost; +drop user mysqluser10@localhost; +drop user mysqluser11@localhost; +drop database mysqltest1; End of 5.0 tests diff --git a/mysql-test/suite/funcs_1/r/innodb_storedproc_06.result b/mysql-test/suite/funcs_1/r/innodb_storedproc_06.result index 88bddf68e24..41d9fb0a1c7 100644 --- a/mysql-test/suite/funcs_1/r/innodb_storedproc_06.result +++ b/mysql-test/suite/funcs_1/r/innodb_storedproc_06.result @@ -131,10 +131,6 @@ root@localhost db_storedproc_1 drop user 'user_1'@'localhost'; DROP PROCEDURE sp3; DROP FUNCTION fn1; -Warnings: -Error 1133 Can't find any matching row in the user table -Error 1269 Can't revoke all privileges for one or more of the requested users -Warning 1405 Failed to revoke all privileges to dropped routine Testcase 3.1.6.4: ----------------- diff --git a/mysql-test/suite/funcs_1/r/memory_storedproc_06.result b/mysql-test/suite/funcs_1/r/memory_storedproc_06.result index 88bddf68e24..41d9fb0a1c7 100644 --- a/mysql-test/suite/funcs_1/r/memory_storedproc_06.result +++ b/mysql-test/suite/funcs_1/r/memory_storedproc_06.result @@ -131,10 +131,6 @@ root@localhost db_storedproc_1 drop user 'user_1'@'localhost'; DROP PROCEDURE sp3; DROP FUNCTION fn1; -Warnings: -Error 1133 Can't find any matching row in the user table -Error 1269 Can't revoke all privileges for one or more of the requested users -Warning 1405 Failed to revoke all privileges to dropped routine Testcase 3.1.6.4: ----------------- diff --git a/mysql-test/suite/funcs_1/r/myisam_storedproc_06.result b/mysql-test/suite/funcs_1/r/myisam_storedproc_06.result index 88bddf68e24..41d9fb0a1c7 100644 --- a/mysql-test/suite/funcs_1/r/myisam_storedproc_06.result +++ b/mysql-test/suite/funcs_1/r/myisam_storedproc_06.result @@ -131,10 +131,6 @@ root@localhost db_storedproc_1 drop user 'user_1'@'localhost'; DROP PROCEDURE sp3; DROP FUNCTION fn1; -Warnings: -Error 1133 Can't find any matching row in the user table -Error 1269 Can't revoke all privileges for one or more of the requested users -Warning 1405 Failed to revoke all privileges to dropped routine Testcase 3.1.6.4: ----------------- diff --git a/mysql-test/t/grant.test b/mysql-test/t/grant.test index 21e3bbf5842..bf7b7ba4bb8 100644 --- a/mysql-test/t/grant.test +++ b/mysql-test/t/grant.test @@ -1267,6 +1267,183 @@ DROP USER testuser@localhost; use test; --echo + +--echo # +--echo # Test for bug #36544 "DROP USER does not remove stored function +--echo # privileges". +--echo # +create database mysqltest1; +create function mysqltest1.f1() returns int return 0; +create procedure mysqltest1.p1() begin end; +--echo # +--echo # 1) Check that DROP USER properly removes privileges on both +--echo # stored procedures and functions. +--echo # +create user mysqluser1@localhost; +grant execute on function mysqltest1.f1 to mysqluser1@localhost; +grant execute on procedure mysqltest1.p1 to mysqluser1@localhost; + +--echo # Quick test that granted privileges are properly reflected +--echo # in privilege tables and in in-memory structures. +show grants for mysqluser1@localhost; +select db, routine_name, routine_type, proc_priv from mysql.procs_priv where user='mysqluser1' and host='localhost'; +--echo # +--echo # Create connection 'bug_36544_con1' as 'mysqluser1@localhost'. +--connect (bug36544_con1,localhost,mysqluser1,,) +call mysqltest1.p1(); +select mysqltest1.f1(); + +--echo # +--echo # Switch to connection 'default'. +--connection default +drop user mysqluser1@localhost; + +--echo # +--echo # Test that dropping of user is properly reflected in +--echo # both privilege tables and in in-memory structures. +--echo # +--echo # Switch to connection 'bug36544_con1'. +--connection bug36544_con1 +--echo # The connection cold be alive but should not be able to +--echo # access to any of the stored routines. +--error ER_PROCACCESS_DENIED_ERROR +call mysqltest1.p1(); +--error ER_PROCACCESS_DENIED_ERROR +select mysqltest1.f1(); +--disconnect bug36544_con1 + +--echo # +--echo # Switch to connection 'default'. +--connection default +--echo # +--echo # Now create user with the same name and check that he +--echo # has not inherited privileges. +create user mysqluser1@localhost; +show grants for mysqluser1@localhost; +select db, routine_name, routine_type, proc_priv from mysql.procs_priv where user='mysqluser1' and host='localhost'; +--echo # +--echo # Create connection 'bug_36544_con2' as 'mysqluser1@localhost'. +--connect (bug36544_con2,localhost,mysqluser1,,) +--echo # Newly created user should not be able to access any of the routines. +--error ER_PROCACCESS_DENIED_ERROR +call mysqltest1.p1(); +--error ER_PROCACCESS_DENIED_ERROR +select mysqltest1.f1(); +--echo # +--echo # Switch to connection 'default'. +--connection default + +--echo # +--echo # 2) Check that RENAME USER properly updates privileges on both +--echo # stored procedures and functions. +--echo # +grant execute on function mysqltest1.f1 to mysqluser1@localhost; +grant execute on procedure mysqltest1.p1 to mysqluser1@localhost; +--echo # +--echo # Create one more user to make in-memory hashes non-trivial. +--echo # User names 'mysqluser11' and 'mysqluser10' were selected +--echo # to trigger bug discovered during code inspection. +create user mysqluser11@localhost; +grant execute on function mysqltest1.f1 to mysqluser11@localhost; +grant execute on procedure mysqltest1.p1 to mysqluser11@localhost; +--echo # Also create a couple of tables to test for another bug +--echo # discovered during code inspection (again table names were +--echo # chosen especially to trigger the bug). +create table mysqltest1.t11 (i int); +create table mysqltest1.t22 (i int); +grant select on mysqltest1.t22 to mysqluser1@localhost; +grant select on mysqltest1.t11 to mysqluser1@localhost; + +--echo # Quick test that granted privileges are properly reflected +--echo # in privilege tables and in in-memory structures. +show grants for mysqluser1@localhost; +select db, routine_name, routine_type, proc_priv from mysql.procs_priv where user='mysqluser1' and host='localhost'; +select db, table_name, table_priv from mysql.tables_priv where user='mysqluser1' and host='localhost'; +--echo # +--echo # Switch to connection 'bug36544_con2'. +--connection bug36544_con2 +call mysqltest1.p1(); +select mysqltest1.f1(); +select * from mysqltest1.t11; +select * from mysqltest1.t22; + +--echo # +--echo # Switch to connection 'default'. +--connection default +rename user mysqluser1@localhost to mysqluser10@localhost; + +--echo # +--echo # Test that there are no privileges left for mysqluser1. +--echo # +--echo # Switch to connection 'bug36544_con2'. +--connection bug36544_con2 +--echo # The connection cold be alive but should not be able to +--echo # access to any of the stored routines or tables. +--error ER_PROCACCESS_DENIED_ERROR +call mysqltest1.p1(); +--error ER_PROCACCESS_DENIED_ERROR +select mysqltest1.f1(); +--error ER_TABLEACCESS_DENIED_ERROR +select * from mysqltest1.t11; +--error ER_TABLEACCESS_DENIED_ERROR +select * from mysqltest1.t22; +--disconnect bug36544_con2 + +--echo # +--echo # Switch to connection 'default'. +--connection default +--echo # +--echo # Now create user with the old name and check that he +--echo # has not inherited privileges. +create user mysqluser1@localhost; +show grants for mysqluser1@localhost; +select db, routine_name, routine_type, proc_priv from mysql.procs_priv where user='mysqluser1' and host='localhost'; +select db, table_name, table_priv from mysql.tables_priv where user='mysqluser1' and host='localhost'; +--echo # +--echo # Create connection 'bug_36544_con3' as 'mysqluser1@localhost'. +--connect (bug36544_con3,localhost,mysqluser1,,) +--echo # Newly created user should not be able to access to any of the +--echo # stored routines or tables. +--error ER_PROCACCESS_DENIED_ERROR +call mysqltest1.p1(); +--error ER_PROCACCESS_DENIED_ERROR +select mysqltest1.f1(); +--error ER_TABLEACCESS_DENIED_ERROR +select * from mysqltest1.t11; +--error ER_TABLEACCESS_DENIED_ERROR +select * from mysqltest1.t22; +--disconnect bug36544_con3 + +--echo # +--echo # Switch to connection 'default'. +--connection default +--echo # +--echo # Now check that privileges became associated with a new user +--echo # name - mysqluser10. +--echo # +show grants for mysqluser10@localhost; +select db, routine_name, routine_type, proc_priv from mysql.procs_priv where user='mysqluser10' and host='localhost'; +select db, table_name, table_priv from mysql.tables_priv where user='mysqluser10' and host='localhost'; +--echo # +--echo # Create connection 'bug_36544_con4' as 'mysqluser10@localhost'. +--connect (bug36544_con4,localhost,mysqluser10,,) +call mysqltest1.p1(); +select mysqltest1.f1(); +select * from mysqltest1.t11; +select * from mysqltest1.t22; +--disconnect bug36544_con4 + +--echo # +--echo # Switch to connection 'default'. +--connection default +--echo # +--echo # Clean-up. +drop user mysqluser1@localhost; +drop user mysqluser10@localhost; +drop user mysqluser11@localhost; +drop database mysqltest1; + + --echo End of 5.0 tests disconnect master; diff --git a/sql/sql_acl.cc b/sql/sql_acl.cc index bf117874552..2484ad8edf4 100644 --- a/sql/sql_acl.cc +++ b/sql/sql_acl.cc @@ -1,4 +1,4 @@ -/* Copyright (C) 2000-2003 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by @@ -5048,18 +5048,15 @@ static int handle_grant_table(TABLE_LIST *tables, uint table_no, bool drop, } -/* +/** Handle an in-memory privilege structure. - SYNOPSIS - handle_grant_struct() - struct_no The number of the structure to handle (0..3). - drop If user_from is to be dropped. - user_from The the user to be searched/dropped/renamed. - user_to The new name for the user if to be renamed, - NULL otherwise. + @param struct_no The number of the structure to handle (0..4). + @param drop If user_from is to be dropped. + @param user_from The the user to be searched/dropped/renamed. + @param user_to The new name for the user if to be renamed, NULL otherwise. - DESCRIPTION + @note Scan through all elements in an in-memory grant structure and apply the requested operation. Delete from grant structure if drop is true. @@ -5069,12 +5066,12 @@ static int handle_grant_table(TABLE_LIST *tables, uint table_no, bool drop, 0 acl_users 1 acl_dbs 2 column_priv_hash - 3 procs_priv_hash + 3 proc_priv_hash + 4 func_priv_hash - RETURN - > 0 At least one element matched. - 0 OK, but no element matched. - -1 Wrong arguments to function + @retval > 0 At least one element matched. + @retval 0 OK, but no element matched. + @retval -1 Wrong arguments to function. */ static int handle_grant_struct(uint struct_no, bool drop, @@ -5088,6 +5085,7 @@ static int handle_grant_struct(uint struct_no, bool drop, ACL_USER *UNINIT_VAR(acl_user); ACL_DB *UNINIT_VAR(acl_db); GRANT_NAME *UNINIT_VAR(grant_name); + HASH *UNINIT_VAR(grant_name_hash); DBUG_ENTER("handle_grant_struct"); DBUG_PRINT("info",("scan struct: %u search: '%s'@'%s'", struct_no, user_from->user.str, user_from->host.str)); @@ -5104,9 +5102,15 @@ static int handle_grant_struct(uint struct_no, bool drop, break; case 2: elements= column_priv_hash.records; + grant_name_hash= &column_priv_hash; break; case 3: elements= proc_priv_hash.records; + grant_name_hash= &proc_priv_hash; + break; + case 4: + elements= func_priv_hash.records; + grant_name_hash= &func_priv_hash; break; default: return -1; @@ -5136,16 +5140,13 @@ static int handle_grant_struct(uint struct_no, bool drop, break; case 2: - grant_name= (GRANT_NAME*) hash_element(&column_priv_hash, idx); + case 3: + case 4: + grant_name= (GRANT_NAME*) hash_element(grant_name_hash, idx); user= grant_name->user; host= grant_name->host.hostname; break; - case 3: - grant_name= (GRANT_NAME*) hash_element(&proc_priv_hash, idx); - user= grant_name->user; - host= grant_name->host.hostname; - break; default: assert(0); } @@ -5176,14 +5177,25 @@ static int handle_grant_struct(uint struct_no, bool drop, break; case 2: - hash_delete(&column_priv_hash, (byte*) grant_name); - break; - case 3: - hash_delete(&proc_priv_hash, (byte*) grant_name); + case 4: + hash_delete(grant_name_hash, (byte*) grant_name); break; } elements--; + /* + - If we are iterating through an array then we just have moved all + elements after the current element one position closer to its head. + This means that we have to take another look at the element at + current position as it is a new element from the array's tail. + - If we are iterating through a hash the current element was replaced + with one of elements from the tail. So we also have to take a look + at the new element in current position. + Note that in our HASH implementation hash_delete() won't move any + elements with position after current one to position before the + current (i.e. from the tail to the head), so it is safe to continue + iteration without re-starting. + */ idx--; } else if ( user_to ) @@ -5201,22 +5213,41 @@ static int handle_grant_struct(uint struct_no, bool drop, case 2: case 3: - /* - Update the grant structure with the new user name and - host name - */ - grant_name->set_user_details(user_to->host.str, grant_name->db, - user_to->user.str, grant_name->tname, - TRUE); + case 4: + { + /* + Save old hash key and its length to be able properly update + element position in hash. + */ + char *old_key= grant_name->hash_key; + size_t old_key_length= grant_name->key_length; - /* - Since username is part of the hash key, when the user name - is renamed, the hash key is changed. Update the hash to - ensure that the position matches the new hash key value - */ - hash_update(&column_priv_hash, (byte*) grant_name, - (byte *) grant_name->hash_key, grant_name->key_length); - break; + /* + Update the grant structure with the new user name and host name. + */ + grant_name->set_user_details(user_to->host.str, grant_name->db, + user_to->user.str, grant_name->tname, + TRUE); + + /* + Since username is part of the hash key, when the user name + is renamed, the hash key is changed. Update the hash to + ensure that the position matches the new hash key value + */ + hash_update(grant_name_hash, (byte*) grant_name, (byte*) old_key, + old_key_length); + /* + hash_update() operation could have moved element from the tail + of the hash to the current position. So we need to take a look + at the element in current position once again. + Thanks to the fact that hash_update() for our HASH implementation + won't move any elements from the tail of the hash to the positions + before the current one (a.k.a. head) it is safe to continue + iteration without restarting. + */ + idx--; + break; + } } } else @@ -5302,7 +5333,7 @@ static int handle_grant_data(TABLE_LIST *tables, bool drop, } } - /* Handle procedures table. */ + /* Handle stored routines table. */ if ((found= handle_grant_table(tables, 4, drop, user_from, user_to)) < 0) { /* Handle of table failed, don't touch in-memory array. */ @@ -5319,6 +5350,15 @@ static int handle_grant_data(TABLE_LIST *tables, bool drop, if (! drop && ! user_to) goto end; } + /* Handle funcs array. */ + if (((handle_grant_struct(4, drop, user_from, user_to) && ! result) || + found) && ! result) + { + result= 1; /* At least one record/element found. */ + /* If search is requested, we do not need to search further. */ + if (! drop && ! user_to) + goto end; + } } /* Handle tables table. */ From 114ac525f22f9fcc2cc8df3906277f43ff487e2a Mon Sep 17 00:00:00 2001 From: Bjorn Munch Date: Mon, 7 Feb 2011 12:42:21 +0100 Subject: [PATCH 076/202] Bug #59979 Add mtr option to run debug server, but without turning on debug Added --debug-server and use $opt_debug_server where appropriate Let --debug imply --debug-server When merging to 5.5, must adapt fix for 59148 Oops, set debug => debug-server too late, fixed --- mysql-test/mysql-test-run.pl | 13 ++++++++++--- 1 file changed, 10 insertions(+), 3 deletions(-) diff --git a/mysql-test/mysql-test-run.pl b/mysql-test/mysql-test-run.pl index 27e52d814e4..502dff75b69 100755 --- a/mysql-test/mysql-test-run.pl +++ b/mysql-test/mysql-test-run.pl @@ -182,6 +182,7 @@ my $opt_cursor_protocol; my $opt_view_protocol; our $opt_debug; +our $opt_debug_server; our @opt_cases; # The test cases names in argv our $opt_embedded_server; @@ -936,6 +937,7 @@ sub command_line_setup { # Debugging 'debug' => \$opt_debug, + 'debug-server' => \$opt_debug_server, 'gdb' => \$opt_gdb, 'client-gdb' => \$opt_client_gdb, 'manual-gdb' => \$opt_manual_gdb, @@ -1082,6 +1084,9 @@ sub command_line_setup { my $path_share= dirname($path_language); $path_charsetsdir= mtr_path_exists("$path_share/charsets"); + # --debug implies we run debug server + $opt_debug_server= 1 if $opt_debug; + if (using_extern()) { # Connect to the running mysqld and find out what it supports @@ -1712,7 +1717,7 @@ sub find_mysqld { my @mysqld_names= ("mysqld", "mysqld-max-nt", "mysqld-max", "mysqld-nt"); - if ( $opt_debug ){ + if ( $opt_debug_server ){ # Put mysqld-debug first in the list of binaries to look for mtr_verbose("Adding mysqld-debug first in list of binaries to look for"); unshift(@mysqld_names, "mysqld-debug"); @@ -2402,9 +2407,9 @@ sub check_debug_support ($) { #mtr_report(" - binaries are not debug compiled"); $debug_compiled_binaries= 0; - if ( $opt_debug ) + if ( $opt_debug_server ) { - mtr_error("Can't use --debug, binaries does not support it"); + mtr_error("Can't use --debug[-server], binary does not support it"); } return; } @@ -5582,6 +5587,8 @@ Options for debugging the product client-gdb Start mysqltest client in gdb ddd Start mysqld in ddd debug Dump trace output for all servers and client programs + debug-server Use debug version of server, but without turning on + tracing debugger=NAME Start mysqld in the selected debugger gdb Start the mysqld(s) in gdb manual-debug Let user manually start mysqld in debugger, before From fe40394908ff018b4f6d0c2542152a90db875dfe Mon Sep 17 00:00:00 2001 From: Vasil Dimov Date: Mon, 7 Feb 2011 16:45:37 +0200 Subject: [PATCH 077/202] Backport the fix for Bug#59875 Valgrind warning in buf0buddy.c from 5.5 This warning also happens in 5.1 with a slightly different codepath. --- mysql-test/valgrind.supp | 13 +++++++++++++ 1 file changed, 13 insertions(+) diff --git a/mysql-test/valgrind.supp b/mysql-test/valgrind.supp index 6078006abd7..1983a8e6137 100644 --- a/mysql-test/valgrind.supp +++ b/mysql-test/valgrind.supp @@ -778,3 +778,16 @@ fun:row_ins_step fun:row_insert_for_mysql } + +{ + Bug 59875 Valgrind warning in buf0buddy.c + Memcheck:Addr1 + fun:mach_read_from_4 + fun:buf_buddy_relocate + fun:buf_buddy_free_low + fun:buf_buddy_free + fun:buf_LRU_block_remove_hashed_page + fun:buf_LRU_invalidate_tablespace + fun:fil_delete_tablespace + fun:row_drop_table_for_mysql +} From 12c68dbf164aa5b666acb09f02a14b51c941ad94 Mon Sep 17 00:00:00 2001 From: Anitha Gopi Date: Tue, 8 Feb 2011 11:30:35 +0530 Subject: [PATCH 078/202] Removed the collections for mysql-5.1-bugteam. Removed 1st from weekly. This is part of default suites --- mysql-test/collections/default.weekly | 1 - mysql-test/collections/mysql-5.1-bugteam.daily | 5 ----- mysql-test/collections/mysql-5.1-bugteam.push | 4 ---- 3 files changed, 10 deletions(-) delete mode 100644 mysql-test/collections/mysql-5.1-bugteam.daily delete mode 100644 mysql-test/collections/mysql-5.1-bugteam.push diff --git a/mysql-test/collections/default.weekly b/mysql-test/collections/default.weekly index f10bc0776a0..a2765bcaf0c 100755 --- a/mysql-test/collections/default.weekly +++ b/mysql-test/collections/default.weekly @@ -1,4 +1,3 @@ -perl mysql-test-run.pl --timer --force --comment=1st --experimental=collections/default.experimental 1st perl mysql-test-run.pl --timer --force --comment=big-tests --experimental=collections/default.experimental --vardir=var-big-tests --big-test --testcase-timeout=60 --suite-timeout=600 parts.partition_alter1_2_ndb parts.part_supported_sql_func_innodb parts.partition_alter1_2_innodb parts.partition_alter4_innodb parts.partition_alter1_1_2_ndb parts.partition_alter1_1_2_innodb parts.partition_alter1_1_ndb rpl_ndb.rpl_truncate_7ndb_2 main.archive-big main.sum_distinct-big main.mysqlbinlog_row_big main.alter_table-big main.variables-big main.type_newdecimal-big main.read_many_rows_innodb main.log_tables-big main.count_distinct3 main.events_time_zone main.merge-big main.create-big main.events_stress main.ssl-big funcs_1.myisam_views-big perl mysql-test-run.pl --timer --force --parallel=auto --comment=eits-tests-myisam-engine --experimental=collections/default.experimental --vardir=var-stmt-eits-tests-myisam-engine --suite=engines/iuds,engines/funcs --suite-timeout=500 --max-test-fail=0 --retry-failure=0 --mysqld=--default-storage-engine=myisam perl mysql-test-run.pl --timer --force --parallel=auto --comment=eits-rpl-binlog-row-tests-myisam-engine --experimental=collections/default.experimental --vardir=var-binlog-row-eits-tests-myisam-engine --suite=engines/iuds,engines/funcs --suite-timeout=500 --max-test-fail=0 --retry-failure=0 --mysqld=--default-storage-engine=myisam --do-test=rpl --mysqld=--binlog-format=row diff --git a/mysql-test/collections/mysql-5.1-bugteam.daily b/mysql-test/collections/mysql-5.1-bugteam.daily deleted file mode 100644 index 0503bd49f73..00000000000 --- a/mysql-test/collections/mysql-5.1-bugteam.daily +++ /dev/null @@ -1,5 +0,0 @@ -perl mysql-test-run.pl --timer --force --parallel=auto --comment=n_mix --vardir=var-n_mix --mysqld=--binlog-format=mixed --experimental=collections/default.experimental -perl mysql-test-run.pl --timer --force --parallel=auto --comment=ps_row --vardir=var-ps_row --ps-protocol --mysqld=--binlog-format=row --experimental=collections/default.experimental -perl mysql-test-run.pl --timer --force --parallel=auto --comment=embedded --vardir=var-emebbed --embedded --experimental=collections/default.experimental -perl mysql-test-run.pl --timer --force --parallel=auto --comment=rpl_binlog_row --vardir=var-rpl_binlog_row --suite=rpl,binlog --mysqld=--binlog-format=row --experimental=collections/default.experimental -perl mysql-test-run.pl --timer --force --parallel=auto --comment=funcs_1 --vardir=var-funcs_1 --suite=funcs_1 --experimental=collections/default.experimental diff --git a/mysql-test/collections/mysql-5.1-bugteam.push b/mysql-test/collections/mysql-5.1-bugteam.push deleted file mode 100644 index d01b98eb87f..00000000000 --- a/mysql-test/collections/mysql-5.1-bugteam.push +++ /dev/null @@ -1,4 +0,0 @@ -perl mysql-test-run.pl --timer --force --parallel=auto --comment=n_mix --vardir=var-n_mix --mysqld=--binlog-format=mixed --experimental=collections/default.experimental --skip-ndb -perl mysql-test-run.pl --timer --force --parallel=auto --comment=ps_row --vardir=var-ps_row --suite=main --ps-protocol --mysqld=--binlog-format=row --experimental=collections/default.experimental --skip-ndb -perl mysql-test-run.pl --timer --force --parallel=auto --comment=embedded --vardir=var-emebbed --suite=main --embedded --experimental=collections/default.experimental --skip-ndb -perl mysql-test-run.pl --timer --force --parallel=auto --comment=funcs_1 --vardir=var-funcs_1 --suite=funcs_1 --experimental=collections/default.experimental --skip-ndb From 994132add6118b8d91893d495a8cb628c1017da4 Mon Sep 17 00:00:00 2001 From: "John H. Embretsen" Date: Tue, 8 Feb 2011 10:51:09 +0100 Subject: [PATCH 079/202] Fix for Bug#59837 - mysqlhotcopy fails with wrong error (11) on specific platforms: Test failed on a certain Linux platform in automated environment. It turns out that this platform has an old version of Perl modules DBI and DBD::mysql installed, as well as the OS itself being relatively old. Allowing error code 11 to be returned from mysqlhotcopy on expected error seems harmless and will make the test pass also with older libraries. --- mysql-test/include/mysqlhotcopy.inc | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) diff --git a/mysql-test/include/mysqlhotcopy.inc b/mysql-test/include/mysqlhotcopy.inc index 110b0769ae1..fcf57a68644 100644 --- a/mysql-test/include/mysqlhotcopy.inc +++ b/mysql-test/include/mysqlhotcopy.inc @@ -107,7 +107,7 @@ DROP DATABASE hotcopy_save; --replace_result $MYSQLD_DATADIR MYSQLD_DATADIR --list_files $MYSQLD_DATADIR/hotcopy_save --replace_result $MASTER_MYSOCK MASTER_MYSOCK ---error 9,2304 +--error 9,11,2304 --exec $MYSQLHOTCOPY --quiet -S $MASTER_MYSOCK -u root hotcopy_test hotcopy_save --replace_result $MASTER_MYSOCK MASTER_MYSOCK --exec $MYSQLHOTCOPY --quiet --allowold -S $MASTER_MYSOCK -u root hotcopy_test hotcopy_save From 89621ad7387fb206023e8767b164ad6750d8e43b Mon Sep 17 00:00:00 2001 From: =?UTF-8?q?Marko=20M=C3=A4kel=C3=A4?= Date: Tue, 8 Feb 2011 12:56:23 +0200 Subject: [PATCH 080/202] Implement UNIV_BLOB_DEBUG. An early version of this caught Bug #55284. This option is known to be broken when tablespaces contain off-page columns after crash recovery. It has only been tested when creating the data files from the scratch. btr_blob_dbg_t: A map from page_no:heap_no:field_no to first_blob_page_no. This map is instantiated for every clustered index in index->blobs. It is protected by index->blobs_mutex. btr_blob_dbg_msg_issue(): Issue a diagnostic message. Invoked when btr_blob_dbg_msg is set. btr_blob_dbg_rbt_insert(): Insert a btr_blob_dbg_t into index->blobs. btr_blob_dbg_rbt_delete(): Remove a btr_blob_dbg_t from index->blobs. btr_blob_dbg_cmp(): Comparator for btr_blob_dbg_t. btr_blob_dbg_add_blob(): Add a BLOB reference to the map. btr_blob_dbg_add_rec(): Add all BLOB references from a record to the map. btr_blob_dbg_print(): Display the map of BLOB references in an index. btr_blob_dbg_remove_rec(): Remove all BLOB references of a record from the map. btr_blob_dbg_is_empty(): Check that no BLOB references exist to or from a page. Disowned references from delete-marked records are tolerated. btr_blob_dbg_op(): Perform an operation on all BLOB references on a B-tree page. btr_blob_dbg_add(): Add all BLOB references from a B-tree page to the map. btr_blob_dbg_remove(): Remove all BLOB references from a B-tree page from the map. btr_blob_dbg_restore(): Restore the BLOB references after a failed page reorganize. btr_blob_dbg_set_deleted_flag(): Modify the 'deleted' flag in the BLOB references of a record. btr_blob_dbg_owner(): Own or disown a BLOB reference. btr_page_create(), btr_page_free_low(): Assert that no BLOB references exist. btr_create(): Create index->blobs for clustered indexes. btr_page_reorganize_low(): Invoke btr_blob_dbg_remove() before copying the records. Invoke btr_blob_dbg_restore() if the operation fails. btr_page_empty(), btr_lift_page_up(), btr_compress(), btr_discard_page(): Invoke btr_blob_dbg_remove(). btr_cur_del_mark_set_clust_rec(): Invoke btr_blob_dbg_set_deleted_flag(). Other cases of modifying the delete mark are either in the secondary index or during crash recovery, which we do not promise to support. btr_cur_set_ownership_of_extern_field(): Invoke btr_blob_dbg_owner(). btr_store_big_rec_extern_fields(): Invoke btr_blob_dbg_add_blob(). btr_free_externally_stored_field(): Invoke btr_blob_dbg_assert_empty() on the first BLOB page. page_cur_insert_rec_low(), page_cur_insert_rec_zip(), page_copy_rec_list_end_to_created_page(): Invoke btr_blob_dbg_add_rec(). page_cur_insert_rec_zip_reorg(), page_copy_rec_list_end(), page_copy_rec_list_start(): After failure, invoke btr_blob_dbg_remove() and btr_blob_dbg_add(). page_cur_delete_rec(): Invoke btr_blob_dbg_remove_rec(). page_delete_rec_list_end(): Invoke btr_blob_dbg_op(btr_blob_dbg_remove_rec). page_zip_reorganize(): Invoke btr_blob_dbg_remove() before copying the records. page_zip_copy_recs(): Invoke btr_blob_dbg_add(). row_upd_rec_in_place(): Invoke btr_blob_dbg_rbt_delete() and btr_blob_dbg_rbt_insert(). innobase_start_or_create_for_mysql(): Warn when UNIV_BLOB_DEBUG is enabled. rb://550 approved by Jimmy Yang --- storage/innodb_plugin/btr/btr0btr.c | 571 ++++++++++++++++++++++ storage/innodb_plugin/btr/btr0cur.c | 44 ++ storage/innodb_plugin/dict/dict0mem.c | 9 + storage/innodb_plugin/include/btr0btr.h | 85 ++++ storage/innodb_plugin/include/btr0types.h | 125 +++++ storage/innodb_plugin/include/dict0mem.h | 7 + storage/innodb_plugin/include/page0zip.h | 2 +- storage/innodb_plugin/include/univ.i | 2 + storage/innodb_plugin/page/page0cur.c | 10 + storage/innodb_plugin/page/page0page.c | 11 + storage/innodb_plugin/page/page0zip.c | 5 +- storage/innodb_plugin/row/row0upd.c | 35 ++ storage/innodb_plugin/srv/srv0start.c | 6 + 13 files changed, 910 insertions(+), 2 deletions(-) diff --git a/storage/innodb_plugin/btr/btr0btr.c b/storage/innodb_plugin/btr/btr0btr.c index 3d8d6048603..46810c011c4 100644 --- a/storage/innodb_plugin/btr/btr0btr.c +++ b/storage/innodb_plugin/btr/btr0btr.c @@ -42,6 +42,560 @@ Created 6/2/1994 Heikki Tuuri #include "ibuf0ibuf.h" #include "trx0trx.h" +#ifdef UNIV_BLOB_DEBUG +# include "srv0srv.h" +# include "ut0rbt.h" + +/** TRUE when messages about index->blobs modification are enabled. */ +static ibool btr_blob_dbg_msg; + +/** Issue a message about an operation on index->blobs. +@param op operation +@param b the entry being subjected to the operation +@param ctx the context of the operation */ +#define btr_blob_dbg_msg_issue(op, b, ctx) \ + fprintf(stderr, op " %u:%u:%u->%u %s(%u,%u,%u)\n", \ + (b)->ref_page_no, (b)->ref_heap_no, \ + (b)->ref_field_no, (b)->blob_page_no, ctx, \ + (b)->owner, (b)->always_owner, (b)->del) + +/** Insert to index->blobs a reference to an off-page column. +@param index the index tree +@param b the reference +@param ctx context (for logging) */ +UNIV_INTERN +void +btr_blob_dbg_rbt_insert( +/*====================*/ + dict_index_t* index, /*!< in/out: index tree */ + const btr_blob_dbg_t* b, /*!< in: the reference */ + const char* ctx) /*!< in: context (for logging) */ +{ + if (btr_blob_dbg_msg) { + btr_blob_dbg_msg_issue("insert", b, ctx); + } + mutex_enter(&index->blobs_mutex); + rbt_insert(index->blobs, b, b); + mutex_exit(&index->blobs_mutex); +} + +/** Remove from index->blobs a reference to an off-page column. +@param index the index tree +@param b the reference +@param ctx context (for logging) */ +UNIV_INTERN +void +btr_blob_dbg_rbt_delete( +/*====================*/ + dict_index_t* index, /*!< in/out: index tree */ + const btr_blob_dbg_t* b, /*!< in: the reference */ + const char* ctx) /*!< in: context (for logging) */ +{ + if (btr_blob_dbg_msg) { + btr_blob_dbg_msg_issue("delete", b, ctx); + } + mutex_enter(&index->blobs_mutex); + ut_a(rbt_delete(index->blobs, b)); + mutex_exit(&index->blobs_mutex); +} + +/**************************************************************//** +Comparator for items (btr_blob_dbg_t) in index->blobs. +The key in index->blobs is (ref_page_no, ref_heap_no, ref_field_no). +@return negative, 0 or positive if *a<*b, *a=*b, *a>*b */ +static +int +btr_blob_dbg_cmp( +/*=============*/ + const void* a, /*!< in: first btr_blob_dbg_t to compare */ + const void* b) /*!< in: second btr_blob_dbg_t to compare */ +{ + const btr_blob_dbg_t* aa = a; + const btr_blob_dbg_t* bb = b; + + ut_ad(aa != NULL); + ut_ad(bb != NULL); + + if (aa->ref_page_no != bb->ref_page_no) { + return(aa->ref_page_no < bb->ref_page_no ? -1 : 1); + } + if (aa->ref_heap_no != bb->ref_heap_no) { + return(aa->ref_heap_no < bb->ref_heap_no ? -1 : 1); + } + if (aa->ref_field_no != bb->ref_field_no) { + return(aa->ref_field_no < bb->ref_field_no ? -1 : 1); + } + return(0); +} + +/**************************************************************//** +Add a reference to an off-page column to the index->blobs map. */ +UNIV_INTERN +void +btr_blob_dbg_add_blob( +/*==================*/ + const rec_t* rec, /*!< in: clustered index record */ + ulint field_no, /*!< in: off-page column number */ + ulint page_no, /*!< in: start page of the column */ + dict_index_t* index, /*!< in/out: index tree */ + const char* ctx) /*!< in: context (for logging) */ +{ + btr_blob_dbg_t b; + const page_t* page = page_align(rec); + + ut_a(index->blobs); + + b.blob_page_no = page_no; + b.ref_page_no = page_get_page_no(page); + b.ref_heap_no = page_rec_get_heap_no(rec); + b.ref_field_no = field_no; + ut_a(b.ref_field_no >= index->n_uniq); + b.always_owner = b.owner = TRUE; + b.del = FALSE; + ut_a(!rec_get_deleted_flag(rec, page_is_comp(page))); + btr_blob_dbg_rbt_insert(index, &b, ctx); +} + +/**************************************************************//** +Add to index->blobs any references to off-page columns from a record. +@return number of references added */ +UNIV_INTERN +ulint +btr_blob_dbg_add_rec( +/*=================*/ + const rec_t* rec, /*!< in: record */ + dict_index_t* index, /*!< in/out: index */ + const ulint* offsets,/*!< in: offsets */ + const char* ctx) /*!< in: context (for logging) */ +{ + ulint count = 0; + ulint i; + btr_blob_dbg_t b; + ibool del; + + ut_ad(rec_offs_validate(rec, index, offsets)); + + if (!rec_offs_any_extern(offsets)) { + return(0); + } + + b.ref_page_no = page_get_page_no(page_align(rec)); + b.ref_heap_no = page_rec_get_heap_no(rec); + del = (rec_get_deleted_flag(rec, rec_offs_comp(offsets)) != 0); + + for (i = 0; i < rec_offs_n_fields(offsets); i++) { + if (rec_offs_nth_extern(offsets, i)) { + ulint len; + const byte* field_ref = rec_get_nth_field( + rec, offsets, i, &len); + + ut_a(len != UNIV_SQL_NULL); + ut_a(len >= BTR_EXTERN_FIELD_REF_SIZE); + field_ref += len - BTR_EXTERN_FIELD_REF_SIZE; + + if (!memcmp(field_ref, field_ref_zero, + BTR_EXTERN_FIELD_REF_SIZE)) { + /* the column has not been stored yet */ + continue; + } + + b.ref_field_no = i; + b.blob_page_no = mach_read_from_4( + field_ref + BTR_EXTERN_PAGE_NO); + ut_a(b.ref_field_no >= index->n_uniq); + b.always_owner = b.owner + = !(field_ref[BTR_EXTERN_LEN] + & BTR_EXTERN_OWNER_FLAG); + b.del = del; + + btr_blob_dbg_rbt_insert(index, &b, ctx); + count++; + } + } + + return(count); +} + +/**************************************************************//** +Display the references to off-page columns. +This function is to be called from a debugger, +for example when a breakpoint on ut_dbg_assertion_failed is hit. */ +UNIV_INTERN +void +btr_blob_dbg_print( +/*===============*/ + const dict_index_t* index) /*!< in: index tree */ +{ + const ib_rbt_node_t* node; + + if (!index->blobs) { + return; + } + + /* We intentionally do not acquire index->blobs_mutex here. + This function is to be called from a debugger, and the caller + should make sure that the index->blobs_mutex is held. */ + + for (node = rbt_first(index->blobs); + node != NULL; node = rbt_next(index->blobs, node)) { + const btr_blob_dbg_t* b + = rbt_value(btr_blob_dbg_t, node); + fprintf(stderr, "%u:%u:%u->%u%s%s%s\n", + b->ref_page_no, b->ref_heap_no, b->ref_field_no, + b->blob_page_no, + b->owner ? "" : "(disowned)", + b->always_owner ? "" : "(has disowned)", + b->del ? "(deleted)" : ""); + } +} + +/**************************************************************//** +Remove from index->blobs any references to off-page columns from a record. +@return number of references removed */ +UNIV_INTERN +ulint +btr_blob_dbg_remove_rec( +/*====================*/ + const rec_t* rec, /*!< in: record */ + dict_index_t* index, /*!< in/out: index */ + const ulint* offsets,/*!< in: offsets */ + const char* ctx) /*!< in: context (for logging) */ +{ + ulint i; + ulint count = 0; + btr_blob_dbg_t b; + + ut_ad(rec_offs_validate(rec, index, offsets)); + + if (!rec_offs_any_extern(offsets)) { + return(0); + } + + b.ref_page_no = page_get_page_no(page_align(rec)); + b.ref_heap_no = page_rec_get_heap_no(rec); + + for (i = 0; i < rec_offs_n_fields(offsets); i++) { + if (rec_offs_nth_extern(offsets, i)) { + ulint len; + const byte* field_ref = rec_get_nth_field( + rec, offsets, i, &len); + + ut_a(len != UNIV_SQL_NULL); + ut_a(len >= BTR_EXTERN_FIELD_REF_SIZE); + field_ref += len - BTR_EXTERN_FIELD_REF_SIZE; + + b.ref_field_no = i; + b.blob_page_no = mach_read_from_4( + field_ref + BTR_EXTERN_PAGE_NO); + + switch (b.blob_page_no) { + case 0: + /* The column has not been stored yet. + The BLOB pointer must be all zero. + There cannot be a BLOB starting at + page 0, because page 0 is reserved for + the tablespace header. */ + ut_a(!memcmp(field_ref, field_ref_zero, + BTR_EXTERN_FIELD_REF_SIZE)); + /* fall through */ + case FIL_NULL: + /* the column has been freed already */ + continue; + } + + btr_blob_dbg_rbt_delete(index, &b, ctx); + count++; + } + } + + return(count); +} + +/**************************************************************//** +Check that there are no references to off-page columns from or to +the given page. Invoked when freeing or clearing a page. +@return TRUE when no orphan references exist */ +UNIV_INTERN +ibool +btr_blob_dbg_is_empty( +/*==================*/ + dict_index_t* index, /*!< in: index */ + ulint page_no) /*!< in: page number */ +{ + const ib_rbt_node_t* node; + ibool success = TRUE; + + if (!index->blobs) { + return(success); + } + + mutex_enter(&index->blobs_mutex); + + for (node = rbt_first(index->blobs); + node != NULL; node = rbt_next(index->blobs, node)) { + const btr_blob_dbg_t* b + = rbt_value(btr_blob_dbg_t, node); + + if (b->ref_page_no != page_no && b->blob_page_no != page_no) { + continue; + } + + fprintf(stderr, + "InnoDB: orphan BLOB ref%s%s%s %u:%u:%u->%u\n", + b->owner ? "" : "(disowned)", + b->always_owner ? "" : "(has disowned)", + b->del ? "(deleted)" : "", + b->ref_page_no, b->ref_heap_no, b->ref_field_no, + b->blob_page_no); + + if (b->blob_page_no != page_no || b->owner || !b->del) { + success = FALSE; + } + } + + mutex_exit(&index->blobs_mutex); + return(success); +} + +/**************************************************************//** +Count and process all references to off-page columns on a page. +@return number of references processed */ +UNIV_INTERN +ulint +btr_blob_dbg_op( +/*============*/ + const page_t* page, /*!< in: B-tree leaf page */ + const rec_t* rec, /*!< in: record to start from + (NULL to process the whole page) */ + dict_index_t* index, /*!< in/out: index */ + const char* ctx, /*!< in: context (for logging) */ + const btr_blob_dbg_op_f op) /*!< in: operation on records */ +{ + ulint count = 0; + mem_heap_t* heap = NULL; + ulint offsets_[REC_OFFS_NORMAL_SIZE]; + ulint* offsets = offsets_; + rec_offs_init(offsets_); + + ut_a(fil_page_get_type(page) == FIL_PAGE_INDEX); + ut_a(!rec || page_align(rec) == page); + + if (!index->blobs || !page_is_leaf(page) + || !dict_index_is_clust(index)) { + return(0); + } + + if (rec == NULL) { + rec = page_get_infimum_rec(page); + } + + do { + offsets = rec_get_offsets(rec, index, offsets, + ULINT_UNDEFINED, &heap); + count += op(rec, index, offsets, ctx); + rec = page_rec_get_next_const(rec); + } while (!page_rec_is_supremum(rec)); + + if (UNIV_LIKELY_NULL(heap)) { + mem_heap_free(heap); + } + + return(count); +} + +/**************************************************************//** +Count and add to index->blobs any references to off-page columns +from records on a page. +@return number of references added */ +UNIV_INTERN +ulint +btr_blob_dbg_add( +/*=============*/ + const page_t* page, /*!< in: rewritten page */ + dict_index_t* index, /*!< in/out: index */ + const char* ctx) /*!< in: context (for logging) */ +{ + btr_blob_dbg_assert_empty(index, page_get_page_no(page)); + + return(btr_blob_dbg_op(page, NULL, index, ctx, btr_blob_dbg_add_rec)); +} + +/**************************************************************//** +Count and remove from index->blobs any references to off-page columns +from records on a page. +Used when reorganizing a page, before copying the records. +@return number of references removed */ +UNIV_INTERN +ulint +btr_blob_dbg_remove( +/*================*/ + const page_t* page, /*!< in: b-tree page */ + dict_index_t* index, /*!< in/out: index */ + const char* ctx) /*!< in: context (for logging) */ +{ + ulint count; + + count = btr_blob_dbg_op(page, NULL, index, ctx, + btr_blob_dbg_remove_rec); + + /* Check that no references exist. */ + btr_blob_dbg_assert_empty(index, page_get_page_no(page)); + + return(count); +} + +/**************************************************************//** +Restore in index->blobs any references to off-page columns +Used when page reorganize fails due to compressed page overflow. */ +UNIV_INTERN +void +btr_blob_dbg_restore( +/*=================*/ + const page_t* npage, /*!< in: page that failed to compress */ + const page_t* page, /*!< in: copy of original page */ + dict_index_t* index, /*!< in/out: index */ + const char* ctx) /*!< in: context (for logging) */ +{ + ulint removed; + ulint added; + + ut_a(page_get_page_no(npage) == page_get_page_no(page)); + ut_a(page_get_space_id(npage) == page_get_space_id(page)); + + removed = btr_blob_dbg_remove(npage, index, ctx); + added = btr_blob_dbg_add(page, index, ctx); + ut_a(added == removed); +} + +/**************************************************************//** +Modify the 'deleted' flag of a record. */ +UNIV_INTERN +void +btr_blob_dbg_set_deleted_flag( +/*==========================*/ + const rec_t* rec, /*!< in: record */ + dict_index_t* index, /*!< in/out: index */ + const ulint* offsets,/*!< in: rec_get_offs(rec, index) */ + ibool del) /*!< in: TRUE=deleted, FALSE=exists */ +{ + const ib_rbt_node_t* node; + btr_blob_dbg_t b; + btr_blob_dbg_t* c; + ulint i; + + ut_ad(rec_offs_validate(rec, index, offsets)); + ut_a(dict_index_is_clust(index)); + ut_a(del == !!del);/* must be FALSE==0 or TRUE==1 */ + + if (!rec_offs_any_extern(offsets) || !index->blobs) { + + return; + } + + b.ref_page_no = page_get_page_no(page_align(rec)); + b.ref_heap_no = page_rec_get_heap_no(rec); + + for (i = 0; i < rec_offs_n_fields(offsets); i++) { + if (rec_offs_nth_extern(offsets, i)) { + ulint len; + const byte* field_ref = rec_get_nth_field( + rec, offsets, i, &len); + + ut_a(len != UNIV_SQL_NULL); + ut_a(len >= BTR_EXTERN_FIELD_REF_SIZE); + field_ref += len - BTR_EXTERN_FIELD_REF_SIZE; + + b.ref_field_no = i; + b.blob_page_no = mach_read_from_4( + field_ref + BTR_EXTERN_PAGE_NO); + + switch (b.blob_page_no) { + case 0: + ut_a(memcmp(field_ref, field_ref_zero, + BTR_EXTERN_FIELD_REF_SIZE)); + /* page number 0 is for the + page allocation bitmap */ + case FIL_NULL: + /* the column has been freed already */ + ut_error; + } + + mutex_enter(&index->blobs_mutex); + node = rbt_lookup(index->blobs, &b); + ut_a(node); + + c = rbt_value(btr_blob_dbg_t, node); + /* The flag should be modified. */ + c->del = del; + if (btr_blob_dbg_msg) { + b = *c; + mutex_exit(&index->blobs_mutex); + btr_blob_dbg_msg_issue("del_mk", &b, ""); + } else { + mutex_exit(&index->blobs_mutex); + } + } + } +} + +/**************************************************************//** +Change the ownership of an off-page column. */ +UNIV_INTERN +void +btr_blob_dbg_owner( +/*===============*/ + const rec_t* rec, /*!< in: record */ + dict_index_t* index, /*!< in/out: index */ + const ulint* offsets,/*!< in: rec_get_offs(rec, index) */ + ulint i, /*!< in: ith field in rec */ + ibool own) /*!< in: TRUE=owned, FALSE=disowned */ +{ + const ib_rbt_node_t* node; + btr_blob_dbg_t b; + const byte* field_ref; + ulint len; + + ut_ad(rec_offs_validate(rec, index, offsets)); + ut_a(rec_offs_nth_extern(offsets, i)); + + field_ref = rec_get_nth_field(rec, offsets, i, &len); + ut_a(len != UNIV_SQL_NULL); + ut_a(len >= BTR_EXTERN_FIELD_REF_SIZE); + field_ref += len - BTR_EXTERN_FIELD_REF_SIZE; + + b.ref_page_no = page_get_page_no(page_align(rec)); + b.ref_heap_no = page_rec_get_heap_no(rec); + b.ref_field_no = i; + b.owner = !(field_ref[BTR_EXTERN_LEN] & BTR_EXTERN_OWNER_FLAG); + b.blob_page_no = mach_read_from_4(field_ref + BTR_EXTERN_PAGE_NO); + + ut_a(b.owner == own); + + mutex_enter(&index->blobs_mutex); + node = rbt_lookup(index->blobs, &b); + /* row_ins_clust_index_entry_by_modify() invokes + btr_cur_unmark_extern_fields() also for the newly inserted + references, which are all zero bytes until the columns are stored. + The node lookup must fail if and only if that is the case. */ + ut_a(!memcmp(field_ref, field_ref_zero, BTR_EXTERN_FIELD_REF_SIZE) + == !node); + + if (node) { + btr_blob_dbg_t* c = rbt_value(btr_blob_dbg_t, node); + /* Some code sets ownership from TRUE to TRUE. + We do not allow changing ownership from FALSE to FALSE. */ + ut_a(own || c->owner); + + c->owner = own; + if (!own) { + c->always_owner = FALSE; + } + } + + mutex_exit(&index->blobs_mutex); +} +#endif /* UNIV_BLOB_DEBUG */ + /* Latching strategy of the InnoDB B-tree -------------------------------------- @@ -296,6 +850,7 @@ btr_page_create( page_t* page = buf_block_get_frame(block); ut_ad(mtr_memo_contains(mtr, block, MTR_MEMO_PAGE_X_FIX)); + btr_blob_dbg_assert_empty(index, buf_block_get_page_no(block)); if (UNIV_LIKELY_NULL(page_zip)) { page_create_zip(block, index, level, mtr); @@ -489,6 +1044,7 @@ btr_page_free_low( modify clock */ buf_block_modify_clock_inc(block); + btr_blob_dbg_assert_empty(index, buf_block_get_page_no(block)); if (dict_index_is_ibuf(index)) { @@ -773,6 +1329,13 @@ btr_create( block = buf_page_get(space, zip_size, page_no, RW_X_LATCH, mtr); } else { +#ifdef UNIV_BLOB_DEBUG + if ((type & DICT_CLUSTERED) && !index->blobs) { + mutex_create(&index->blobs_mutex, SYNC_ANY_LATCH); + index->blobs = rbt_create(sizeof(btr_blob_dbg_t), + btr_blob_dbg_cmp); + } +#endif /* UNIV_BLOB_DEBUG */ block = fseg_create(space, 0, PAGE_HEADER + PAGE_BTR_SEG_TOP, mtr); } @@ -996,6 +1559,7 @@ btr_page_reorganize_low( block->check_index_page_at_flush = TRUE; #endif /* !UNIV_HOTBACKUP */ + btr_blob_dbg_remove(page, index, "btr_page_reorganize"); /* Recreate the page: note that global data on page (possible segment headers, next page-field, etc.) is preserved intact */ @@ -1024,6 +1588,8 @@ btr_page_reorganize_low( (!page_zip_compress(page_zip, page, index, NULL))) { /* Restore the old page and exit. */ + btr_blob_dbg_restore(page, temp_page, index, + "btr_page_reorganize_compress_fail"); #if defined UNIV_DEBUG || defined UNIV_ZIP_DEBUG /* Check that the bytes that we skip are identical. */ @@ -1157,6 +1723,7 @@ btr_page_empty( #endif /* UNIV_ZIP_DEBUG */ btr_search_drop_page_hash_index(block); + btr_blob_dbg_remove(page, index, "btr_page_empty"); /* Recreate the page: note that global data on page (possible segment headers, next page-field, etc.) is preserved intact */ @@ -2497,6 +3064,7 @@ btr_lift_page_up( index); } + btr_blob_dbg_remove(page, index, "btr_lift_page_up"); lock_update_copy_and_discard(father_block, block); /* Go upward to root page, decrementing levels by one. */ @@ -2758,6 +3326,7 @@ err_exit: lock_update_merge_right(merge_block, orig_succ, block); } + btr_blob_dbg_remove(page, index, "btr_compress"); mem_heap_free(heap); if (!dict_index_is_clust(index) && page_is_leaf(merge_page)) { @@ -2988,6 +3557,8 @@ btr_discard_page( block); } + btr_blob_dbg_remove(page, index, "btr_discard_page"); + /* Free the file page */ btr_page_free(index, block, mtr); diff --git a/storage/innodb_plugin/btr/btr0cur.c b/storage/innodb_plugin/btr/btr0cur.c index 704cc606a5f..86d77c79e7b 100644 --- a/storage/innodb_plugin/btr/btr0cur.c +++ b/storage/innodb_plugin/btr/btr0cur.c @@ -2572,6 +2572,7 @@ btr_cur_del_mark_set_clust_rec( page_zip = buf_block_get_page_zip(block); + btr_blob_dbg_set_deleted_flag(rec, index, offsets, val); btr_rec_set_deleted_flag(rec, page_zip, val); trx = thr_get_trx(thr); @@ -3595,6 +3596,8 @@ btr_cur_set_ownership_of_extern_field( } else { mach_write_to_1(data + local_len + BTR_EXTERN_LEN, byte_val); } + + btr_blob_dbg_owner(rec, index, offsets, i, val); } /*******************************************************************//** @@ -4094,6 +4097,11 @@ btr_store_big_rec_extern_fields_func( } if (prev_page_no == FIL_NULL) { + btr_blob_dbg_add_blob( + rec, big_rec_vec->fields[i] + .field_no, page_no, index, + "store"); + mach_write_to_4(field_ref + BTR_EXTERN_SPACE_ID, space_id); @@ -4169,6 +4177,11 @@ next_zip_page: MLOG_4BYTES, &mtr); if (prev_page_no == FIL_NULL) { + btr_blob_dbg_add_blob( + rec, big_rec_vec->fields[i] + .field_no, page_no, index, + "store"); + mlog_write_ulint(field_ref + BTR_EXTERN_SPACE_ID, space_id, @@ -4337,6 +4350,37 @@ btr_free_externally_stored_field( rec_zip_size = 0; } +#ifdef UNIV_BLOB_DEBUG + if (!(field_ref[BTR_EXTERN_LEN] & BTR_EXTERN_OWNER_FLAG) + && !((field_ref[BTR_EXTERN_LEN] & BTR_EXTERN_INHERITED_FLAG) + && (rb_ctx == RB_NORMAL || rb_ctx == RB_RECOVERY))) { + /* This off-page column will be freed. + Check that no references remain. */ + + btr_blob_dbg_t b; + + b.blob_page_no = mach_read_from_4( + field_ref + BTR_EXTERN_PAGE_NO); + + if (rec) { + /* Remove the reference from the record to the + BLOB. If the BLOB were not freed, the + reference would be removed when the record is + removed. Freeing the BLOB will overwrite the + BTR_EXTERN_PAGE_NO in the field_ref of the + record with FIL_NULL, which would make the + btr_blob_dbg information inconsistent with the + record. */ + b.ref_page_no = page_get_page_no(page_align(rec)); + b.ref_heap_no = page_rec_get_heap_no(rec); + b.ref_field_no = i; + btr_blob_dbg_rbt_delete(index, &b, "free"); + } + + btr_blob_dbg_assert_empty(index, b.blob_page_no); + } +#endif /* UNIV_BLOB_DEBUG */ + for (;;) { #ifdef UNIV_SYNC_DEBUG buf_block_t* rec_block; diff --git a/storage/innodb_plugin/dict/dict0mem.c b/storage/innodb_plugin/dict/dict0mem.c index 3287247029f..aef815dd2f6 100644 --- a/storage/innodb_plugin/dict/dict0mem.c +++ b/storage/innodb_plugin/dict/dict0mem.c @@ -36,6 +36,9 @@ Created 1/8/1996 Heikki Tuuri #ifndef UNIV_HOTBACKUP # include "lock0lock.h" #endif /* !UNIV_HOTBACKUP */ +#ifdef UNIV_BLOB_DEBUG +# include "ut0rbt.h" +#endif /* UNIV_BLOB_DEBUG */ #define DICT_HEAP_SIZE 100 /*!< initial memory heap size when creating a table or index object */ @@ -316,6 +319,12 @@ dict_mem_index_free( { ut_ad(index); ut_ad(index->magic_n == DICT_INDEX_MAGIC_N); +#ifdef UNIV_BLOB_DEBUG + if (index->blobs) { + mutex_free(&index->blobs_mutex); + rbt_free(index->blobs); + } +#endif /* UNIV_BLOB_DEBUG */ mem_heap_free(index->heap); } diff --git a/storage/innodb_plugin/include/btr0btr.h b/storage/innodb_plugin/include/btr0btr.h index dde3a0bab69..5aa02694e0e 100644 --- a/storage/innodb_plugin/include/btr0btr.h +++ b/storage/innodb_plugin/include/btr0btr.h @@ -81,6 +81,91 @@ UNIQUE definition on secondary indexes when we decide if we can use the insert buffer to speed up inserts */ #define BTR_IGNORE_SEC_UNIQUE 2048 +#ifdef UNIV_BLOB_DEBUG +# include "ut0rbt.h" +/** An index->blobs entry for keeping track of off-page column references */ +struct btr_blob_dbg_struct +{ + unsigned blob_page_no:32; /*!< first BLOB page number */ + unsigned ref_page_no:32; /*!< referring page number */ + unsigned ref_heap_no:16; /*!< referring heap number */ + unsigned ref_field_no:10; /*!< referring field number */ + unsigned owner:1; /*!< TRUE if BLOB owner */ + unsigned always_owner:1; /*!< TRUE if always + has been the BLOB owner; + reset to TRUE on B-tree + page splits and merges */ + unsigned del:1; /*!< TRUE if currently + delete-marked */ +}; + +/**************************************************************//** +Add a reference to an off-page column to the index->blobs map. */ +UNIV_INTERN +void +btr_blob_dbg_add_blob( +/*==================*/ + const rec_t* rec, /*!< in: clustered index record */ + ulint field_no, /*!< in: number of off-page column */ + ulint page_no, /*!< in: start page of the column */ + dict_index_t* index, /*!< in/out: index tree */ + const char* ctx) /*!< in: context (for logging) */ + __attribute__((nonnull)); +/**************************************************************//** +Display the references to off-page columns. +This function is to be called from a debugger, +for example when a breakpoint on ut_dbg_assertion_failed is hit. */ +UNIV_INTERN +void +btr_blob_dbg_print( +/*===============*/ + const dict_index_t* index) /*!< in: index tree */ + __attribute__((nonnull)); +/**************************************************************//** +Check that there are no references to off-page columns from or to +the given page. Invoked when freeing or clearing a page. +@return TRUE when no orphan references exist */ +UNIV_INTERN +ibool +btr_blob_dbg_is_empty( +/*==================*/ + dict_index_t* index, /*!< in: index */ + ulint page_no) /*!< in: page number */ + __attribute__((nonnull, warn_unused_result)); + +/**************************************************************//** +Modify the 'deleted' flag of a record. */ +UNIV_INTERN +void +btr_blob_dbg_set_deleted_flag( +/*==========================*/ + const rec_t* rec, /*!< in: record */ + dict_index_t* index, /*!< in/out: index */ + const ulint* offsets,/*!< in: rec_get_offs(rec, index) */ + ibool del) /*!< in: TRUE=deleted, FALSE=exists */ + __attribute__((nonnull)); +/**************************************************************//** +Change the ownership of an off-page column. */ +UNIV_INTERN +void +btr_blob_dbg_owner( +/*===============*/ + const rec_t* rec, /*!< in: record */ + dict_index_t* index, /*!< in/out: index */ + const ulint* offsets,/*!< in: rec_get_offs(rec, index) */ + ulint i, /*!< in: ith field in rec */ + ibool own) /*!< in: TRUE=owned, FALSE=disowned */ + __attribute__((nonnull)); +/** Assert that there are no BLOB references to or from the given page. */ +# define btr_blob_dbg_assert_empty(index, page_no) \ + ut_a(btr_blob_dbg_is_empty(index, page_no)) +#else /* UNIV_BLOB_DEBUG */ +# define btr_blob_dbg_add_blob(rec, field_no, page, index, ctx) ((void) 0) +# define btr_blob_dbg_set_deleted_flag(rec, index, offsets, del)((void) 0) +# define btr_blob_dbg_owner(rec, index, offsets, i, val) ((void) 0) +# define btr_blob_dbg_assert_empty(index, page_no) ((void) 0) +#endif /* UNIV_BLOB_DEBUG */ + /**************************************************************//** Gets the root node of a tree and x-latches it. @return root page, x-latched */ diff --git a/storage/innodb_plugin/include/btr0types.h b/storage/innodb_plugin/include/btr0types.h index ef4a6b04b34..07c06fb18d7 100644 --- a/storage/innodb_plugin/include/btr0types.h +++ b/storage/innodb_plugin/include/btr0types.h @@ -38,6 +38,131 @@ typedef struct btr_cur_struct btr_cur_t; /** B-tree search information for the adaptive hash index */ typedef struct btr_search_struct btr_search_t; +#ifdef UNIV_BLOB_DEBUG +# include "buf0types.h" +/** An index->blobs entry for keeping track of off-page column references */ +typedef struct btr_blob_dbg_struct btr_blob_dbg_t; + +/** Insert to index->blobs a reference to an off-page column. +@param index the index tree +@param b the reference +@param ctx context (for logging) */ +UNIV_INTERN +void +btr_blob_dbg_rbt_insert( +/*====================*/ + dict_index_t* index, /*!< in/out: index tree */ + const btr_blob_dbg_t* b, /*!< in: the reference */ + const char* ctx) /*!< in: context (for logging) */ + __attribute__((nonnull)); + +/** Remove from index->blobs a reference to an off-page column. +@param index the index tree +@param b the reference +@param ctx context (for logging) */ +UNIV_INTERN +void +btr_blob_dbg_rbt_delete( +/*====================*/ + dict_index_t* index, /*!< in/out: index tree */ + const btr_blob_dbg_t* b, /*!< in: the reference */ + const char* ctx) /*!< in: context (for logging) */ + __attribute__((nonnull)); + +/**************************************************************//** +Add to index->blobs any references to off-page columns from a record. +@return number of references added */ +UNIV_INTERN +ulint +btr_blob_dbg_add_rec( +/*=================*/ + const rec_t* rec, /*!< in: record */ + dict_index_t* index, /*!< in/out: index */ + const ulint* offsets,/*!< in: offsets */ + const char* ctx) /*!< in: context (for logging) */ + __attribute__((nonnull)); +/**************************************************************//** +Remove from index->blobs any references to off-page columns from a record. +@return number of references removed */ +UNIV_INTERN +ulint +btr_blob_dbg_remove_rec( +/*====================*/ + const rec_t* rec, /*!< in: record */ + dict_index_t* index, /*!< in/out: index */ + const ulint* offsets,/*!< in: offsets */ + const char* ctx) /*!< in: context (for logging) */ + __attribute__((nonnull)); +/**************************************************************//** +Count and add to index->blobs any references to off-page columns +from records on a page. +@return number of references added */ +UNIV_INTERN +ulint +btr_blob_dbg_add( +/*=============*/ + const page_t* page, /*!< in: rewritten page */ + dict_index_t* index, /*!< in/out: index */ + const char* ctx) /*!< in: context (for logging) */ + __attribute__((nonnull)); +/**************************************************************//** +Count and remove from index->blobs any references to off-page columns +from records on a page. +Used when reorganizing a page, before copying the records. +@return number of references removed */ +UNIV_INTERN +ulint +btr_blob_dbg_remove( +/*================*/ + const page_t* page, /*!< in: b-tree page */ + dict_index_t* index, /*!< in/out: index */ + const char* ctx) /*!< in: context (for logging) */ + __attribute__((nonnull)); +/**************************************************************//** +Restore in index->blobs any references to off-page columns +Used when page reorganize fails due to compressed page overflow. */ +UNIV_INTERN +void +btr_blob_dbg_restore( +/*=================*/ + const page_t* npage, /*!< in: page that failed to compress */ + const page_t* page, /*!< in: copy of original page */ + dict_index_t* index, /*!< in/out: index */ + const char* ctx) /*!< in: context (for logging) */ + __attribute__((nonnull)); + +/** Operation that processes the BLOB references of an index record +@param[in] rec record on index page +@param[in/out] index the index tree of the record +@param[in] offsets rec_get_offsets(rec,index) +@param[in] ctx context (for logging) +@return number of BLOB references processed */ +typedef ulint (*btr_blob_dbg_op_f) +(const rec_t* rec,dict_index_t* index,const ulint* offsets,const char* ctx); + +/**************************************************************//** +Count and process all references to off-page columns on a page. +@return number of references processed */ +UNIV_INTERN +ulint +btr_blob_dbg_op( +/*============*/ + const page_t* page, /*!< in: B-tree leaf page */ + const rec_t* rec, /*!< in: record to start from + (NULL to process the whole page) */ + dict_index_t* index, /*!< in/out: index */ + const char* ctx, /*!< in: context (for logging) */ + const btr_blob_dbg_op_f op) /*!< in: operation on records */ + __attribute__((nonnull(1,3,4,5))); +#else /* UNIV_BLOB_DEBUG */ +# define btr_blob_dbg_add_rec(rec, index, offsets, ctx) ((void) 0) +# define btr_blob_dbg_add(page, index, ctx) ((void) 0) +# define btr_blob_dbg_remove_rec(rec, index, offsets, ctx) ((void) 0) +# define btr_blob_dbg_remove(page, index, ctx) ((void) 0) +# define btr_blob_dbg_restore(npage, page, index, ctx) ((void) 0) +# define btr_blob_dbg_op(page, rec, index, ctx, op) ((void) 0) +#endif /* UNIV_BLOB_DEBUG */ + /** The size of a reference to data stored on a different page. The reference is stored at the end of the prefix of the field in the index record. */ diff --git a/storage/innodb_plugin/include/dict0mem.h b/storage/innodb_plugin/include/dict0mem.h index 09a068ccb93..bd32a239cfd 100644 --- a/storage/innodb_plugin/include/dict0mem.h +++ b/storage/innodb_plugin/include/dict0mem.h @@ -340,6 +340,13 @@ struct dict_index_struct{ index, or 0 if the index existed when InnoDB was started up */ #endif /* !UNIV_HOTBACKUP */ +#ifdef UNIV_BLOB_DEBUG + mutex_t blobs_mutex; + /*!< mutex protecting blobs */ + void* blobs; /*!< map of (page_no,heap_no,field_no) + to first_blob_page_no; protected by + blobs_mutex; @see btr_blob_dbg_t */ +#endif /* UNIV_BLOB_DEBUG */ #ifdef UNIV_DEBUG ulint magic_n;/*!< magic number */ /** Value of dict_index_struct::magic_n */ diff --git a/storage/innodb_plugin/include/page0zip.h b/storage/innodb_plugin/include/page0zip.h index 574809e5227..00c1d0516e6 100644 --- a/storage/innodb_plugin/include/page0zip.h +++ b/storage/innodb_plugin/include/page0zip.h @@ -420,7 +420,7 @@ page_zip_copy_recs( const page_t* src, /*!< in: page */ dict_index_t* index, /*!< in: index of the B-tree */ mtr_t* mtr) /*!< in: mini-transaction */ - __attribute__((nonnull(1,2,3,4))); + __attribute__((nonnull)); #endif /* !UNIV_HOTBACKUP */ /**********************************************************************//** diff --git a/storage/innodb_plugin/include/univ.i b/storage/innodb_plugin/include/univ.i index 690bfd5d6a9..6dd38df3782 100644 --- a/storage/innodb_plugin/include/univ.i +++ b/storage/innodb_plugin/include/univ.i @@ -194,6 +194,8 @@ this will break redo log file compatibility, but it may be useful when debugging redo log application problems. */ #define UNIV_MEM_DEBUG /* detect memory leaks etc */ #define UNIV_IBUF_DEBUG /* debug the insert buffer */ +#define UNIV_BLOB_DEBUG /* track BLOB ownership; +assumes that no BLOBs survive server restart */ #define UNIV_IBUF_COUNT_DEBUG /* debug the insert buffer; this limits the database to IBUF_COUNT_N_SPACES and IBUF_COUNT_N_PAGES, and the insert buffer must be empty when the database is started */ diff --git a/storage/innodb_plugin/page/page0cur.c b/storage/innodb_plugin/page/page0cur.c index f10f16a7dd9..936762b986a 100644 --- a/storage/innodb_plugin/page/page0cur.c +++ b/storage/innodb_plugin/page/page0cur.c @@ -1149,6 +1149,8 @@ use_heap: current_rec, index, mtr); } + btr_blob_dbg_add_rec(insert_rec, index, offsets, "insert"); + return(insert_rec); } @@ -1195,10 +1197,12 @@ page_cur_insert_rec_zip_reorg( } /* Out of space: restore the page */ + btr_blob_dbg_remove(page, index, "insert_zip_fail"); if (!page_zip_decompress(page_zip, page, FALSE)) { ut_error; /* Memory corrupted? */ } ut_ad(page_validate(page, index)); + btr_blob_dbg_add(page, index, "insert_zip_fail"); return(NULL); } @@ -1490,6 +1494,8 @@ use_heap: page_zip_write_rec(page_zip, insert_rec, index, offsets, 1); + btr_blob_dbg_add_rec(insert_rec, index, offsets, "insert_zip_ok"); + /* 9. Write log record of the insert */ if (UNIV_LIKELY(mtr != NULL)) { page_cur_insert_rec_write_log(insert_rec, rec_size, @@ -1697,6 +1703,9 @@ page_copy_rec_list_end_to_created_page( heap_top += rec_size; + rec_offs_make_valid(insert_rec, index, offsets); + btr_blob_dbg_add_rec(insert_rec, index, offsets, "copy_end"); + page_cur_insert_rec_write_log(insert_rec, rec_size, prev_rec, index, mtr); prev_rec = insert_rec; @@ -1944,6 +1953,7 @@ page_cur_delete_rec( page_dir_slot_set_n_owned(cur_dir_slot, page_zip, cur_n_owned - 1); /* 6. Free the memory occupied by the record */ + btr_blob_dbg_remove_rec(current_rec, index, offsets, "delete"); page_mem_free(page, page_zip, current_rec, index, offsets); /* 7. Now we have decremented the number of owned records of the slot. diff --git a/storage/innodb_plugin/page/page0page.c b/storage/innodb_plugin/page/page0page.c index 10008f9ac25..6cae03e8829 100644 --- a/storage/innodb_plugin/page/page0page.c +++ b/storage/innodb_plugin/page/page0page.c @@ -685,12 +685,16 @@ page_copy_rec_list_end( if (UNIV_UNLIKELY (!page_zip_reorganize(new_block, index, mtr))) { + btr_blob_dbg_remove(new_page, index, + "copy_end_reorg_fail"); if (UNIV_UNLIKELY (!page_zip_decompress(new_page_zip, new_page, FALSE))) { ut_error; } ut_ad(page_validate(new_page, index)); + btr_blob_dbg_add(new_page, index, + "copy_end_reorg_fail"); return(NULL); } else { /* The page was reorganized: @@ -803,12 +807,16 @@ page_copy_rec_list_start( if (UNIV_UNLIKELY (!page_zip_reorganize(new_block, index, mtr))) { + btr_blob_dbg_remove(new_page, index, + "copy_start_reorg_fail"); if (UNIV_UNLIKELY (!page_zip_decompress(new_page_zip, new_page, FALSE))) { ut_error; } ut_ad(page_validate(new_page, index)); + btr_blob_dbg_add(new_page, index, + "copy_start_reorg_fail"); return(NULL); } else { /* The page was reorganized: @@ -1080,6 +1088,9 @@ page_delete_rec_list_end( /* Remove the record chain segment from the record chain */ page_rec_set_next(prev_rec, page_get_supremum_rec(page)); + btr_blob_dbg_op(page, rec, index, "delete_end", + btr_blob_dbg_remove_rec); + /* Catenate the deleted chain segment to the page free list */ page_rec_set_next(last_rec, page_header_get_ptr(page, PAGE_FREE)); diff --git a/storage/innodb_plugin/page/page0zip.c b/storage/innodb_plugin/page/page0zip.c index bb9b0995c72..a1dd4177ba8 100644 --- a/storage/innodb_plugin/page/page0zip.c +++ b/storage/innodb_plugin/page/page0zip.c @@ -4451,6 +4451,8 @@ page_zip_reorganize( /* Copy the old page to temporary space */ buf_frame_copy(temp_page, page); + btr_blob_dbg_remove(page, index, "zip_reorg"); + /* Recreate the page: note that global data on page (possible segment headers, next page-field, etc.) is preserved intact */ @@ -4509,7 +4511,7 @@ page_zip_copy_recs( mtr_t* mtr) /*!< in: mini-transaction */ { ut_ad(mtr_memo_contains_page(mtr, page, MTR_MEMO_PAGE_X_FIX)); - ut_ad(mtr_memo_contains_page(mtr, (page_t*) src, MTR_MEMO_PAGE_X_FIX)); + ut_ad(mtr_memo_contains_page(mtr, src, MTR_MEMO_PAGE_X_FIX)); ut_ad(!dict_index_is_ibuf(index)); #ifdef UNIV_ZIP_DEBUG /* The B-tree operations that call this function may set @@ -4579,6 +4581,7 @@ page_zip_copy_recs( #ifdef UNIV_ZIP_DEBUG ut_a(page_zip_validate(page_zip, page)); #endif /* UNIV_ZIP_DEBUG */ + btr_blob_dbg_add(page, index, "page_zip_copy_recs"); page_zip_compress_write_log(page_zip, page, index, mtr); } diff --git a/storage/innodb_plugin/row/row0upd.c b/storage/innodb_plugin/row/row0upd.c index 9ded3d68018..3a6de4b94a7 100644 --- a/storage/innodb_plugin/row/row0upd.c +++ b/storage/innodb_plugin/row/row0upd.c @@ -498,14 +498,49 @@ row_upd_rec_in_place( n_fields = upd_get_n_fields(update); for (i = 0; i < n_fields; i++) { +#ifdef UNIV_BLOB_DEBUG + btr_blob_dbg_t b; + const byte* field_ref = NULL; +#endif /* UNIV_BLOB_DEBUG */ + upd_field = upd_get_nth_field(update, i); new_val = &(upd_field->new_val); ut_ad(!dfield_is_ext(new_val) == !rec_offs_nth_extern(offsets, upd_field->field_no)); +#ifdef UNIV_BLOB_DEBUG + if (dfield_is_ext(new_val)) { + ulint len; + field_ref = rec_get_nth_field(rec, offsets, i, &len); + ut_a(len != UNIV_SQL_NULL); + ut_a(len >= BTR_EXTERN_FIELD_REF_SIZE); + field_ref += len - BTR_EXTERN_FIELD_REF_SIZE; + + b.ref_page_no = page_get_page_no(page_align(rec)); + b.ref_heap_no = page_rec_get_heap_no(rec); + b.ref_field_no = i; + b.blob_page_no = mach_read_from_4( + field_ref + BTR_EXTERN_PAGE_NO); + ut_a(b.ref_field_no >= index->n_uniq); + btr_blob_dbg_rbt_delete(index, &b, "upd_in_place"); + } +#endif /* UNIV_BLOB_DEBUG */ rec_set_nth_field(rec, offsets, upd_field->field_no, dfield_get_data(new_val), dfield_get_len(new_val)); + +#ifdef UNIV_BLOB_DEBUG + if (dfield_is_ext(new_val)) { + b.blob_page_no = mach_read_from_4( + field_ref + BTR_EXTERN_PAGE_NO); + b.always_owner = b.owner = !(field_ref[BTR_EXTERN_LEN] + & BTR_EXTERN_OWNER_FLAG); + b.del = rec_get_deleted_flag( + rec, rec_offs_comp(offsets)); + + btr_blob_dbg_rbt_insert(index, &b, "upd_in_place"); + } +#endif /* UNIV_BLOB_DEBUG */ } if (UNIV_LIKELY_NULL(page_zip)) { diff --git a/storage/innodb_plugin/srv/srv0start.c b/storage/innodb_plugin/srv/srv0start.c index 73f8f319704..f8b5049ca65 100644 --- a/storage/innodb_plugin/srv/srv0start.c +++ b/storage/innodb_plugin/srv/srv0start.c @@ -1061,6 +1061,12 @@ innobase_start_or_create_for_mysql(void) ); #endif +#ifdef UNIV_BLOB_DEBUG + fprintf(stderr, + "InnoDB: !!!!!!!! UNIV_BLOB_DEBUG switched on !!!!!!!!!\n" + "InnoDB: Server restart may fail with UNIV_BLOB_DEBUG\n"); +#endif /* UNIV_BLOB_DEBUG */ + #ifdef UNIV_SYNC_DEBUG fprintf(stderr, "InnoDB: !!!!!!!! UNIV_SYNC_DEBUG switched on !!!!!!!!!\n"); From c46e20f6c1275df5890838f92dc070fc7de99f63 Mon Sep 17 00:00:00 2001 From: Dmitry Shulga Date: Wed, 9 Feb 2011 12:46:12 +0600 Subject: [PATCH 081/202] Follow up fix for bug#57450. batch_readline_init() was modified - return an error if the input source is a directory or a block device. This follow-up is necessary because on some platforms, such as Solaris, call to read() from directory may be successful. --- client/mysql.cc | 2 ++ client/readline.cc | 8 ++++++++ 2 files changed, 10 insertions(+) diff --git a/client/mysql.cc b/client/mysql.cc index b19aaf61e58..e7e7b244a49 100644 --- a/client/mysql.cc +++ b/client/mysql.cc @@ -1131,6 +1131,8 @@ int main(int argc,char *argv[]) if (status.batch && !status.line_buff && !(status.line_buff= batch_readline_init(MAX_BATCH_BUFFER_SIZE, stdin))) { + put_info("Can't initialize batch_readline - may be the input source is " + "a directory or a block device.", INFO_ERROR, 0); free_defaults(defaults_argv); my_end(0); exit(1); diff --git a/client/readline.cc b/client/readline.cc index 7f283502ecb..9ac9ea5824e 100644 --- a/client/readline.cc +++ b/client/readline.cc @@ -18,6 +18,7 @@ #include #include #include +#include #include "my_readline.h" static bool init_line_buffer(LINE_BUFFER *buffer,File file,ulong size, @@ -30,6 +31,13 @@ static char *intern_read_line(LINE_BUFFER *buffer, ulong *out_length); LINE_BUFFER *batch_readline_init(ulong max_size,FILE *file) { LINE_BUFFER *line_buff; + MY_STAT input_file_stat; + + if (my_fstat(fileno(file), &input_file_stat, MYF(MY_WME)) || + MY_S_ISDIR(input_file_stat.st_mode) || + MY_S_ISBLK(input_file_stat.st_mode)) + return 0; + if (!(line_buff=(LINE_BUFFER*) my_malloc(sizeof(*line_buff),MYF(MY_WME | MY_ZEROFILL)))) return 0; From d9a768f7668f8935ec12fed5b3ede1ac354b7853 Mon Sep 17 00:00:00 2001 From: "John H. Embretsen" Date: Wed, 9 Feb 2011 10:50:09 +0100 Subject: [PATCH 082/202] Backport to 5.0: Fix for Bug#52060 - test udf fails on Snow Leopard. Reverse DNS lookup of "localhost" returns "broadcasthost" on Snow Leopard (Mac), and NULL on most others. Simply ignore the output, as this is not an essential part of UDF testing. --- mysql-test/r/udf.result | 2 -- mysql-test/t/udf.test | 7 +++++-- 2 files changed, 5 insertions(+), 4 deletions(-) diff --git a/mysql-test/r/udf.result b/mysql-test/r/udf.result index 92185962d1f..27cd8e640f3 100644 --- a/mysql-test/r/udf.result +++ b/mysql-test/r/udf.result @@ -40,8 +40,6 @@ ERROR HY000: Wrong number of arguments to reverse_lookup; Use the source select reverse_lookup("127.0.0.1"); select reverse_lookup(127,0,0,1); select reverse_lookup("localhost"); -reverse_lookup("localhost") -NULL select avgcost(); ERROR HY000: wrong number of arguments: AVGCOST() requires two arguments select avgcost(100,23.76); diff --git a/mysql-test/t/udf.test b/mysql-test/t/udf.test index 648494b3df9..3633c77be0d 100644 --- a/mysql-test/t/udf.test +++ b/mysql-test/t/udf.test @@ -51,14 +51,17 @@ select lookup("localhost"); --error 0 select reverse_lookup(); -# These two functions should return "localhost", but it's +# These two function calls should return "localhost", but it's # depending on configuration, so just call them and don't log the result --disable_result_log select reverse_lookup("127.0.0.1"); select reverse_lookup(127,0,0,1); + +# This function call may return different results depending on platform, +# so ignore results (see Bug#52060). +select reverse_lookup("localhost"); --enable_result_log -select reverse_lookup("localhost"); --error 0 select avgcost(); --error 0 From 960ae6da6a8195d1870e60d6eaf25c326f68b93a Mon Sep 17 00:00:00 2001 From: Dmitry Shulga Date: Wed, 9 Feb 2011 17:13:17 +0600 Subject: [PATCH 083/202] Follow up fix for bug#57450. batch_readline_init() was modified - make check for type of file for input stream unless target platform is WINDOWS since on this platform S_IFBLK is undefined. --- client/readline.cc | 2 ++ 1 file changed, 2 insertions(+) diff --git a/client/readline.cc b/client/readline.cc index 9ac9ea5824e..fb8cde577b5 100644 --- a/client/readline.cc +++ b/client/readline.cc @@ -33,10 +33,12 @@ LINE_BUFFER *batch_readline_init(ulong max_size,FILE *file) LINE_BUFFER *line_buff; MY_STAT input_file_stat; +#ifndef __WIN__ if (my_fstat(fileno(file), &input_file_stat, MYF(MY_WME)) || MY_S_ISDIR(input_file_stat.st_mode) || MY_S_ISBLK(input_file_stat.st_mode)) return 0; +#endif if (!(line_buff=(LINE_BUFFER*) my_malloc(sizeof(*line_buff),MYF(MY_WME | MY_ZEROFILL)))) From f5dab8c83b562882ec345a6cb97a7e3649fa0d80 Mon Sep 17 00:00:00 2001 From: unknown Date: Wed, 9 Feb 2011 19:02:38 +0100 Subject: [PATCH 084/202] Set version number for mysql-5.1.52sp1 release --- configure.in | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) diff --git a/configure.in b/configure.in index c1672557bd1..28ec04a4c42 100644 --- a/configure.in +++ b/configure.in @@ -12,7 +12,7 @@ dnl dnl When changing the major version number please also check the switch dnl statement in mysqlbinlog::check_master_version(). You may also need dnl to update version.c in ndb. -AC_INIT([MySQL Server], [5.1.52], [], [mysql]) +AC_INIT([MySQL Server], [5.1.52sp1], [], [mysql]) AC_CONFIG_SRCDIR([sql/mysqld.cc]) AC_CANONICAL_SYSTEM From d4549347efc8daf659f11c78bd9d945d9e0079b8 Mon Sep 17 00:00:00 2001 From: MySQL Build Team Date: Wed, 9 Feb 2011 21:03:17 +0100 Subject: [PATCH 085/202] Backport into build-201102032246-5.1.52sp1 > ------------------------------------------------------------ > revno: 1810.3987.43 > revision-id: alexander.nozdrin@oracle.com-20101122132749-tl6m39zsfgvzi2mf > parent: alexander.nozdrin@oracle.com-20101122132550-hcu608iuq5un9k0q > committer: Alexander Nozdrin > branch nick: mysql-5.0-bugteam > timestamp: Mon 2010-11-22 16:27:49 +0300 > message: > Patch for Bug#58340 (Remove Server GPL EXCEPTIONS-CLIENT file). --- EXCEPTIONS-CLIENT | 119 ---------------------------------------------- 1 file changed, 119 deletions(-) delete mode 100644 EXCEPTIONS-CLIENT diff --git a/EXCEPTIONS-CLIENT b/EXCEPTIONS-CLIENT deleted file mode 100644 index c570ff7ba24..00000000000 --- a/EXCEPTIONS-CLIENT +++ /dev/null @@ -1,119 +0,0 @@ -MySQL FLOSS License Exception - -The MySQL AB Exception for Free/Libre and Open Source -Software-only Applications Using MySQL Client Libraries (the -"FLOSS Exception"). - -Version 0.6, 7 March 2007 - -Exception Intent - -We want specified Free/Libre and Open Source Software (``FLOSS'') -applications to be able to use specified GPL-licensed MySQL client -libraries (the ``Program'') despite the fact that not all FLOSS -licenses are compatible with version 2 of the GNU General Public -License (the ``GPL''). - -Legal Terms and Conditions - -As a special exception to the terms and conditions of version 2.0 -of the GPL: - - 1. You are free to distribute a Derivative Work that is formed - entirely from the Program and one or more works (each, a - "FLOSS Work") licensed under one or more of the licenses - listed below in section 1, as long as: - a. You obey the GPL in all respects for the Program and the - Derivative Work, except for identifiable sections of the - Derivative Work which are not derived from the Program, - and which can reasonably be considered independent and - separate works in themselves, - b. all identifiable sections of the Derivative Work which - are not derived from the Program, and which can - reasonably be considered independent and separate works - in themselves, - i. are distributed subject to one of the FLOSS licenses - listed below, and - ii. the object code or executable form of those sections - are accompanied by the complete corresponding - machine-readable source code for those sections on - the same medium and under the same FLOSS license as - the corresponding object code or executable forms of - those sections, and - c. any works which are aggregated with the Program or with a - Derivative Work on a volume of a storage or distribution - medium in accordance with the GPL, can reasonably be - considered independent and separate works in themselves - which are not derivatives of either the Program, a - Derivative Work or a FLOSS Work. - If the above conditions are not met, then the Program may only - be copied, modified, distributed or used under the terms and - conditions of the GPL or another valid licensing option from - MySQL AB. - - 2. FLOSS License List - -License name Version(s)/Copyright Date -Academic Free License 2.0 -Apache Software License 1.0/1.1/2.0 -Apple Public Source License 2.0 -Artistic license From Perl 5.8.0 -BSD license "July 22 1999" -Common Development and Distribution License (CDDL) 1.0 -Common Public License 1.0 -Eclipse Public License 1.0 -GNU Library or "Lesser" General Public License (LGPL) 2.0/2.1 -Jabber Open Source License 1.0 -MIT license (As listed in file MIT-License.txt) --- -Mozilla Public License (MPL) 1.0/1.1 -Open Software License 2.0 -OpenSSL license (with original SSLeay license) "2003" ("1998") -PHP License 3.0 -Python license (CNRI Python License) --- -Python Software Foundation License 2.1.1 -Sleepycat License "1999" -University of Illinois/NCSA Open Source License --- -W3C License "2001" -X11 License "2001" -Zlib/libpng License --- -Zope Public License 2.0 - - Due to the many variants of some of the above licenses, we - require that any version follow the 2003 version of the Free - Software Foundation's Free Software Definition - (http://www.gnu.org/philosophy/free-sw.html) or version 1.9 of - the Open Source Definition by the Open Source Initiative - (http://www.opensource.org/docs/definition.php). - - 3. Definitions - - a. Terms used, but not defined, herein shall have the - meaning provided in the GPL. - b. Derivative Work means a derivative work under copyright - law. - - 4. Applicability: This FLOSS Exception applies to all Programs - that contain a notice placed by MySQL AB saying that the - Program may be distributed under the terms of this FLOSS - Exception. If you create or distribute a work which is a - Derivative Work of both the Program and any other work - licensed under the GPL, then this FLOSS Exception is not - available for that work; thus, you must remove the FLOSS - Exception notice from that work and comply with the GPL in all - respects, including by retaining all GPL notices. You may - choose to redistribute a copy of the Program exclusively under - the terms of the GPL by removing the FLOSS Exception notice - from that copy of the Program, provided that the copy has - never been modified by you or any third party. - -Appendix A. Qualified Libraries and Packages - -The following is a non-exhaustive list of libraries and packages -which are covered by the FLOSS License Exception. Please note that -this appendix is provided merely as an additional service to -specific FLOSS projects wishing to simplify licensing information -for their users. Compliance with one of the licenses noted under -the "FLOSS license list" section remains a prerequisite. - -Package Name Qualifying License and Version -Apache Portable Runtime (APR) Apache Software License 2.0 From 34812d0f099732d24d717e9a8a6ef13c4fe89abc Mon Sep 17 00:00:00 2001 From: MySQL Build Team Date: Wed, 9 Feb 2011 21:08:15 +0100 Subject: [PATCH 086/202] Backport into build-201102032246-5.1.52sp1 > ------------------------------------------------------------ > revno: 1810.3987.44 > revision-id: alexander.nozdrin@oracle.com-20101124095339-oatpqq684jpbbso2 > parent: alexander.nozdrin@oracle.com-20101122132749-tl6m39zsfgvzi2mf > committer: Alexander Nozdrin > branch nick: mysql-5.0-bugteam > timestamp: Wed 2010-11-24 12:53:39 +0300 > message: > A follow-up for Bug#58340 (Remove Server GPL EXCEPTIONS-CLIENT file) -- remove all > EXCEPTIONS-CLIENT from all the places. --- Makefile.am | 2 +- libmysql/Makefile.am | 3 +-- libmysql/Makefile.shared | 3 +-- libmysql/conf_to_src.c | 3 +-- libmysql/dll.c | 3 +-- libmysql/errmsg.c | 3 +-- libmysql/get_password.c | 3 +-- libmysql/libmysql.c | 3 +-- libmysql/manager.c | 3 +-- libmysql_r/Makefile.am | 3 +-- scripts/make_binary_distribution.sh | 2 +- scripts/make_win_bin_dist | 4 ++-- 12 files changed, 13 insertions(+), 22 deletions(-) diff --git a/Makefile.am b/Makefile.am index 4ce753ad8aa..eb44ca7bfd8 100644 --- a/Makefile.am +++ b/Makefile.am @@ -19,7 +19,7 @@ AUTOMAKE_OPTIONS = foreign # These are built from source in the Docs directory EXTRA_DIST = INSTALL-SOURCE INSTALL-WIN-SOURCE \ - README COPYING EXCEPTIONS-CLIENT CMakeLists.txt + README COPYING CMakeLists.txt SUBDIRS = . include @docs_dirs@ @zlib_dir@ \ @readline_topdir@ sql-common scripts \ diff --git a/libmysql/Makefile.am b/libmysql/Makefile.am index f67abfd8ac6..cb6b70b84d2 100644 --- a/libmysql/Makefile.am +++ b/libmysql/Makefile.am @@ -5,8 +5,7 @@ # published by the Free Software Foundation. # # There are special exceptions to the terms and conditions of the GPL as it -# is applied to this software. View the full text of the exception in file -# EXCEPTIONS-CLIENT in the directory of this software distribution. +# is applied to this software. # # This library is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of diff --git a/libmysql/Makefile.shared b/libmysql/Makefile.shared index 39c1975888a..a27949eb7ca 100644 --- a/libmysql/Makefile.shared +++ b/libmysql/Makefile.shared @@ -5,8 +5,7 @@ # published by the Free Software Foundation. # # There are special exceptions to the terms and conditions of the GPL as it -# is applied to this software. View the full text of the exception in file -# EXCEPTIONS-CLIENT in the directory of this software distribution. +# is applied to this software. # # This library is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of diff --git a/libmysql/conf_to_src.c b/libmysql/conf_to_src.c index 785e3cad4c1..f39a2e1856f 100644 --- a/libmysql/conf_to_src.c +++ b/libmysql/conf_to_src.c @@ -5,8 +5,7 @@ the Free Software Foundation. There are special exceptions to the terms and conditions of the GPL as it - is applied to this software. View the full text of the exception in file - EXCEPTIONS-CLIENT in the directory of this software distribution. + is applied to this software. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of diff --git a/libmysql/dll.c b/libmysql/dll.c index 8fcf41c792c..8654c035c63 100644 --- a/libmysql/dll.c +++ b/libmysql/dll.c @@ -5,8 +5,7 @@ the Free Software Foundation. There are special exceptions to the terms and conditions of the GPL as it - is applied to this software. View the full text of the exception in file - EXCEPTIONS-CLIENT in the directory of this software distribution. + is applied to this software. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of diff --git a/libmysql/errmsg.c b/libmysql/errmsg.c index 95ee6862aa8..163632127c3 100644 --- a/libmysql/errmsg.c +++ b/libmysql/errmsg.c @@ -5,8 +5,7 @@ the Free Software Foundation. There are special exceptions to the terms and conditions of the GPL as it - is applied to this software. View the full text of the exception in file - EXCEPTIONS-CLIENT in the directory of this software distribution. + is applied to this software. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of diff --git a/libmysql/get_password.c b/libmysql/get_password.c index cbe5fce6949..63d4e68541f 100644 --- a/libmysql/get_password.c +++ b/libmysql/get_password.c @@ -5,8 +5,7 @@ the Free Software Foundation. There are special exceptions to the terms and conditions of the GPL as it - is applied to this software. View the full text of the exception in file - EXCEPTIONS-CLIENT in the directory of this software distribution. + is applied to this software. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of diff --git a/libmysql/libmysql.c b/libmysql/libmysql.c index 8c612b6894e..4ecd976da3b 100644 --- a/libmysql/libmysql.c +++ b/libmysql/libmysql.c @@ -5,8 +5,7 @@ the Free Software Foundation. There are special exceptions to the terms and conditions of the GPL as it - is applied to this software. View the full text of the exception in file - EXCEPTIONS-CLIENT in the directory of this software distribution. + is applied to this software. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of diff --git a/libmysql/manager.c b/libmysql/manager.c index 53ffffa55c0..ef28f1bd323 100644 --- a/libmysql/manager.c +++ b/libmysql/manager.c @@ -5,8 +5,7 @@ the Free Software Foundation. There are special exceptions to the terms and conditions of the GPL as it - is applied to this software. View the full text of the exception in file - EXCEPTIONS-CLIENT in the directory of this software distribution. + is applied to this software. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of diff --git a/libmysql_r/Makefile.am b/libmysql_r/Makefile.am index 4a37dcfdec9..d4f0bea590b 100644 --- a/libmysql_r/Makefile.am +++ b/libmysql_r/Makefile.am @@ -5,8 +5,7 @@ # published by the Free Software Foundation. # # There are special exceptions to the terms and conditions of the GPL as it -# is applied to this software. View the full text of the exception in file -# EXCEPTIONS-CLIENT in the directory of this software distribution. +# is applied to this software. # # This library is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of diff --git a/scripts/make_binary_distribution.sh b/scripts/make_binary_distribution.sh index 79ad585b7d5..cd12e1ecbc5 100644 --- a/scripts/make_binary_distribution.sh +++ b/scripts/make_binary_distribution.sh @@ -381,7 +381,7 @@ copyfileto() copyfileto $BASE/docs ChangeLog Docs/mysql.info copyfileto $BASE COPYING COPYING.LIB README Docs/INSTALL-BINARY \ - EXCEPTIONS-CLIENT LICENSE.mysql + LICENSE.mysql # Non platform-specific bin dir files: BIN_FILES="extra/comp_err$BS extra/replace$BS extra/perror$BS \ diff --git a/scripts/make_win_bin_dist b/scripts/make_win_bin_dist index 22970c95ddd..ac500dded8f 100755 --- a/scripts/make_win_bin_dist +++ b/scripts/make_win_bin_dist @@ -187,8 +187,8 @@ cp ChangeLog $DESTDIR/Docs/ || /bin/true cp support-files/my-*.ini $DESTDIR/ if [ -f COPYING ] ; then - cp COPYING EXCEPTIONS-CLIENT $DESTDIR/ - cp COPYING $DESTDIR/Docs/ + cp COPYING $DESTDIR/ + cp COPYING $DESTDIR/Docs/ fi # ---------------------------------------------------------------------- From 17234d60885d7afc7025a2ecfa0e567095e1603c Mon Sep 17 00:00:00 2001 From: MySQL Build Team Date: Wed, 9 Feb 2011 21:10:07 +0100 Subject: [PATCH 087/202] Backport into build-201102032246-5.1.52sp1 > ------------------------------------------------------------ > revno: 3351.14.280 > revision-id: inaam.rana@oracle.com-20101026205418-aq835zpvxdskdf4c > parent: jimmy.yang@oracle.com-20101025055121-j319j363abfgdh6n > committer: Inaam Rana > branch nick: mysql-5.1-innodb > timestamp: Tue 2010-10-26 16:54:18 -0400 > message: > Bug #57611 ibdata file and continuous growing undo logs > rb://498 > > Fix handling of update_undo_logs at trx commit. Previously, when > rseg->update_undo_list grows beyond 500 the update_undo_logs were > marked with state TRX_UNDO_TO_FREE which should have been > TRX_UNDO_TO_PURGE. > > Approved by: Sunny Bains --- storage/innobase/trx/trx0undo.c | 18 ++++-------------- storage/innodb_plugin/trx/trx0undo.c | 18 ++++-------------- 2 files changed, 8 insertions(+), 28 deletions(-) diff --git a/storage/innobase/trx/trx0undo.c b/storage/innobase/trx/trx0undo.c index 4547ee9ea64..329565943c8 100644 --- a/storage/innobase/trx/trx0undo.c +++ b/storage/innobase/trx/trx0undo.c @@ -1752,21 +1752,11 @@ trx_undo_set_state_at_finish( if (undo->size == 1 && mach_read_from_2(page_hdr + TRX_UNDO_PAGE_FREE) - < TRX_UNDO_PAGE_REUSE_LIMIT) { + < TRX_UNDO_PAGE_REUSE_LIMIT + && UT_LIST_GET_LEN(rseg->update_undo_list) < 500 + && UT_LIST_GET_LEN(rseg->insert_undo_list) < 500) { - /* This is a heuristic to avoid the problem of all UNDO - slots ending up in one of the UNDO lists. Previously if - the server crashed with all the slots in one of the lists, - transactions that required the slots of a different type - would fail for lack of slots. */ - - if (UT_LIST_GET_LEN(rseg->update_undo_list) < 500 - && UT_LIST_GET_LEN(rseg->insert_undo_list) < 500) { - - state = TRX_UNDO_CACHED; - } else { - state = TRX_UNDO_TO_FREE; - } + state = TRX_UNDO_CACHED; } else if (undo->type == TRX_UNDO_INSERT) { diff --git a/storage/innodb_plugin/trx/trx0undo.c b/storage/innodb_plugin/trx/trx0undo.c index c8a4b15e48b..76e88948e41 100644 --- a/storage/innodb_plugin/trx/trx0undo.c +++ b/storage/innodb_plugin/trx/trx0undo.c @@ -1823,21 +1823,11 @@ trx_undo_set_state_at_finish( if (undo->size == 1 && mach_read_from_2(page_hdr + TRX_UNDO_PAGE_FREE) - < TRX_UNDO_PAGE_REUSE_LIMIT) { + < TRX_UNDO_PAGE_REUSE_LIMIT + && UT_LIST_GET_LEN(rseg->update_undo_list) < 500 + && UT_LIST_GET_LEN(rseg->insert_undo_list) < 500) { - /* This is a heuristic to avoid the problem of all UNDO - slots ending up in one of the UNDO lists. Previously if - the server crashed with all the slots in one of the lists, - transactions that required the slots of a different type - would fail for lack of slots. */ - - if (UT_LIST_GET_LEN(rseg->update_undo_list) < 500 - && UT_LIST_GET_LEN(rseg->insert_undo_list) < 500) { - - state = TRX_UNDO_CACHED; - } else { - state = TRX_UNDO_TO_FREE; - } + state = TRX_UNDO_CACHED; } else if (undo->type == TRX_UNDO_INSERT) { From aee322264fd86dd503939cfcff906e00d73bad1c Mon Sep 17 00:00:00 2001 From: MySQL Build Team Date: Wed, 9 Feb 2011 21:13:20 +0100 Subject: [PATCH 088/202] Backport into build-201102032246-5.1.52sp1 > ------------------------------------------------------------ > revno: 3452.13.4 [merge] > revision-id: mmakela@bk-internal.mysql.com-20101011192851-u3bdt7erjkrgn90t > parent: marko.makela@oracle.com-20101011081800-sby6kmb8n1mnryfq > parent: jimmy.yang@oracle.com-20101011123613-guz1qgdktywmel1g > committer: Marko Makela > branch nick: mysql-5.1-security > timestamp: Mon 2010-10-11 21:28:51 +0200 > message: > Merge Bug #57345, Bug #56982, Bug#53307 test from mysql-5.1-innodb > ------------------------------------------------------------ > Use --include-merges or -n0 to see merged revisions. --- mysql-test/t/disabled.def | 1 - storage/innodb_plugin/handler/ha_innodb.cc | 6 +++++- 2 files changed, 5 insertions(+), 2 deletions(-) diff --git a/mysql-test/t/disabled.def b/mysql-test/t/disabled.def index cede26f555a..bb931fb7b14 100644 --- a/mysql-test/t/disabled.def +++ b/mysql-test/t/disabled.def @@ -11,6 +11,5 @@ ############################################################################## kill : Bug#37780 2008-12-03 HHunger need some changes to be robust enough for pushbuild. query_cache_28249 : Bug#43861 2009-03-25 main.query_cache_28249 fails sporadically -partition_innodb_plugin : Bug#53307 2010-04-30 VasilDimov valgrind warnings main.mysqlhotcopy_myisam : bug#54129 2010-06-04 Horst main.mysqlhotcopy_archive: bug#54129 2010-06-04 Horst diff --git a/storage/innodb_plugin/handler/ha_innodb.cc b/storage/innodb_plugin/handler/ha_innodb.cc index 990d99b9cf4..350eb8ae026 100644 --- a/storage/innodb_plugin/handler/ha_innodb.cc +++ b/storage/innodb_plugin/handler/ha_innodb.cc @@ -9409,7 +9409,11 @@ ha_innobase::innobase_peek_autoinc(void) auto_inc = dict_table_autoinc_read(innodb_table); - ut_a(auto_inc > 0); + if (auto_inc == 0) { + ut_print_timestamp(stderr); + fprintf(stderr, " InnoDB: AUTOINC next value generation " + "is disabled for '%s'\n", innodb_table->name); + } dict_table_autoinc_unlock(innodb_table); From 9b656643810e858eea13fb0633d834580754ee46 Mon Sep 17 00:00:00 2001 From: MySQL Build Team Date: Wed, 9 Feb 2011 21:15:36 +0100 Subject: [PATCH 089/202] Backport into build-201102032246-5.1.52sp1 > ------------------------------------------------------------ > revno: 3452.13.54 > revision-id: oystein.grovlen@oracle.com-20110112093715-tc076voaxwblqk8v > parent: georgi.kodinov@oracle.com-20110110130833-1c9q21mr7zoq07vg > committer: Oystein Grovlen > branch nick: mysql-5.1-security > timestamp: Wed 2011-01-12 10:37:15 +0100 > message: > Bug#59211: Select Returns Different Value for min(year) Function > > get_year_value() contains code to convert 2-digits year to > 4-digits. The fix for Bug#49910 added a check on the size of > the underlying field so that this conversion is not done for > YEAR(4) values. (Since otherwise one would convert invalid > YEAR(4) values to valid ones.) > > The existing check does not work when Item_cache is used, since > it is not detected when the cache is based on a Field. The > reported change in behavior is due to Bug#58030 which added > extra cached items in min/max computations. > > The elegant solution would be to implement > Item_cache::real_item() to return the underlying Item. > However, some side effects are observed (change in explain > output) that indicates that such a change is not straight- > forward, and definitely not appropriate for an MRU. > > Instead, a Item_cache::field() method has been added in order > to get access to the underlying field. (This field() method > eliminates the need for Item_cache::eq_def() used in > test_if_ref(), but in order to limit the scope of this fix, > that code has been left as is.) --- mysql-test/r/type_year.result | 14 ++++++++++++++ mysql-test/t/type_year.test | 10 ++++++++++ sql/item.h | 13 ++++++++++--- sql/item_cmpfunc.cc | 9 ++++++--- 4 files changed, 40 insertions(+), 6 deletions(-) diff --git a/mysql-test/r/type_year.result b/mysql-test/r/type_year.result index 8948214f565..2dc491c6166 100644 --- a/mysql-test/r/type_year.result +++ b/mysql-test/r/type_year.result @@ -341,4 +341,18 @@ ta_y s tb_y s 2001 2001 2001 2001 DROP TABLE t1; # +# Bug #59211: Select Returns Different Value for min(year) Function +# +CREATE TABLE t1(c1 YEAR(4)); +INSERT INTO t1 VALUES (1901),(2155),(0000); +SELECT * FROM t1; +c1 +1901 +2155 +0000 +SELECT COUNT(*) AS total_rows, MIN(c1) AS min_value, MAX(c1) FROM t1; +total_rows min_value MAX(c1) +3 0 2155 +DROP TABLE t1; +# End of 5.1 tests diff --git a/mysql-test/t/type_year.test b/mysql-test/t/type_year.test index d8da4ccc82c..1a9e66478e1 100644 --- a/mysql-test/t/type_year.test +++ b/mysql-test/t/type_year.test @@ -149,6 +149,16 @@ SELECT ta.y AS ta_y, ta.s, tb.y AS tb_y, tb.s FROM t1 ta, t1 tb HAVING ta_y = tb DROP TABLE t1; +--echo # +--echo # Bug #59211: Select Returns Different Value for min(year) Function +--echo # + +CREATE TABLE t1(c1 YEAR(4)); +INSERT INTO t1 VALUES (1901),(2155),(0000); +SELECT * FROM t1; +SELECT COUNT(*) AS total_rows, MIN(c1) AS min_value, MAX(c1) FROM t1; +DROP TABLE t1; + --echo # --echo End of 5.1 tests diff --git a/sql/item.h b/sql/item.h index 57abb43010e..fd85fc780af 100644 --- a/sql/item.h +++ b/sql/item.h @@ -2960,11 +2960,10 @@ class Item_cache: public Item_basic_constant protected: Item *example; table_map used_table_map; - /* - Field that this object will get value from. This is set/used by + /** + Field that this object will get value from. This is used by index-based subquery engines to detect and remove the equality injected by IN->EXISTS transformation. - For all other uses of Item_cache, cached_field doesn't matter. */ Field *cached_field; enum enum_field_types cached_field_type; @@ -3021,6 +3020,14 @@ public: { return this == item; } + + /** + If this item caches a field value, return pointer to underlying field. + + @return Pointer to field, or NULL if this is not a cache for a field value. + */ + Field* field() { return cached_field; } + virtual void store(Item *item); virtual bool cache_value()= 0; }; diff --git a/sql/item_cmpfunc.cc b/sql/item_cmpfunc.cc index 6987dd9e053..8b8ee4a0054 100644 --- a/sql/item_cmpfunc.cc +++ b/sql/item_cmpfunc.cc @@ -1196,9 +1196,12 @@ get_year_value(THD *thd, Item ***item_arg, Item **cache_arg, value of 2000. */ Item *real_item= item->real_item(); - if (!(real_item->type() == Item::FIELD_ITEM && - ((Item_field *)real_item)->field->type() == MYSQL_TYPE_YEAR && - ((Item_field *)real_item)->field->field_length == 4)) + Field *field= NULL; + if (real_item->type() == Item::FIELD_ITEM) + field= ((Item_field *)real_item)->field; + else if (real_item->type() == Item::CACHE_ITEM) + field= ((Item_cache *)real_item)->field(); + if (!(field && field->type() == MYSQL_TYPE_YEAR && field->field_length == 4)) { if (value < 70) value+= 100; From f31cc126b8faf277529ec327baa1d0d3b8e8d049 Mon Sep 17 00:00:00 2001 From: MySQL Build Team Date: Wed, 9 Feb 2011 21:21:06 +0100 Subject: [PATCH 090/202] Backport into build-201102032246-5.1.52sp1 > ------------------------------------------------------------ > revno: 3452.17.1 > revision-id: mattias.jonsson@oracle.com-20101005125751-ds92svhhb13ds8ri > parent: sergey.glukhov@sun.com-20101004085126-ia6veky4w6j87i43 > committer: Mattias Jonsson > branch nick: b55091-51-security > timestamp: Tue 2010-10-05 14:57:51 +0200 > message: > Bug#55091: Server crashes on ADD PARTITION after a failed attempt > > In case of failure in ALTER ... PARTITION under LOCK TABLE > the server could crash, due to it had modified the locked > table object, which was not reverted in case of failure, > resulting in a bad table definition used after the failed > command. > > Solved by always closing the LOCKED TABLE, even in case > of error. > > Note: this is a 5.1-only fix, bug#56172 fixed it in 5.5+ --- mysql-test/r/partition_innodb_plugin.result | 73 +++++++++++++++++++++ mysql-test/t/partition_innodb_plugin.test | 66 +++++++++++++++++++ sql/sql_partition.cc | 21 +++++- 3 files changed, 159 insertions(+), 1 deletion(-) diff --git a/mysql-test/r/partition_innodb_plugin.result b/mysql-test/r/partition_innodb_plugin.result index dd91eee316a..f6b5ce84338 100644 --- a/mysql-test/r/partition_innodb_plugin.result +++ b/mysql-test/r/partition_innodb_plugin.result @@ -1,3 +1,76 @@ +call mtr.add_suppression("nnoDB: Error: table `test`.`t1` .* Partition.* InnoDB internal"); +# +# Bug#55091: Server crashes on ADD PARTITION after a failed attempt +# +SET @old_innodb_file_format_check = @@global.innodb_file_format_check; +SET @old_innodb_file_format = @@global.innodb_file_format; +SET @old_innodb_file_per_table = @@global.innodb_file_per_table; +SET @old_innodb_strict_mode = @@global.innodb_strict_mode; +SET @@global.innodb_file_format = Barracuda, +@@global.innodb_file_per_table = ON, +@@global.innodb_strict_mode = ON; +# Connection con1 +CREATE TABLE t1 (id INT NOT NULL +PRIMARY KEY, +user_num CHAR(10) +) ENGINE = InnoDB +KEY_BLOCK_SIZE=4 +PARTITION BY HASH(id) PARTITIONS 1; +t1#P#p0.ibd +t1.frm +t1.par +SHOW CREATE TABLE t1; +Table Create Table +t1 CREATE TABLE `t1` ( + `id` int(11) NOT NULL, + `user_num` char(10) DEFAULT NULL, + PRIMARY KEY (`id`) +) ENGINE=InnoDB DEFAULT CHARSET=latin1 KEY_BLOCK_SIZE=4 +/*!50100 PARTITION BY HASH (id) +PARTITIONS 1 */ +SET GLOBAL innodb_file_per_table = OFF; +# Connection con2 +LOCK TABLE t1 WRITE; +# ALTER fails because COMPRESSED/KEY_BLOCK_SIZE +# are incompatible with innodb_file_per_table = OFF; +ALTER TABLE t1 ADD PARTITION PARTITIONS 1; +ERROR HY000: Got error 1478 from storage engine +t1#P#p0.ibd +t1.frm +t1.par +# This SET is not needed to reproduce the bug, +# it is here just to make the test case more realistic +SET innodb_strict_mode = OFF; +ALTER TABLE t1 ADD PARTITION PARTITIONS 2; +Warnings: +Warning 1478 InnoDB: KEY_BLOCK_SIZE requires innodb_file_per_table. +Warning 1478 InnoDB: ignoring KEY_BLOCK_SIZE=4. +Warning 1478 InnoDB: KEY_BLOCK_SIZE requires innodb_file_per_table. +Warning 1478 InnoDB: ignoring KEY_BLOCK_SIZE=4. +Warning 1478 InnoDB: KEY_BLOCK_SIZE requires innodb_file_per_table. +Warning 1478 InnoDB: ignoring KEY_BLOCK_SIZE=4. +t1.frm +t1.par +ALTER TABLE t1 REBUILD PARTITION p0; +Warnings: +Warning 1478 InnoDB: KEY_BLOCK_SIZE requires innodb_file_per_table. +Warning 1478 InnoDB: ignoring KEY_BLOCK_SIZE=4. +UNLOCK TABLES; +SHOW CREATE TABLE t1; +Table Create Table +t1 CREATE TABLE `t1` ( + `id` int(11) NOT NULL, + `user_num` char(10) DEFAULT NULL, + PRIMARY KEY (`id`) +) ENGINE=InnoDB DEFAULT CHARSET=latin1 KEY_BLOCK_SIZE=4 +/*!50100 PARTITION BY HASH (id) +PARTITIONS 3 */ +DROP TABLE t1; +# Connection default +SET @@global.innodb_strict_mode = @old_innodb_strict_mode; +SET @@global.innodb_file_format = @old_innodb_file_format; +SET @@global.innodb_file_per_table = @old_innodb_file_per_table; +SET @@global.innodb_file_format_check = @old_innodb_file_format_check; SET NAMES utf8; CREATE TABLE `t``\""e` (a INT, PRIMARY KEY (a)) ENGINE=InnoDB diff --git a/mysql-test/t/partition_innodb_plugin.test b/mysql-test/t/partition_innodb_plugin.test index eeb990c0d81..114adf67180 100644 --- a/mysql-test/t/partition_innodb_plugin.test +++ b/mysql-test/t/partition_innodb_plugin.test @@ -1,5 +1,71 @@ --source include/have_partition.inc --source include/have_innodb_plugin.inc +# Remove the line below when bug#53307 is solved. +--source include/not_valgrind.inc + +let $MYSQLD_DATADIR= `SELECT @@datadir`; + +call mtr.add_suppression("nnoDB: Error: table `test`.`t1` .* Partition.* InnoDB internal"); +--echo # +--echo # Bug#55091: Server crashes on ADD PARTITION after a failed attempt +--echo # +SET @old_innodb_file_format_check = @@global.innodb_file_format_check; +SET @old_innodb_file_format = @@global.innodb_file_format; +SET @old_innodb_file_per_table = @@global.innodb_file_per_table; +SET @old_innodb_strict_mode = @@global.innodb_strict_mode; +SET @@global.innodb_file_format = Barracuda, +@@global.innodb_file_per_table = ON, +@@global.innodb_strict_mode = ON; + +--echo # Connection con1 +--connect(con1,localhost,root,,) + +CREATE TABLE t1 (id INT NOT NULL +PRIMARY KEY, +user_num CHAR(10) +) ENGINE = InnoDB +KEY_BLOCK_SIZE=4 +PARTITION BY HASH(id) PARTITIONS 1; + +--list_files $MYSQLD_DATADIR/test +SHOW CREATE TABLE t1; + +SET GLOBAL innodb_file_per_table = OFF; + +--disconnect con1 +--connect(con2,localhost,root,,) +--echo # Connection con2 + +LOCK TABLE t1 WRITE; + +--echo # ALTER fails because COMPRESSED/KEY_BLOCK_SIZE +--echo # are incompatible with innodb_file_per_table = OFF; + +--error ER_GET_ERRNO +ALTER TABLE t1 ADD PARTITION PARTITIONS 1; + +--list_files $MYSQLD_DATADIR/test +--echo # This SET is not needed to reproduce the bug, +--echo # it is here just to make the test case more realistic +SET innodb_strict_mode = OFF; + +ALTER TABLE t1 ADD PARTITION PARTITIONS 2; +--list_files $MYSQLD_DATADIR/test + +# really bug#56172 +ALTER TABLE t1 REBUILD PARTITION p0; + +UNLOCK TABLES; +SHOW CREATE TABLE t1; +DROP TABLE t1; + +--disconnect con2 +--connection default +--echo # Connection default +SET @@global.innodb_strict_mode = @old_innodb_strict_mode; +SET @@global.innodb_file_format = @old_innodb_file_format; +SET @@global.innodb_file_per_table = @old_innodb_file_per_table; +SET @@global.innodb_file_format_check = @old_innodb_file_format_check; # # Bug#32430 - show engine innodb status causes errors diff --git a/sql/sql_partition.cc b/sql/sql_partition.cc index 76caa2b0c8d..7b0c47865d8 100644 --- a/sql/sql_partition.cc +++ b/sql/sql_partition.cc @@ -5934,6 +5934,12 @@ static void alter_partition_lock_handling(ALTER_PARTITION_PARAM_TYPE *lpt) int err; if (lpt->thd->locked_tables) { + /* + Close the table if open, to remove/destroy the already altered + table->part_info object, so that it is not reused. + */ + if (lpt->table->db_stat) + abort_and_upgrade_lock_and_close_table(lpt); /* When we have the table locked, it is necessary to reopen the table since all table objects were closed and removed as part of the @@ -6436,7 +6442,20 @@ uint fast_alter_partition_table(THD *thd, TABLE *table, table, table_list, FALSE, NULL, written_bin_log)); err: - close_thread_tables(thd); + if (thd->locked_tables) + { + /* + table->part_info was altered in prep_alter_part_table and must be + destroyed and recreated, since otherwise it will be reused, since + we are under LOCK TABLE. + */ + alter_partition_lock_handling(lpt); + } + else + { + /* Force the table to be closed to avoid reuse of the table->part_info */ + close_thread_tables(thd); + } DBUG_RETURN(TRUE); } #endif From 6b9865571454b6def2a6c9a22be7f76964c58d82 Mon Sep 17 00:00:00 2001 From: MySQL Build Team Date: Wed, 9 Feb 2011 21:22:26 +0100 Subject: [PATCH 091/202] Backport into build-201102032246-5.1.52sp1 > ------------------------------------------------------------ > revno: 3496.1.39 > revision-id: jon.hauglid@oracle.com-20101019081957-zf2ohl7wgnhvnnb0 > parent: tor.didriksen@oracle.com-20101019070648-jhi9ezq3b5qk4wcm > committer: Jon Olav Hauglid > branch nick: mysql-5.1-bugteam-bug57274 > timestamp: Tue 2010-10-19 10:19:57 +0200 > message: > Bug #57274 SET GLOBAL debug crashes on Solaris in embedded server mode > (variables_debug fails) > > The problem was that "SET GLOBAL debug" could cause a crash on Solaris. > The crash happened if the server failed to open the trace file given in > the "SET GLOBAL debug" statement. This caused an error message to be > printed to stderr containing the process name. However, printing to > stderr crashed the server since the pointer to the process name had > not been initialized. > > This patch fixes the problem by initializing the process name > properly when doing "SET GLOBAL debug". > > No test case added as this bug was repeatable with existing test > coverage in variables_debug.test. --- dbug/dbug.c | 1 + 1 file changed, 1 insertion(+) diff --git a/dbug/dbug.c b/dbug/dbug.c index 76723fa8767..7372f1b2c0c 100644 --- a/dbug/dbug.c +++ b/dbug/dbug.c @@ -744,6 +744,7 @@ void _db_set_init_(const char *control) CODE_STATE tmp_cs; bzero((uchar*) &tmp_cs, sizeof(tmp_cs)); tmp_cs.stack= &init_settings; + tmp_cs.process= db_process ? db_process : "dbug"; DbugParse(&tmp_cs, control); } From 829f6b85e118c1c9e94a86154c5fe21a690e30a6 Mon Sep 17 00:00:00 2001 From: MySQL Build Team Date: Wed, 9 Feb 2011 21:26:44 +0100 Subject: [PATCH 092/202] Backport into build-201102032246-5.1.52sp1 > ------------------------------------------------------------ > revno: 3504 > revision-id: svoj@oracle.com-20101111100317-3bjzbj6c2ihfzb9t > parent: dmitry.shulga@oracle.com-20101111045251-jl1spfh3xjti1sll > committer: Sergey Vojtovich > branch nick: mysql-5.1-bugteam-bug58079 > timestamp: Thu 2010-11-11 13:03:17 +0300 > message: > BUG#58079 - Remove the IBM DB2 storage engine --- mysql-test/suite/ibmdb2i/include/have_i54.inc | 20 - mysql-test/suite/ibmdb2i/include/have_i61.inc | 20 - .../suite/ibmdb2i/include/have_ibmdb2i.inc | 6 - .../suite/ibmdb2i/r/ibmdb2i_bug_44020.result | 11 - .../suite/ibmdb2i/r/ibmdb2i_bug_44025.result | 4 - .../suite/ibmdb2i/r/ibmdb2i_bug_44232.result | 4 - .../suite/ibmdb2i/r/ibmdb2i_bug_44610.result | 18 - .../suite/ibmdb2i/r/ibmdb2i_bug_45196.result | 33 - .../suite/ibmdb2i/r/ibmdb2i_bug_45793.result | 7 - .../suite/ibmdb2i/r/ibmdb2i_bug_45983.result | 20 - .../suite/ibmdb2i/r/ibmdb2i_bug_49329.result | 9 - .../suite/ibmdb2i/r/ibmdb2i_collations.result | 1204 ------ .../suite/ibmdb2i/t/ibmdb2i_bug_44020.test | 9 - .../suite/ibmdb2i/t/ibmdb2i_bug_44025.test | 9 - .../suite/ibmdb2i/t/ibmdb2i_bug_44232.test | 8 - .../suite/ibmdb2i/t/ibmdb2i_bug_44610.test | 28 - .../suite/ibmdb2i/t/ibmdb2i_bug_45196.test | 26 - .../suite/ibmdb2i/t/ibmdb2i_bug_45793.test | 11 - .../suite/ibmdb2i/t/ibmdb2i_bug_45983.test | 47 - .../suite/ibmdb2i/t/ibmdb2i_bug_49329.test | 10 - .../suite/ibmdb2i/t/ibmdb2i_collations.test | 44 - storage/ibmdb2i/CMakeLists.txt | 25 - storage/ibmdb2i/Makefile.am | 54 - storage/ibmdb2i/db2i_blobCollection.cc | 107 - storage/ibmdb2i/db2i_blobCollection.h | 151 - storage/ibmdb2i/db2i_charsetSupport.cc | 826 ---- storage/ibmdb2i/db2i_charsetSupport.h | 65 - storage/ibmdb2i/db2i_collationSupport.cc | 355 -- storage/ibmdb2i/db2i_collationSupport.h | 48 - storage/ibmdb2i/db2i_constraints.cc | 672 ---- storage/ibmdb2i/db2i_conversion.cc | 1459 ------- storage/ibmdb2i/db2i_errors.cc | 297 -- storage/ibmdb2i/db2i_errors.h | 93 - storage/ibmdb2i/db2i_file.cc | 556 --- storage/ibmdb2i/db2i_file.h | 445 --- storage/ibmdb2i/db2i_global.h | 138 - storage/ibmdb2i/db2i_iconv.h | 51 - storage/ibmdb2i/db2i_ileBridge.cc | 1342 ------- storage/ibmdb2i/db2i_ileBridge.h | 499 --- storage/ibmdb2i/db2i_ioBuffers.cc | 332 -- storage/ibmdb2i/db2i_ioBuffers.h | 416 -- storage/ibmdb2i/db2i_misc.h | 129 - storage/ibmdb2i/db2i_myconv.cc | 1498 -------- storage/ibmdb2i/db2i_myconv.h | 3201 ---------------- storage/ibmdb2i/db2i_rir.cc | 686 ---- storage/ibmdb2i/db2i_safeString.h | 98 - storage/ibmdb2i/db2i_sqlStatementStream.cc | 86 - storage/ibmdb2i/db2i_sqlStatementStream.h | 151 - storage/ibmdb2i/db2i_validatedPointer.h | 162 - storage/ibmdb2i/ha_ibmdb2i.cc | 3359 ----------------- storage/ibmdb2i/ha_ibmdb2i.h | 822 ---- storage/ibmdb2i/plug.in | 12 - 52 files changed, 19683 deletions(-) delete mode 100755 mysql-test/suite/ibmdb2i/include/have_i54.inc delete mode 100644 mysql-test/suite/ibmdb2i/include/have_i61.inc delete mode 100644 mysql-test/suite/ibmdb2i/include/have_ibmdb2i.inc delete mode 100644 mysql-test/suite/ibmdb2i/r/ibmdb2i_bug_44020.result delete mode 100644 mysql-test/suite/ibmdb2i/r/ibmdb2i_bug_44025.result delete mode 100755 mysql-test/suite/ibmdb2i/r/ibmdb2i_bug_44232.result delete mode 100755 mysql-test/suite/ibmdb2i/r/ibmdb2i_bug_44610.result delete mode 100644 mysql-test/suite/ibmdb2i/r/ibmdb2i_bug_45196.result delete mode 100644 mysql-test/suite/ibmdb2i/r/ibmdb2i_bug_45793.result delete mode 100644 mysql-test/suite/ibmdb2i/r/ibmdb2i_bug_45983.result delete mode 100644 mysql-test/suite/ibmdb2i/r/ibmdb2i_bug_49329.result delete mode 100644 mysql-test/suite/ibmdb2i/r/ibmdb2i_collations.result delete mode 100644 mysql-test/suite/ibmdb2i/t/ibmdb2i_bug_44020.test delete mode 100644 mysql-test/suite/ibmdb2i/t/ibmdb2i_bug_44025.test delete mode 100755 mysql-test/suite/ibmdb2i/t/ibmdb2i_bug_44232.test delete mode 100755 mysql-test/suite/ibmdb2i/t/ibmdb2i_bug_44610.test delete mode 100644 mysql-test/suite/ibmdb2i/t/ibmdb2i_bug_45196.test delete mode 100644 mysql-test/suite/ibmdb2i/t/ibmdb2i_bug_45793.test delete mode 100644 mysql-test/suite/ibmdb2i/t/ibmdb2i_bug_45983.test delete mode 100644 mysql-test/suite/ibmdb2i/t/ibmdb2i_bug_49329.test delete mode 100644 mysql-test/suite/ibmdb2i/t/ibmdb2i_collations.test delete mode 100644 storage/ibmdb2i/CMakeLists.txt delete mode 100644 storage/ibmdb2i/Makefile.am delete mode 100644 storage/ibmdb2i/db2i_blobCollection.cc delete mode 100644 storage/ibmdb2i/db2i_blobCollection.h delete mode 100644 storage/ibmdb2i/db2i_charsetSupport.cc delete mode 100644 storage/ibmdb2i/db2i_charsetSupport.h delete mode 100644 storage/ibmdb2i/db2i_collationSupport.cc delete mode 100644 storage/ibmdb2i/db2i_collationSupport.h delete mode 100644 storage/ibmdb2i/db2i_constraints.cc delete mode 100644 storage/ibmdb2i/db2i_conversion.cc delete mode 100644 storage/ibmdb2i/db2i_errors.cc delete mode 100644 storage/ibmdb2i/db2i_errors.h delete mode 100644 storage/ibmdb2i/db2i_file.cc delete mode 100644 storage/ibmdb2i/db2i_file.h delete mode 100644 storage/ibmdb2i/db2i_global.h delete mode 100644 storage/ibmdb2i/db2i_iconv.h delete mode 100644 storage/ibmdb2i/db2i_ileBridge.cc delete mode 100644 storage/ibmdb2i/db2i_ileBridge.h delete mode 100644 storage/ibmdb2i/db2i_ioBuffers.cc delete mode 100644 storage/ibmdb2i/db2i_ioBuffers.h delete mode 100644 storage/ibmdb2i/db2i_misc.h delete mode 100644 storage/ibmdb2i/db2i_myconv.cc delete mode 100644 storage/ibmdb2i/db2i_myconv.h delete mode 100644 storage/ibmdb2i/db2i_rir.cc delete mode 100644 storage/ibmdb2i/db2i_safeString.h delete mode 100644 storage/ibmdb2i/db2i_sqlStatementStream.cc delete mode 100644 storage/ibmdb2i/db2i_sqlStatementStream.h delete mode 100644 storage/ibmdb2i/db2i_validatedPointer.h delete mode 100644 storage/ibmdb2i/ha_ibmdb2i.cc delete mode 100644 storage/ibmdb2i/ha_ibmdb2i.h delete mode 100644 storage/ibmdb2i/plug.in diff --git a/mysql-test/suite/ibmdb2i/include/have_i54.inc b/mysql-test/suite/ibmdb2i/include/have_i54.inc deleted file mode 100755 index 7054e196153..00000000000 --- a/mysql-test/suite/ibmdb2i/include/have_i54.inc +++ /dev/null @@ -1,20 +0,0 @@ -# Check for IBM i 6.1 or later ---disable_query_log -system uname -rv > $MYSQLTEST_VARDIR/tmp/version; ---disable_warnings -drop table if exists uname_vr; ---enable_warnings -create temporary table uname_vr (r int, v int); ---disable_warnings -eval LOAD DATA INFILE "$MYSQLTEST_VARDIR/tmp/version" into table uname_vr fields terminated by ' '; ---enable_warnings -let $ok = `select count(*) from uname_vr where v = 5 and r = 4`; -drop table uname_vr; -remove_file $MYSQLTEST_VARDIR/tmp/version; ---enable_query_log -if (!$ok) -{ - skip "Need IBM i 5.4 or later"; -} - - diff --git a/mysql-test/suite/ibmdb2i/include/have_i61.inc b/mysql-test/suite/ibmdb2i/include/have_i61.inc deleted file mode 100644 index 84b9a17c1d8..00000000000 --- a/mysql-test/suite/ibmdb2i/include/have_i61.inc +++ /dev/null @@ -1,20 +0,0 @@ -# Check for IBM i 6.1 or later ---disable_query_log -system uname -rv > $MYSQLTEST_VARDIR/tmp/version; ---disable_warnings -drop table if exists uname_vr; ---enable_warnings -create temporary table uname_vr (r int, v int); ---disable_warnings -eval LOAD DATA INFILE "$MYSQLTEST_VARDIR/tmp/version" into table uname_vr fields terminated by ' '; ---enable_warnings -let $ok = `select count(*) from uname_vr where v > 5`; -drop table uname_vr; -remove_file $MYSQLTEST_VARDIR/tmp/version; ---enable_query_log -if (!$ok) -{ - skip "Need IBM i 6.1 or later"; -} - - diff --git a/mysql-test/suite/ibmdb2i/include/have_ibmdb2i.inc b/mysql-test/suite/ibmdb2i/include/have_ibmdb2i.inc deleted file mode 100644 index f3ef0b4f1ac..00000000000 --- a/mysql-test/suite/ibmdb2i/include/have_ibmdb2i.inc +++ /dev/null @@ -1,6 +0,0 @@ -if (!`SELECT count(*) FROM information_schema.engines WHERE - (support = 'YES' OR support = 'DEFAULT') AND - engine = 'ibmdb2i'`) -{ - skip Need ibmdb2i engine; -} diff --git a/mysql-test/suite/ibmdb2i/r/ibmdb2i_bug_44020.result b/mysql-test/suite/ibmdb2i/r/ibmdb2i_bug_44020.result deleted file mode 100644 index ddf92db6bca..00000000000 --- a/mysql-test/suite/ibmdb2i/r/ibmdb2i_bug_44020.result +++ /dev/null @@ -1,11 +0,0 @@ -create schema `A12345_@$#`; -create table `A12345_@$#`.t1 (i int) engine=ibmdb2i; -show create table `A12345_@$#`.t1; -Table Create Table -t1 CREATE TABLE `t1` ( - `i` int(11) DEFAULT NULL -) ENGINE=IBMDB2I DEFAULT CHARSET=latin1 -select * from `A12345_@$#`.t1; -i -drop table `A12345_@$#`.t1; -drop schema `A12345_@$#`; diff --git a/mysql-test/suite/ibmdb2i/r/ibmdb2i_bug_44025.result b/mysql-test/suite/ibmdb2i/r/ibmdb2i_bug_44025.result deleted file mode 100644 index 10a3070fcc4..00000000000 --- a/mysql-test/suite/ibmdb2i/r/ibmdb2i_bug_44025.result +++ /dev/null @@ -1,4 +0,0 @@ -create table t1 (c char(10) collate utf8_swedish_ci, index(c)) engine=ibmdb2i; -drop table t1; -create table t1 (c char(10) collate ucs2_swedish_ci, index(c)) engine=ibmdb2i; -drop table t1; diff --git a/mysql-test/suite/ibmdb2i/r/ibmdb2i_bug_44232.result b/mysql-test/suite/ibmdb2i/r/ibmdb2i_bug_44232.result deleted file mode 100755 index 8276b401073..00000000000 --- a/mysql-test/suite/ibmdb2i/r/ibmdb2i_bug_44232.result +++ /dev/null @@ -1,4 +0,0 @@ -create table t1 (c char(1) character set armscii8) engine=ibmdb2i; -ERROR HY000: Can't create table 'test.t1' (errno: 2504) -create table t1 (c char(1) character set eucjpms ) engine=ibmdb2i; -ERROR HY000: Can't create table 'test.t1' (errno: 2504) diff --git a/mysql-test/suite/ibmdb2i/r/ibmdb2i_bug_44610.result b/mysql-test/suite/ibmdb2i/r/ibmdb2i_bug_44610.result deleted file mode 100755 index 311e800e1b0..00000000000 --- a/mysql-test/suite/ibmdb2i/r/ibmdb2i_bug_44610.result +++ /dev/null @@ -1,18 +0,0 @@ -create table ABC (i int) engine=ibmdb2i; -drop table ABC; -create table `1234567890ABC` (i int) engine=ibmdb2i; -drop table `1234567890ABC`; -create table `!@#$%` (i int) engine=ibmdb2i; -drop table `!@#$%`; -create table `ABCD#########` (i int) engine=ibmdb2i; -drop table `ABCD#########`; -create table `_` (i int) engine=ibmdb2i; -drop table `_`; -create table `abc##def` (i int) engine=ibmdb2i; -drop table `abc##def`; -set names utf8; -create table İ (s1 int) engine=ibmdb2i; -drop table İ; -create table İİ (s1 int) engine=ibmdb2i; -drop table İİ; -set names latin1; diff --git a/mysql-test/suite/ibmdb2i/r/ibmdb2i_bug_45196.result b/mysql-test/suite/ibmdb2i/r/ibmdb2i_bug_45196.result deleted file mode 100644 index 916e1d93ee5..00000000000 --- a/mysql-test/suite/ibmdb2i/r/ibmdb2i_bug_45196.result +++ /dev/null @@ -1,33 +0,0 @@ -drop table if exists t1; -create table t1 (c char(10), index(c)) collate ucs2_czech_ci engine=ibmdb2i; -insert into t1 values ("ch"),("h"),("i"); -select * from t1 order by c; -c -h -ch -i -drop table t1; -create table t1 (c char(10), index(c)) collate utf8_czech_ci engine=ibmdb2i; -insert into t1 values ("ch"),("h"),("i"); -select * from t1 order by c; -c -h -ch -i -drop table t1; -create table t1 (c char(10), index(c)) collate ucs2_danish_ci engine=ibmdb2i; -insert into t1 values("abc"),("abcd"),("aaaa"); -select c from t1 order by c; -c -abc -abcd -aaaa -drop table t1; -create table t1 (c char(10), index(c)) collate utf8_danish_ci engine=ibmdb2i; -insert into t1 values("abc"),("abcd"),("aaaa"); -select c from t1 order by c; -c -abc -abcd -aaaa -drop table t1; diff --git a/mysql-test/suite/ibmdb2i/r/ibmdb2i_bug_45793.result b/mysql-test/suite/ibmdb2i/r/ibmdb2i_bug_45793.result deleted file mode 100644 index 2392b746877..00000000000 --- a/mysql-test/suite/ibmdb2i/r/ibmdb2i_bug_45793.result +++ /dev/null @@ -1,7 +0,0 @@ -drop table if exists t1; -create table t1 (c char(10), index(c)) charset macce engine=ibmdb2i; -insert into t1 values ("test"); -select * from t1 order by c; -c -test -drop table t1; diff --git a/mysql-test/suite/ibmdb2i/r/ibmdb2i_bug_45983.result b/mysql-test/suite/ibmdb2i/r/ibmdb2i_bug_45983.result deleted file mode 100644 index b9f4dcfc656..00000000000 --- a/mysql-test/suite/ibmdb2i/r/ibmdb2i_bug_45983.result +++ /dev/null @@ -1,20 +0,0 @@ -set ibmdb2i_create_index_option=1; -drop schema if exists test1; -create schema test1; -use test1; -CREATE TABLE t1 (f int primary key, index(f)) engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (f char(10) collate utf8_bin primary key, index(f)) engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (f char(10) collate latin1_swedish_ci primary key, index(f)) engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (f char(10) collate latin1_swedish_ci primary key, i int, index i(i,f)) engine=ibmdb2i; -drop table t1; -create table fd (SQSSEQ CHAR(10)) engine=ibmdb2i; -select * from fd; -SQSSEQ -*HEX -*HEX -*HEX -*HEX -drop table fd; diff --git a/mysql-test/suite/ibmdb2i/r/ibmdb2i_bug_49329.result b/mysql-test/suite/ibmdb2i/r/ibmdb2i_bug_49329.result deleted file mode 100644 index d5bfc2579fd..00000000000 --- a/mysql-test/suite/ibmdb2i/r/ibmdb2i_bug_49329.result +++ /dev/null @@ -1,9 +0,0 @@ -create table ABC (i int) engine=ibmdb2i; -insert into ABC values(1); -create table abc (i int) engine=ibmdb2i; -insert into abc values (2); -select * from ABC; -i -1 -drop table ABC; -drop table abc; diff --git a/mysql-test/suite/ibmdb2i/r/ibmdb2i_collations.result b/mysql-test/suite/ibmdb2i/r/ibmdb2i_collations.result deleted file mode 100644 index 4f7d71cab2d..00000000000 --- a/mysql-test/suite/ibmdb2i/r/ibmdb2i_collations.result +++ /dev/null @@ -1,1204 +0,0 @@ -drop table if exists t1, ffd, fd; -CREATE TABLE t1 (armscii8_bin integer, c char(10), v varchar(20), index(c), index(v)) collate armscii8_bin engine=ibmdb2i; -CREATE TABLE t1 (armscii8_general_ci integer, c char(10), v varchar(20), index(c), index(v)) collate armscii8_general_ci engine=ibmdb2i; -CREATE TABLE t1 (ascii_bin integer, c char(10), v varchar(20), index(c), index(v)) collate ascii_bin engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 11 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 23 NULL 6 Using where -drop table t1; -create table t1 (ascii_bin char(10) primary key) collate ascii_bin engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (ascii_general_ci integer, c char(10), v varchar(20), index(c), index(v)) collate ascii_general_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 11 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 23 NULL 6 Using where -drop table t1; -create table t1 (ascii_general_ci char(10) primary key) collate ascii_general_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (big5_bin integer, c char(10), v varchar(20), index(c), index(v)) collate big5_bin engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 21 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 43 NULL 6 Using where -drop table t1; -create table t1 (big5_bin char(10) primary key) collate big5_bin engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (big5_chinese_ci integer, c char(10), v varchar(20), index(c), index(v)) collate big5_chinese_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 21 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 43 NULL 6 Using where -drop table t1; -create table t1 (big5_chinese_ci char(10) primary key) collate big5_chinese_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (cp1250_bin integer, c char(10), v varchar(20), index(c), index(v)) collate cp1250_bin engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 11 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 23 NULL 6 Using where -drop table t1; -create table t1 (cp1250_bin char(10) primary key) collate cp1250_bin engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (cp1250_croatian_ci integer, c char(10), v varchar(20), index(c), index(v)) collate cp1250_croatian_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 11 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 23 NULL 6 Using where -drop table t1; -create table t1 (cp1250_croatian_ci char(10) primary key) collate cp1250_croatian_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (cp1250_czech_cs integer, c char(10), v varchar(20), index(c), index(v)) collate cp1250_czech_cs engine=ibmdb2i; -CREATE TABLE t1 (cp1250_general_ci integer, c char(10), v varchar(20), index(c), index(v)) collate cp1250_general_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 11 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 23 NULL 6 Using where -drop table t1; -create table t1 (cp1250_general_ci char(10) primary key) collate cp1250_general_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (cp1250_polish_ci integer, c char(10), v varchar(20), index(c), index(v)) collate cp1250_polish_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 11 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 23 NULL 6 Using where -drop table t1; -create table t1 (cp1250_polish_ci char(10) primary key) collate cp1250_polish_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (cp1251_bin integer, c char(10), v varchar(20), index(c), index(v)) collate cp1251_bin engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 11 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 23 NULL 6 Using where -drop table t1; -create table t1 (cp1251_bin char(10) primary key) collate cp1251_bin engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (cp1251_bulgarian_ci integer, c char(10), v varchar(20), index(c), index(v)) collate cp1251_bulgarian_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 11 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 23 NULL 6 Using where -drop table t1; -create table t1 (cp1251_bulgarian_ci char(10) primary key) collate cp1251_bulgarian_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (cp1251_general_ci integer, c char(10), v varchar(20), index(c), index(v)) collate cp1251_general_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 11 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 23 NULL 6 Using where -drop table t1; -create table t1 (cp1251_general_ci char(10) primary key) collate cp1251_general_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (cp1251_general_cs integer, c char(10), v varchar(20), index(c), index(v)) collate cp1251_general_cs engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 11 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 23 NULL 6 Using where -drop table t1; -create table t1 (cp1251_general_cs char(10) primary key) collate cp1251_general_cs engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (cp1251_ukrainian_ci integer, c char(10), v varchar(20), index(c), index(v)) collate cp1251_ukrainian_ci engine=ibmdb2i; -CREATE TABLE t1 (cp1256_bin integer, c char(10), v varchar(20), index(c), index(v)) collate cp1256_bin engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 11 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 23 NULL 6 Using where -drop table t1; -create table t1 (cp1256_bin char(10) primary key) collate cp1256_bin engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (cp1256_general_ci integer, c char(10), v varchar(20), index(c), index(v)) collate cp1256_general_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 11 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 23 NULL 6 Using where -drop table t1; -create table t1 (cp1256_general_ci char(10) primary key) collate cp1256_general_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (cp1257_bin integer, c char(10), v varchar(20), index(c), index(v)) collate cp1257_bin engine=ibmdb2i; -CREATE TABLE t1 (cp1257_general_ci integer, c char(10), v varchar(20), index(c), index(v)) collate cp1257_general_ci engine=ibmdb2i; -CREATE TABLE t1 (cp1257_lithuanian_ci integer, c char(10), v varchar(20), index(c), index(v)) collate cp1257_lithuanian_ci engine=ibmdb2i; -CREATE TABLE t1 (cp850_bin integer, c char(10), v varchar(20), index(c), index(v)) collate cp850_bin engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 11 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 23 NULL 6 Using where -drop table t1; -create table t1 (cp850_bin char(10) primary key) collate cp850_bin engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (cp850_general_ci integer, c char(10), v varchar(20), index(c), index(v)) collate cp850_general_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 11 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 23 NULL 6 Using where -drop table t1; -create table t1 (cp850_general_ci char(10) primary key) collate cp850_general_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (cp852_bin integer, c char(10), v varchar(20), index(c), index(v)) collate cp852_bin engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 11 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 23 NULL 6 Using where -drop table t1; -create table t1 (cp852_bin char(10) primary key) collate cp852_bin engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (cp852_general_ci integer, c char(10), v varchar(20), index(c), index(v)) collate cp852_general_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 11 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 23 NULL 6 Using where -drop table t1; -create table t1 (cp852_general_ci char(10) primary key) collate cp852_general_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (cp866_bin integer, c char(10), v varchar(20), index(c), index(v)) collate cp866_bin engine=ibmdb2i; -CREATE TABLE t1 (cp866_general_ci integer, c char(10), v varchar(20), index(c), index(v)) collate cp866_general_ci engine=ibmdb2i; -CREATE TABLE t1 (cp932_bin integer, c char(10), v varchar(20), index(c), index(v)) collate cp932_bin engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 21 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 43 NULL 6 Using where -drop table t1; -create table t1 (cp932_bin char(10) primary key) collate cp932_bin engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (cp932_japanese_ci integer, c char(10), v varchar(20), index(c), index(v)) collate cp932_japanese_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 21 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 43 NULL 6 Using where -drop table t1; -create table t1 (cp932_japanese_ci char(10) primary key) collate cp932_japanese_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (dec8_bin integer, c char(10), v varchar(20), index(c), index(v)) collate dec8_bin engine=ibmdb2i; -CREATE TABLE t1 (dec8_swedish_ci integer, c char(10), v varchar(20), index(c), index(v)) collate dec8_swedish_ci engine=ibmdb2i; -CREATE TABLE t1 (eucjpms_bin integer, c char(10), v varchar(20), index(c), index(v)) collate eucjpms_bin engine=ibmdb2i; -CREATE TABLE t1 (eucjpms_japanese_ci integer, c char(10), v varchar(20), index(c), index(v)) collate eucjpms_japanese_ci engine=ibmdb2i; -CREATE TABLE t1 (euckr_bin integer, c char(10), v varchar(20), index(c), index(v)) collate euckr_bin engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 21 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 43 NULL 6 Using where -drop table t1; -create table t1 (euckr_bin char(10) primary key) collate euckr_bin engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (euckr_korean_ci integer, c char(10), v varchar(20), index(c), index(v)) collate euckr_korean_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 21 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 43 NULL 6 Using where -drop table t1; -create table t1 (euckr_korean_ci char(10) primary key) collate euckr_korean_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (gb2312_bin integer, c char(10), v varchar(20), index(c), index(v)) collate gb2312_bin engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 21 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 43 NULL 6 Using where -drop table t1; -create table t1 (gb2312_bin char(10) primary key) collate gb2312_bin engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (gb2312_chinese_ci integer, c char(10), v varchar(20), index(c), index(v)) collate gb2312_chinese_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 21 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 43 NULL 6 Using where -drop table t1; -create table t1 (gb2312_chinese_ci char(10) primary key) collate gb2312_chinese_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (gbk_bin integer, c char(10), v varchar(20), index(c), index(v)) collate gbk_bin engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 21 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 43 NULL 6 Using where -drop table t1; -create table t1 (gbk_bin char(10) primary key) collate gbk_bin engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (gbk_chinese_ci integer, c char(10), v varchar(20), index(c), index(v)) collate gbk_chinese_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 21 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 43 NULL 6 Using where -drop table t1; -create table t1 (gbk_chinese_ci char(10) primary key) collate gbk_chinese_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (geostd8_bin integer, c char(10), v varchar(20), index(c), index(v)) collate geostd8_bin engine=ibmdb2i; -CREATE TABLE t1 (geostd8_general_ci integer, c char(10), v varchar(20), index(c), index(v)) collate geostd8_general_ci engine=ibmdb2i; -CREATE TABLE t1 (greek_bin integer, c char(10), v varchar(20), index(c), index(v)) collate greek_bin engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 11 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 23 NULL 6 Using where -drop table t1; -create table t1 (greek_bin char(10) primary key) collate greek_bin engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (greek_general_ci integer, c char(10), v varchar(20), index(c), index(v)) collate greek_general_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 11 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 23 NULL 6 Using where -drop table t1; -create table t1 (greek_general_ci char(10) primary key) collate greek_general_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (hebrew_bin integer, c char(10), v varchar(20), index(c), index(v)) collate hebrew_bin engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 11 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 23 NULL 6 Using where -drop table t1; -create table t1 (hebrew_bin char(10) primary key) collate hebrew_bin engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (hebrew_general_ci integer, c char(10), v varchar(20), index(c), index(v)) collate hebrew_general_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 11 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 23 NULL 6 Using where -drop table t1; -create table t1 (hebrew_general_ci char(10) primary key) collate hebrew_general_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (hp8_bin integer, c char(10), v varchar(20), index(c), index(v)) collate hp8_bin engine=ibmdb2i; -CREATE TABLE t1 (hp8_english_ci integer, c char(10), v varchar(20), index(c), index(v)) collate hp8_english_ci engine=ibmdb2i; -CREATE TABLE t1 (keybcs2_bin integer, c char(10), v varchar(20), index(c), index(v)) collate keybcs2_bin engine=ibmdb2i; -CREATE TABLE t1 (keybcs2_general_ci integer, c char(10), v varchar(20), index(c), index(v)) collate keybcs2_general_ci engine=ibmdb2i; -CREATE TABLE t1 (koi8r_bin integer, c char(10), v varchar(20), index(c), index(v)) collate koi8r_bin engine=ibmdb2i; -CREATE TABLE t1 (koi8r_general_ci integer, c char(10), v varchar(20), index(c), index(v)) collate koi8r_general_ci engine=ibmdb2i; -CREATE TABLE t1 (koi8u_bin integer, c char(10), v varchar(20), index(c), index(v)) collate koi8u_bin engine=ibmdb2i; -CREATE TABLE t1 (koi8u_general_ci integer, c char(10), v varchar(20), index(c), index(v)) collate koi8u_general_ci engine=ibmdb2i; -CREATE TABLE t1 (latin1_bin integer, c char(10), v varchar(20), index(c), index(v)) collate latin1_bin engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 11 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 23 NULL 6 Using where -drop table t1; -create table t1 (latin1_bin char(10) primary key) collate latin1_bin engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (latin1_danish_ci integer, c char(10), v varchar(20), index(c), index(v)) collate latin1_danish_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 11 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 23 NULL 6 Using where -drop table t1; -create table t1 (latin1_danish_ci char(10) primary key) collate latin1_danish_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (latin1_general_ci integer, c char(10), v varchar(20), index(c), index(v)) collate latin1_general_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 11 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 23 NULL 6 Using where -drop table t1; -create table t1 (latin1_general_ci char(10) primary key) collate latin1_general_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (latin1_general_cs integer, c char(10), v varchar(20), index(c), index(v)) collate latin1_general_cs engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 11 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 23 NULL 6 Using where -drop table t1; -create table t1 (latin1_general_cs char(10) primary key) collate latin1_general_cs engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (latin1_german1_ci integer, c char(10), v varchar(20), index(c), index(v)) collate latin1_german1_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 11 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 23 NULL 6 Using where -drop table t1; -create table t1 (latin1_german1_ci char(10) primary key) collate latin1_german1_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (latin1_german2_ci integer, c char(10), v varchar(20), index(c), index(v)) collate latin1_german2_ci engine=ibmdb2i; -CREATE TABLE t1 (latin1_spanish_ci integer, c char(10), v varchar(20), index(c), index(v)) collate latin1_spanish_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 11 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 23 NULL 6 Using where -drop table t1; -create table t1 (latin1_spanish_ci char(10) primary key) collate latin1_spanish_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (latin1_swedish_ci integer, c char(10), v varchar(20), index(c), index(v)) collate latin1_swedish_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 11 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 23 NULL 6 Using where -drop table t1; -create table t1 (latin1_swedish_ci char(10) primary key) collate latin1_swedish_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (latin2_bin integer, c char(10), v varchar(20), index(c), index(v)) collate latin2_bin engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 11 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 23 NULL 6 Using where -drop table t1; -create table t1 (latin2_bin char(10) primary key) collate latin2_bin engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (latin2_croatian_ci integer, c char(10), v varchar(20), index(c), index(v)) collate latin2_croatian_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 11 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 23 NULL 6 Using where -drop table t1; -create table t1 (latin2_croatian_ci char(10) primary key) collate latin2_croatian_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (latin2_czech_cs integer, c char(10), v varchar(20), index(c), index(v)) collate latin2_czech_cs engine=ibmdb2i; -CREATE TABLE t1 (latin2_general_ci integer, c char(10), v varchar(20), index(c), index(v)) collate latin2_general_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 11 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 23 NULL 6 Using where -drop table t1; -create table t1 (latin2_general_ci char(10) primary key) collate latin2_general_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (latin2_hungarian_ci integer, c char(10), v varchar(20), index(c), index(v)) collate latin2_hungarian_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 11 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 23 NULL 6 Using where -drop table t1; -create table t1 (latin2_hungarian_ci char(10) primary key) collate latin2_hungarian_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (latin5_bin integer, c char(10), v varchar(20), index(c), index(v)) collate latin5_bin engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 11 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 23 NULL 6 Using where -drop table t1; -create table t1 (latin5_bin char(10) primary key) collate latin5_bin engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (latin5_turkish_ci integer, c char(10), v varchar(20), index(c), index(v)) collate latin5_turkish_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 11 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 23 NULL 6 Using where -drop table t1; -create table t1 (latin5_turkish_ci char(10) primary key) collate latin5_turkish_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (latin7_bin integer, c char(10), v varchar(20), index(c), index(v)) collate latin7_bin engine=ibmdb2i; -CREATE TABLE t1 (latin7_estonian_cs integer, c char(10), v varchar(20), index(c), index(v)) collate latin7_estonian_cs engine=ibmdb2i; -CREATE TABLE t1 (latin7_general_ci integer, c char(10), v varchar(20), index(c), index(v)) collate latin7_general_ci engine=ibmdb2i; -CREATE TABLE t1 (latin7_general_cs integer, c char(10), v varchar(20), index(c), index(v)) collate latin7_general_cs engine=ibmdb2i; -CREATE TABLE t1 (macce_bin integer, c char(10), v varchar(20), index(c), index(v)) collate macce_bin engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 11 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 23 NULL 6 Using where -drop table t1; -create table t1 (macce_bin char(10) primary key) collate macce_bin engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (macce_general_ci integer, c char(10), v varchar(20), index(c), index(v)) collate macce_general_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 11 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 23 NULL 6 Using where -drop table t1; -create table t1 (macce_general_ci char(10) primary key) collate macce_general_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (macroman_bin integer, c char(10), v varchar(20), index(c), index(v)) collate macroman_bin engine=ibmdb2i; -CREATE TABLE t1 (macroman_general_ci integer, c char(10), v varchar(20), index(c), index(v)) collate macroman_general_ci engine=ibmdb2i; -CREATE TABLE t1 (sjis_bin integer, c char(10), v varchar(20), index(c), index(v)) collate sjis_bin engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 21 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 43 NULL 6 Using where -drop table t1; -create table t1 (sjis_bin char(10) primary key) collate sjis_bin engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (sjis_japanese_ci integer, c char(10), v varchar(20), index(c), index(v)) collate sjis_japanese_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 21 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 43 NULL 6 Using where -drop table t1; -create table t1 (sjis_japanese_ci char(10) primary key) collate sjis_japanese_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (swe7_bin integer, c char(10), v varchar(20), index(c), index(v)) collate swe7_bin engine=ibmdb2i; -CREATE TABLE t1 (swe7_swedish_ci integer, c char(10), v varchar(20), index(c), index(v)) collate swe7_swedish_ci engine=ibmdb2i; -CREATE TABLE t1 (tis620_bin integer, c char(10), v varchar(20), index(c), index(v)) collate tis620_bin engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 11 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 23 NULL 6 Using where -drop table t1; -create table t1 (tis620_bin char(10) primary key) collate tis620_bin engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (tis620_thai_ci integer, c char(10), v varchar(20), index(c), index(v)) collate tis620_thai_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 11 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 23 NULL 6 Using where -drop table t1; -create table t1 (tis620_thai_ci char(10) primary key) collate tis620_thai_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (ucs2_bin integer, c char(10), v varchar(20), index(c), index(v)) collate ucs2_bin engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 21 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 43 NULL 6 Using where -drop table t1; -create table t1 (ucs2_bin char(10) primary key) collate ucs2_bin engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (ucs2_czech_ci integer, c char(10), v varchar(20), index(c), index(v)) collate ucs2_czech_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 21 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 43 NULL 6 Using where -drop table t1; -create table t1 (ucs2_czech_ci char(10) primary key) collate ucs2_czech_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (ucs2_danish_ci integer, c char(10), v varchar(20), index(c), index(v)) collate ucs2_danish_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 21 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 43 NULL 6 Using where -drop table t1; -create table t1 (ucs2_danish_ci char(10) primary key) collate ucs2_danish_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (ucs2_esperanto_ci integer, c char(10), v varchar(20), index(c), index(v)) collate ucs2_esperanto_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 21 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 43 NULL 6 Using where -drop table t1; -create table t1 (ucs2_esperanto_ci char(10) primary key) collate ucs2_esperanto_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (ucs2_estonian_ci integer, c char(10), v varchar(20), index(c), index(v)) collate ucs2_estonian_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 21 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 43 NULL 6 Using where -drop table t1; -create table t1 (ucs2_estonian_ci char(10) primary key) collate ucs2_estonian_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (ucs2_general_ci integer, c char(10), v varchar(20), index(c), index(v)) collate ucs2_general_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 21 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 43 NULL 6 Using where -drop table t1; -create table t1 (ucs2_general_ci char(10) primary key) collate ucs2_general_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (ucs2_hungarian_ci integer, c char(10), v varchar(20), index(c), index(v)) collate ucs2_hungarian_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 21 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 43 NULL 6 Using where -drop table t1; -create table t1 (ucs2_hungarian_ci char(10) primary key) collate ucs2_hungarian_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (ucs2_icelandic_ci integer, c char(10), v varchar(20), index(c), index(v)) collate ucs2_icelandic_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 21 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 43 NULL 6 Using where -drop table t1; -create table t1 (ucs2_icelandic_ci char(10) primary key) collate ucs2_icelandic_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (ucs2_latvian_ci integer, c char(10), v varchar(20), index(c), index(v)) collate ucs2_latvian_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 21 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 43 NULL 6 Using where -drop table t1; -create table t1 (ucs2_latvian_ci char(10) primary key) collate ucs2_latvian_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (ucs2_lithuanian_ci integer, c char(10), v varchar(20), index(c), index(v)) collate ucs2_lithuanian_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 21 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 43 NULL 6 Using where -drop table t1; -create table t1 (ucs2_lithuanian_ci char(10) primary key) collate ucs2_lithuanian_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (ucs2_persian_ci integer, c char(10), v varchar(20), index(c), index(v)) collate ucs2_persian_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 21 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 43 NULL 6 Using where -drop table t1; -create table t1 (ucs2_persian_ci char(10) primary key) collate ucs2_persian_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (ucs2_polish_ci integer, c char(10), v varchar(20), index(c), index(v)) collate ucs2_polish_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 21 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 43 NULL 6 Using where -drop table t1; -create table t1 (ucs2_polish_ci char(10) primary key) collate ucs2_polish_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (ucs2_romanian_ci integer, c char(10), v varchar(20), index(c), index(v)) collate ucs2_romanian_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 21 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 43 NULL 6 Using where -drop table t1; -create table t1 (ucs2_romanian_ci char(10) primary key) collate ucs2_romanian_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (ucs2_roman_ci integer, c char(10), v varchar(20), index(c), index(v)) collate ucs2_roman_ci engine=ibmdb2i; -CREATE TABLE t1 (ucs2_slovak_ci integer, c char(10), v varchar(20), index(c), index(v)) collate ucs2_slovak_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 21 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 43 NULL 6 Using where -drop table t1; -create table t1 (ucs2_slovak_ci char(10) primary key) collate ucs2_slovak_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (ucs2_slovenian_ci integer, c char(10), v varchar(20), index(c), index(v)) collate ucs2_slovenian_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 21 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 43 NULL 6 Using where -drop table t1; -create table t1 (ucs2_slovenian_ci char(10) primary key) collate ucs2_slovenian_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (ucs2_spanish2_ci integer, c char(10), v varchar(20), index(c), index(v)) collate ucs2_spanish2_ci engine=ibmdb2i; -CREATE TABLE t1 (ucs2_spanish_ci integer, c char(10), v varchar(20), index(c), index(v)) collate ucs2_spanish_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 21 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 43 NULL 6 Using where -drop table t1; -create table t1 (ucs2_spanish_ci char(10) primary key) collate ucs2_spanish_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (ucs2_swedish_ci integer, c char(10), v varchar(20), index(c), index(v)) collate ucs2_swedish_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 21 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 43 NULL 6 Using where -drop table t1; -create table t1 (ucs2_swedish_ci char(10) primary key) collate ucs2_swedish_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (ucs2_turkish_ci integer, c char(10), v varchar(20), index(c), index(v)) collate ucs2_turkish_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 21 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 43 NULL 6 Using where -drop table t1; -create table t1 (ucs2_turkish_ci char(10) primary key) collate ucs2_turkish_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (ucs2_unicode_ci integer, c char(10), v varchar(20), index(c), index(v)) collate ucs2_unicode_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 21 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 43 NULL 6 Using where -drop table t1; -create table t1 (ucs2_unicode_ci char(10) primary key) collate ucs2_unicode_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (ujis_bin integer, c char(10), v varchar(20), index(c), index(v)) collate ujis_bin engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 31 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 63 NULL 6 Using where -drop table t1; -create table t1 (ujis_bin char(10) primary key) collate ujis_bin engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (ujis_japanese_ci integer, c char(10), v varchar(20), index(c), index(v)) collate ujis_japanese_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 31 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 63 NULL 6 Using where -drop table t1; -create table t1 (ujis_japanese_ci char(10) primary key) collate ujis_japanese_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (utf8_bin integer, c char(10), v varchar(20), index(c), index(v)) collate utf8_bin engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 31 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 63 NULL 6 Using where -drop table t1; -create table t1 (utf8_bin char(10) primary key) collate utf8_bin engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (utf8_czech_ci integer, c char(10), v varchar(20), index(c), index(v)) collate utf8_czech_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 31 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 63 NULL 6 Using where -drop table t1; -create table t1 (utf8_czech_ci char(10) primary key) collate utf8_czech_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (utf8_danish_ci integer, c char(10), v varchar(20), index(c), index(v)) collate utf8_danish_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 31 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 63 NULL 6 Using where -drop table t1; -create table t1 (utf8_danish_ci char(10) primary key) collate utf8_danish_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (utf8_esperanto_ci integer, c char(10), v varchar(20), index(c), index(v)) collate utf8_esperanto_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 31 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 63 NULL 6 Using where -drop table t1; -create table t1 (utf8_esperanto_ci char(10) primary key) collate utf8_esperanto_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (utf8_estonian_ci integer, c char(10), v varchar(20), index(c), index(v)) collate utf8_estonian_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 31 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 63 NULL 6 Using where -drop table t1; -create table t1 (utf8_estonian_ci char(10) primary key) collate utf8_estonian_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (utf8_general_ci integer, c char(10), v varchar(20), index(c), index(v)) collate utf8_general_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 31 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 63 NULL 6 Using where -drop table t1; -create table t1 (utf8_general_ci char(10) primary key) collate utf8_general_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (utf8_hungarian_ci integer, c char(10), v varchar(20), index(c), index(v)) collate utf8_hungarian_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 31 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 63 NULL 6 Using where -drop table t1; -create table t1 (utf8_hungarian_ci char(10) primary key) collate utf8_hungarian_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (utf8_icelandic_ci integer, c char(10), v varchar(20), index(c), index(v)) collate utf8_icelandic_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 31 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 63 NULL 6 Using where -drop table t1; -create table t1 (utf8_icelandic_ci char(10) primary key) collate utf8_icelandic_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (utf8_latvian_ci integer, c char(10), v varchar(20), index(c), index(v)) collate utf8_latvian_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 31 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 63 NULL 6 Using where -drop table t1; -create table t1 (utf8_latvian_ci char(10) primary key) collate utf8_latvian_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (utf8_lithuanian_ci integer, c char(10), v varchar(20), index(c), index(v)) collate utf8_lithuanian_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 31 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 63 NULL 6 Using where -drop table t1; -create table t1 (utf8_lithuanian_ci char(10) primary key) collate utf8_lithuanian_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (utf8_persian_ci integer, c char(10), v varchar(20), index(c), index(v)) collate utf8_persian_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 31 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 63 NULL 6 Using where -drop table t1; -create table t1 (utf8_persian_ci char(10) primary key) collate utf8_persian_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (utf8_polish_ci integer, c char(10), v varchar(20), index(c), index(v)) collate utf8_polish_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 31 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 63 NULL 6 Using where -drop table t1; -create table t1 (utf8_polish_ci char(10) primary key) collate utf8_polish_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (utf8_romanian_ci integer, c char(10), v varchar(20), index(c), index(v)) collate utf8_romanian_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 31 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 63 NULL 6 Using where -drop table t1; -create table t1 (utf8_romanian_ci char(10) primary key) collate utf8_romanian_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (utf8_roman_ci integer, c char(10), v varchar(20), index(c), index(v)) collate utf8_roman_ci engine=ibmdb2i; -CREATE TABLE t1 (utf8_slovak_ci integer, c char(10), v varchar(20), index(c), index(v)) collate utf8_slovak_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 31 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 63 NULL 6 Using where -drop table t1; -create table t1 (utf8_slovak_ci char(10) primary key) collate utf8_slovak_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (utf8_slovenian_ci integer, c char(10), v varchar(20), index(c), index(v)) collate utf8_slovenian_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 31 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 63 NULL 6 Using where -drop table t1; -create table t1 (utf8_slovenian_ci char(10) primary key) collate utf8_slovenian_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (utf8_spanish2_ci integer, c char(10), v varchar(20), index(c), index(v)) collate utf8_spanish2_ci engine=ibmdb2i; -CREATE TABLE t1 (utf8_spanish_ci integer, c char(10), v varchar(20), index(c), index(v)) collate utf8_spanish_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 31 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 63 NULL 6 Using where -drop table t1; -create table t1 (utf8_spanish_ci char(10) primary key) collate utf8_spanish_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (utf8_swedish_ci integer, c char(10), v varchar(20), index(c), index(v)) collate utf8_swedish_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 31 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 63 NULL 6 Using where -drop table t1; -create table t1 (utf8_swedish_ci char(10) primary key) collate utf8_swedish_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (utf8_turkish_ci integer, c char(10), v varchar(20), index(c), index(v)) collate utf8_turkish_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 31 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 63 NULL 6 Using where -drop table t1; -create table t1 (utf8_turkish_ci char(10) primary key) collate utf8_turkish_ci engine=ibmdb2i; -drop table t1; -CREATE TABLE t1 (utf8_unicode_ci integer, c char(10), v varchar(20), index(c), index(v)) collate utf8_unicode_ci engine=ibmdb2i; -insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); -insert into t1 select * from t1; -explain select c,v from t1 force index(c) where c like "ab%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range c c 31 NULL 6 Using where -explain select c,v from t1 force index(v) where v like "de%"; -id select_type table type possible_keys key key_len ref rows Extra -1 SIMPLE t1 range v v 63 NULL 6 Using where -drop table t1; -create table t1 (utf8_unicode_ci char(10) primary key) collate utf8_unicode_ci engine=ibmdb2i; -drop table t1; -create table ffd (WHCHD1 CHAR(20), WHCSID decimal(5,0)) engine=ibmdb2i; -create table fd (SQSSEQ CHAR(10)) engine=ibmdb2i; -create temporary table intermed (row integer key auto_increment, cs char(30), ccsid integer); -insert into intermed (cs, ccsid) select * from ffd; -create temporary table intermed2 (row integer key auto_increment, srtseq char(10)); -insert into intermed2 (srtseq) select * from fd; -select ccsid, cs, srtseq from intermed inner join intermed2 on intermed.row = intermed2.row; -ccsid cs srtseq -500 "ascii_bin" QBLA101F4U -500 "ascii_general_ci" QALA101F4S -1200 "big5_bin" QBCHT04B0U -1200 "big5_chinese_ci" QACHT04B0S -1153 "cp1250_bin" QELA20481U -1153 "cp1250_croatian_ci" QALA20481S -1153 "cp1250_general_ci" QCLA20481S -1153 "cp1250_polish_ci" QDLA20481S -1025 "cp1251_bin" QCCYR0401U -1025 "cp1251_bulgarian_ci QACYR0401S -1025 "cp1251_general_ci" QBCYR0401S -1025 "cp1251_general_cs" QBCYR0401U -420 "cp1256_bin" QBARA01A4U -420 "cp1256_general_ci" QAARA01A4S -500 "cp850_bin" QDLA101F4U -500 "cp850_general_ci" QCLA101F4S -870 "cp852_bin" QBLA20366U -870 "cp852_general_ci" QALA20366S -1200 "cp932_bin" QBJPN04B0U -1200 "cp932_japanese_ci" QAJPN04B0S -1200 "euckr_bin" QBKOR04B0U -1200 "euckr_korean_ci" QAKOR04B0S -1200 "gb2312_bin" QBCHS04B0U -1200 "gb2312_chinese_ci" QACHS04B0S -1200 "gbk_bin" QDCHS04B0U -1200 "gbk_chinese_ci" QCCHS04B0S -875 "greek_bin" QBELL036BU -875 "greek_general_ci" QAELL036BS -424 "hebrew_bin" QBHEB01A8U -424 "hebrew_general_ci" QAHEB01A8S -1148 "latin1_bin" QFLA1047CU -1148 "latin1_danish_ci" QALA1047CS -1148 "latin1_general_ci" QBLA1047CS -1148 "latin1_general_cs" QBLA1047CU -1148 "latin1_german1_ci" QCLA1047CS -1148 "latin1_spanish_ci" QDLA1047CS -1148 "latin1_swedish_ci" QELA1047CS -870 "latin2_bin" QGLA20366U -870 "latin2_croatian_ci" QCLA20366S -870 "latin2_general_ci" QELA20366S -870 "latin2_hungarian_ci QFLA20366S -1026 "latin5_bin" QBTRK0402U -1026 "latin5_turkish_ci" QATRK0402S -870 "macce_bin" QILA20366U -870 "macce_general_ci" QHLA20366S -1200 "sjis_bin" QDJPN04B0U -1200 "sjis_japanese_ci" QCJPN04B0S -838 "tis620_bin" QBTHA0346U -838 "tis620_thai_ci" QATHA0346S -13488 "ucs2_bin" *HEX -13488 "ucs2_czech_ci" I34ACS_CZ -13488 "ucs2_danish_ci" I34ADA_DK -13488 "ucs2_esperanto_ci" I34AEO -13488 "ucs2_estonian_ci" I34AET -13488 "ucs2_general_ci" QAUCS04B0S -13488 "ucs2_hungarian_ci" I34AHU -13488 "ucs2_icelandic_ci" I34AIS -13488 "ucs2_latvian_ci" I34ALV -13488 "ucs2_lithuanian_ci" I34ALT -13488 "ucs2_persian_ci" I34AFA -13488 "ucs2_polish_ci" I34APL -13488 "ucs2_romanian_ci" I34ARO -13488 "ucs2_slovak_ci" I34ASK -13488 "ucs2_slovenian_ci" I34ASL -13488 "ucs2_spanish_ci" I34AES -13488 "ucs2_swedish_ci" I34ASW -13488 "ucs2_turkish_ci" I34ATR -13488 "ucs2_unicode_ci" I34AEN -1200 "ujis_bin" QFJPN04B0U -1200 "ujis_japanese_ci" QEJPN04B0S -1208 "utf8_bin" *HEX -1208 "utf8_czech_ci" I34ACS_CZ -1208 "utf8_danish_ci" I34ADA_DK -1208 "utf8_esperanto_ci" I34AEO -1208 "utf8_estonian_ci" I34AET -1200 "utf8_general_ci" QAUCS04B0S -1208 "utf8_hungarian_ci" I34AHU -1208 "utf8_icelandic_ci" I34AIS -1208 "utf8_latvian_ci" I34ALV -1208 "utf8_lithuanian_ci" I34ALT -1208 "utf8_persian_ci" I34AFA -1208 "utf8_polish_ci" I34APL -1208 "utf8_romanian_ci" I34ARO -1208 "utf8_slovak_ci" I34ASK -1208 "utf8_slovenian_ci" I34ASL -1208 "utf8_spanish_ci" I34AES -1208 "utf8_swedish_ci" I34ASW -1208 "utf8_turkish_ci" I34ATR -1208 "utf8_unicode_ci" I34AEN -drop table ffd, fd; diff --git a/mysql-test/suite/ibmdb2i/t/ibmdb2i_bug_44020.test b/mysql-test/suite/ibmdb2i/t/ibmdb2i_bug_44020.test deleted file mode 100644 index 09a7c75cfc0..00000000000 --- a/mysql-test/suite/ibmdb2i/t/ibmdb2i_bug_44020.test +++ /dev/null @@ -1,9 +0,0 @@ -source suite/ibmdb2i/include/have_ibmdb2i.inc; -source include/have_case_sensitive_file_system.inc; - -create schema `A12345_@$#`; -create table `A12345_@$#`.t1 (i int) engine=ibmdb2i; -show create table `A12345_@$#`.t1; -select * from `A12345_@$#`.t1; -drop table `A12345_@$#`.t1; -drop schema `A12345_@$#`; diff --git a/mysql-test/suite/ibmdb2i/t/ibmdb2i_bug_44025.test b/mysql-test/suite/ibmdb2i/t/ibmdb2i_bug_44025.test deleted file mode 100644 index 9b033a2298f..00000000000 --- a/mysql-test/suite/ibmdb2i/t/ibmdb2i_bug_44025.test +++ /dev/null @@ -1,9 +0,0 @@ -source suite/ibmdb2i/include/have_ibmdb2i.inc; -source suite/ibmdb2i/include/have_i61.inc; - - -create table t1 (c char(10) collate utf8_swedish_ci, index(c)) engine=ibmdb2i; -drop table t1; - -create table t1 (c char(10) collate ucs2_swedish_ci, index(c)) engine=ibmdb2i; -drop table t1; diff --git a/mysql-test/suite/ibmdb2i/t/ibmdb2i_bug_44232.test b/mysql-test/suite/ibmdb2i/t/ibmdb2i_bug_44232.test deleted file mode 100755 index ea29b5abcd4..00000000000 --- a/mysql-test/suite/ibmdb2i/t/ibmdb2i_bug_44232.test +++ /dev/null @@ -1,8 +0,0 @@ ---source suite/ibmdb2i/include/have_ibmdb2i.inc ---source suite/ibmdb2i/include/have_i54.inc - ---error 1005 -create table t1 (c char(1) character set armscii8) engine=ibmdb2i; - ---error 1005 -create table t1 (c char(1) character set eucjpms ) engine=ibmdb2i; diff --git a/mysql-test/suite/ibmdb2i/t/ibmdb2i_bug_44610.test b/mysql-test/suite/ibmdb2i/t/ibmdb2i_bug_44610.test deleted file mode 100755 index da69b5d9148..00000000000 --- a/mysql-test/suite/ibmdb2i/t/ibmdb2i_bug_44610.test +++ /dev/null @@ -1,28 +0,0 @@ -source suite/ibmdb2i/include/have_ibmdb2i.inc; - -# Test RCDFMT generation for a variety of kinds of table names -create table ABC (i int) engine=ibmdb2i; -drop table ABC; - -create table `1234567890ABC` (i int) engine=ibmdb2i; -drop table `1234567890ABC`; - -create table `!@#$%` (i int) engine=ibmdb2i; -drop table `!@#$%`; - -create table `ABCD#########` (i int) engine=ibmdb2i; -drop table `ABCD#########`; - -create table `_` (i int) engine=ibmdb2i; -drop table `_`; - -create table `abc##def` (i int) engine=ibmdb2i; -drop table `abc##def`; - -set names utf8; -create table İ (s1 int) engine=ibmdb2i; -drop table İ; - -create table İİ (s1 int) engine=ibmdb2i; -drop table İİ; -set names latin1; diff --git a/mysql-test/suite/ibmdb2i/t/ibmdb2i_bug_45196.test b/mysql-test/suite/ibmdb2i/t/ibmdb2i_bug_45196.test deleted file mode 100644 index 17b1d658975..00000000000 --- a/mysql-test/suite/ibmdb2i/t/ibmdb2i_bug_45196.test +++ /dev/null @@ -1,26 +0,0 @@ -source suite/ibmdb2i/include/have_ibmdb2i.inc; -source suite/ibmdb2i/include/have_i61.inc; - ---disable_warnings -drop table if exists t1; ---enable_warnings - -create table t1 (c char(10), index(c)) collate ucs2_czech_ci engine=ibmdb2i; -insert into t1 values ("ch"),("h"),("i"); -select * from t1 order by c; -drop table t1; - -create table t1 (c char(10), index(c)) collate utf8_czech_ci engine=ibmdb2i; -insert into t1 values ("ch"),("h"),("i"); -select * from t1 order by c; -drop table t1; - -create table t1 (c char(10), index(c)) collate ucs2_danish_ci engine=ibmdb2i; -insert into t1 values("abc"),("abcd"),("aaaa"); -select c from t1 order by c; -drop table t1; - -create table t1 (c char(10), index(c)) collate utf8_danish_ci engine=ibmdb2i; -insert into t1 values("abc"),("abcd"),("aaaa"); -select c from t1 order by c; -drop table t1; diff --git a/mysql-test/suite/ibmdb2i/t/ibmdb2i_bug_45793.test b/mysql-test/suite/ibmdb2i/t/ibmdb2i_bug_45793.test deleted file mode 100644 index 93fb78ff421..00000000000 --- a/mysql-test/suite/ibmdb2i/t/ibmdb2i_bug_45793.test +++ /dev/null @@ -1,11 +0,0 @@ -source suite/ibmdb2i/include/have_ibmdb2i.inc; -source suite/ibmdb2i/include/have_i61.inc; - ---disable_warnings -drop table if exists t1; ---enable_warnings - -create table t1 (c char(10), index(c)) charset macce engine=ibmdb2i; -insert into t1 values ("test"); -select * from t1 order by c; -drop table t1; diff --git a/mysql-test/suite/ibmdb2i/t/ibmdb2i_bug_45983.test b/mysql-test/suite/ibmdb2i/t/ibmdb2i_bug_45983.test deleted file mode 100644 index 695d8e90ada..00000000000 --- a/mysql-test/suite/ibmdb2i/t/ibmdb2i_bug_45983.test +++ /dev/null @@ -1,47 +0,0 @@ -source suite/ibmdb2i/include/have_ibmdb2i.inc; - -# Confirm that ibmdb2i_create_index_option causes additional *HEX sorted indexes to be created for all non-binary keys. - -set ibmdb2i_create_index_option=1; ---disable_warnings -drop schema if exists test1; -create schema test1; -use test1; ---enable_warnings - ---disable_abort_on_error ---error 0,255 -exec system "DLTF QGPL/FDOUT" > /dev/null; ---enable_abort_on_error - -#No additional index because no string fields in key -CREATE TABLE t1 (f int primary key, index(f)) engine=ibmdb2i; ---error 255 -exec system "DSPFD FILE(\"test1\"/PRIM0001) TYPE(*SEQ) OUTPUT(*OUTFILE) OUTFILE(QGPL/FDOUT) OUTMBR(*FIRST *ADD)" > /dev/null; ---error 255 -exec system "DSPFD FILE(\"test1\"/\"f___H_t1\") TYPE(*SEQ) OUTPUT(*OUTFILE) OUTFILE(QGPL/FDOUT) OUTMBR(*FIRST *ADD)" > /dev/null; -drop table t1; - -#No additional index because binary sorting -CREATE TABLE t1 (f char(10) collate utf8_bin primary key, index(f)) engine=ibmdb2i; ---error 255 -exec system "DSPFD FILE(\"test1\"/PRIM0001) TYPE(*SEQ) OUTPUT(*OUTFILE) OUTFILE(QGPL/FDOUT) OUTMBR(*FIRST *ADD)" > /dev/null; ---error 255 -exec system "DSPFD FILE(\"test1\"/\"f___H_t1\") TYPE(*SEQ) OUTPUT(*OUTFILE) OUTFILE(QGPL/FDOUT) OUTMBR(*FIRST *ADD)" > /dev/null; -drop table t1; - -CREATE TABLE t1 (f char(10) collate latin1_swedish_ci primary key, index(f)) engine=ibmdb2i; -exec system "DSPFD FILE(\"test1\"/PRIM0001) TYPE(*SEQ) OUTPUT(*OUTFILE) OUTFILE(QGPL/FDOUT) OUTMBR(*FIRST *ADD)" > /dev/null; -exec system "DSPFD FILE(\"test1\"/\"f___H_t1\") TYPE(*SEQ) OUTPUT(*OUTFILE) OUTFILE(QGPL/FDOUT) OUTMBR(*FIRST *ADD)" > /dev/null; -drop table t1; - -CREATE TABLE t1 (f char(10) collate latin1_swedish_ci primary key, i int, index i(i,f)) engine=ibmdb2i; -exec system "DSPFD FILE(\"test1\"/PRIM0001) TYPE(*SEQ) OUTPUT(*OUTFILE) OUTFILE(QGPL/FDOUT) OUTMBR(*FIRST *ADD)" > /dev/null; -exec system "DSPFD FILE(\"test1\"/\"i___H_t1\") TYPE(*SEQ) OUTPUT(*OUTFILE) OUTFILE(QGPL/FDOUT) OUTMBR(*FIRST *ADD)" > /dev/null; -drop table t1; - - -create table fd (SQSSEQ CHAR(10)) engine=ibmdb2i; -system system "CPYF FROMFILE(QGPL/FDOUT) TOFILE(\"test1\"/\"fd\") mbropt(*replace) fmtopt(*drop *map)" > /dev/null; -select * from fd; -drop table fd; diff --git a/mysql-test/suite/ibmdb2i/t/ibmdb2i_bug_49329.test b/mysql-test/suite/ibmdb2i/t/ibmdb2i_bug_49329.test deleted file mode 100644 index 615df284d8f..00000000000 --- a/mysql-test/suite/ibmdb2i/t/ibmdb2i_bug_49329.test +++ /dev/null @@ -1,10 +0,0 @@ -source suite/ibmdb2i/include/have_ibmdb2i.inc; -source include/have_case_sensitive_file_system.inc; - -create table ABC (i int) engine=ibmdb2i; -insert into ABC values(1); -create table abc (i int) engine=ibmdb2i; -insert into abc values (2); -select * from ABC; -drop table ABC; -drop table abc; diff --git a/mysql-test/suite/ibmdb2i/t/ibmdb2i_collations.test b/mysql-test/suite/ibmdb2i/t/ibmdb2i_collations.test deleted file mode 100644 index 899f330d360..00000000000 --- a/mysql-test/suite/ibmdb2i/t/ibmdb2i_collations.test +++ /dev/null @@ -1,44 +0,0 @@ -source suite/ibmdb2i/include/have_ibmdb2i.inc; -source suite/ibmdb2i/include/have_i61.inc; ---disable_warnings -drop table if exists t1, ffd, fd; ---enable_warnings - ---disable_abort_on_error ---error 0,255 -exec system "DLTF QGPL/FFDOUT" > /dev/null; ---error 0,255 -exec system "DLTF QGPL/FDOUT" > /dev/null; ---enable_abort_on_error -let $count= query_get_value(select count(*) from information_schema.COLLATIONS where COLLATION_NAME <> "binary", count(*),1); - -while ($count) -{ - let $collation = query_get_value(select COLLATION_NAME from information_schema.COLLATIONS where COLLATION_NAME <> "binary" order by COLLATION_NAME desc, COLLATION_NAME, $count); - error 0,1005,2504,2028; - eval CREATE TABLE t1 ($collation integer, c char(10), v varchar(20), index(c), index(v)) collate $collation engine=ibmdb2i; - if (!$mysql_errno) - { - insert into t1 (c,v) values ("abc","def"),("abcd", "def"),("abcde","defg"),("aaaa","bbbb"); - insert into t1 select * from t1; - explain select c,v from t1 force index(c) where c like "ab%"; - explain select c,v from t1 force index(v) where v like "de%"; - drop table t1; - eval create table t1 ($collation char(10) primary key) collate $collation engine=ibmdb2i; - system system "DSPFFD FILE(\"test\"/\"t1\") OUTPUT(*OUTFILE) OUTFILE(QGPL/FFDOUT) OUTMBR(*FIRST *ADD)" > /dev/null; - system system "DSPFD FILE(\"test\"/\"t1\") TYPE(*SEQ) OUTPUT(*OUTFILE) OUTFILE(QGPL/FDOUT) OUTMBR(*FIRST *ADD)" > /dev/null; - drop table t1; - } - dec $count; -} - -create table ffd (WHCHD1 CHAR(20), WHCSID decimal(5,0)) engine=ibmdb2i; -system system "CPYF FROMFILE(QGPL/FFDOUT) TOFILE(\"test\"/\"ffd\") mbropt(*replace) fmtopt(*drop *map)" > /dev/null; -create table fd (SQSSEQ CHAR(10)) engine=ibmdb2i; -system system "CPYF FROMFILE(QGPL/FDOUT) TOFILE(\"test\"/\"fd\") mbropt(*replace) fmtopt(*drop *map)" > /dev/null; -create temporary table intermed (row integer key auto_increment, cs char(30), ccsid integer); -insert into intermed (cs, ccsid) select * from ffd; -create temporary table intermed2 (row integer key auto_increment, srtseq char(10)); -insert into intermed2 (srtseq) select * from fd; -select ccsid, cs, srtseq from intermed inner join intermed2 on intermed.row = intermed2.row; -drop table ffd, fd; diff --git a/storage/ibmdb2i/CMakeLists.txt b/storage/ibmdb2i/CMakeLists.txt deleted file mode 100644 index 11cc4300569..00000000000 --- a/storage/ibmdb2i/CMakeLists.txt +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright (C) 2006 MySQL AB -# -# This program is free software; you can redistribute it and/or modify -# it under the terms of the GNU General Public License as published by -# the Free Software Foundation; version 2 of the License. -# -# This program is distributed in the hope that it will be useful, -# but WITHOUT ANY WARRANTY; without even the implied warranty of -# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the -# GNU General Public License for more details. -# -# You should have received a copy of the GNU General Public License -# along with this program; if not, write to the Free Software -# Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA - -SET(CMAKE_CXX_FLAGS_DEBUG "${CMAKE_CXX_FLAGS_DEBUG} -DSAFEMALLOC -DSAFE_MUTEX") -SET(CMAKE_C_FLAGS_DEBUG "${CMAKE_C_FLAGS_DEBUG} -DSAFEMALLOC -DSAFE_MUTEX") - -INCLUDE_DIRECTORIES(${CMAKE_SOURCE_DIR}/include ${CMAKE_SOURCE_DIR}/sql - ${CMAKE_SOURCE_DIR}/regex - ${CMAKE_SOURCE_DIR}/extra/yassl/include) -ADD_LIBRARY(ibmdb2i ha_ibmdb2i.cc db2i_ileBridge.cc db2i_conversion.cc - db2i_blobCollection.cc db2i_file.cc db2i_charsetSupport.cc - db2i_collationSupport.cc db2i_errors.cc db2i_constraints.cc - db2i_rir.cc db2i_sqlStatementStream.cc db2i_ioBuffers.cc db2i_myconv.cc) diff --git a/storage/ibmdb2i/Makefile.am b/storage/ibmdb2i/Makefile.am deleted file mode 100644 index b9602e392e0..00000000000 --- a/storage/ibmdb2i/Makefile.am +++ /dev/null @@ -1,54 +0,0 @@ -# -# Copyright (c) 2007, 2008, IBM Corporation. -# All rights reserved. -# -# - -#called from the top level Makefile - -MYSQLDATAdir = $(localstatedir) -MYSQLSHAREdir = $(pkgdatadir) -MYSQLBASEdir= $(prefix) -MYSQLLIBdir= $(pkglibdir) -pkgplugindir = $(pkglibdir)/plugin -INCLUDES = -I$(top_srcdir)/include -I$(top_builddir)/include \ - -I$(top_srcdir)/regex \ - -I$(top_srcdir)/sql \ - -I$(srcdir) \ - -I$ /afs/rchland.ibm.com/lande/shadow/dev2000/osxpf/v5r4m0f.xpf/cur/cmvc/base.pgm/my.xpf/apis \ - -I$ /afs/rchland.ibm.com/lande/shadow/dev2000/osxpf/v5r4m0.xpf/bld/cmvc/base.pgm/lg.xpf \ - -I$ /afs/rchland.ibm.com/lande/shadow/dev2000/osxpf/v5r4m0.xpf/bld/cmvc/base.pgm/tq.xpf -WRAPLIBS= - -LDADD = - -DEFS = @DEFS@ - -noinst_HEADERS = ha_ibmdb2i.h db2i_collationSupport.h db2i_file.h \ - db2i_ioBuffers.h db2i_blobCollection.h \ - db2i_global.h db2i_misc.h db2i_charsetSupport.h db2i_errors.h \ - db2i_iconv.h db2i_myconv.h db2i_safeString.h db2i_sqlStatementStream.h \ - db2i_ileBridge.h db2i_validatedPointer.h - -EXTRA_LTLIBRARIES = ha_ibmdb2i.la -pkgplugin_LTLIBRARIES = @plugin_ibmdb2i_shared_target@ -ha_ibmdb2i_la_LIBADD = -liconv -ha_ibmdb2i_la_LDFLAGS = -module -rpath $(MYSQLLIBdir) -ha_ibmdb2i_la_CXXFLAGS= $(AM_CXXFLAGS) -DMYSQL_DYNAMIC_PLUGIN -ha_ibmdb2i_la_CFLAGS = $(AM_CFLAGS) -DMYSQL_DYNAMIC_PLUGIN -ha_ibmdb2i_la_SOURCES = ha_ibmdb2i.cc db2i_ileBridge.cc db2i_conversion.cc \ - db2i_blobCollection.cc db2i_file.cc db2i_charsetSupport.cc \ - db2i_collationSupport.cc db2i_errors.cc db2i_constraints.cc \ - db2i_rir.cc db2i_sqlStatementStream.cc db2i_ioBuffers.cc \ - db2i_myconv.cc - -EXTRA_LIBRARIES = libibmdb2i.a -noinst_LIBRARIES = @plugin_ibmdb2i_static_target@ -libibmdb2i_a_CXXFLAGS = $(AM_CXXFLAGS) -libibmdb2i_a_CFLAGS = $(AM_CFLAGS) -libibmdb2i_a_SOURCES= $(ha_ibmdb2i_la_SOURCES) - - -EXTRA_DIST = CMakeLists.txt plug.in -# Don't update the files from bitkeeper -%::SCCS/s.% diff --git a/storage/ibmdb2i/db2i_blobCollection.cc b/storage/ibmdb2i/db2i_blobCollection.cc deleted file mode 100644 index 17101c9c0a4..00000000000 --- a/storage/ibmdb2i/db2i_blobCollection.cc +++ /dev/null @@ -1,107 +0,0 @@ -/* -Licensed Materials - Property of IBM -DB2 Storage Engine Enablement -Copyright IBM Corporation 2007,2008 -All rights reserved - -Redistribution and use in source and binary forms, with or without modification, -are permitted provided that the following conditions are met: - (a) Redistributions of source code must retain this list of conditions, the - copyright notice in section {d} below, and the disclaimer following this - list of conditions. - (b) Redistributions in binary form must reproduce this list of conditions, the - copyright notice in section (d) below, and the disclaimer following this - list of conditions, in the documentation and/or other materials provided - with the distribution. - (c) The name of IBM may not be used to endorse or promote products derived from - this software without specific prior written permission. - (d) The text of the required copyright notice is: - Licensed Materials - Property of IBM - DB2 Storage Engine Enablement - Copyright IBM Corporation 2007,2008 - All rights reserved - -THIS SOFTWARE IS PROVIDED BY IBM CORPORATION "AS IS" AND ANY EXPRESS OR IMPLIED -WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF -MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT -SHALL IBM CORPORATION BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, -EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT -OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS -INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN -CONTRACT, STRICT LIABILITY, OR TORT INCLUDING NEGLIGENCE OR OTHERWISE) ARISING -IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY -OF SUCH DAMAGE. -*/ - - -#include "db2i_blobCollection.h" - -/** - Return the size to use when allocating space for blob reads. - - @param fieldIndex The field to allocate for - @param[out] shouldProtect Indicates whether storage protection should be - applied to the space, because the size returned is - smaller than the maximum possible size. -*/ - -uint32 -BlobCollection::getSizeToAllocate(int fieldIndex, bool& shouldProtect) -{ - Field* field = table->getMySQLTable()->field[fieldIndex]; - uint fieldLength = field->max_display_length(); - - if (fieldLength <= MAX_FULL_ALLOCATE_BLOB_LENGTH) - { - shouldProtect = false; - return fieldLength; - } - - shouldProtect = true; - - uint curMaxSize = table->getBlobFieldActualSize(fieldIndex); - - uint defaultAllocSize = min(defaultAllocation, fieldLength); - - return max(defaultAllocSize, curMaxSize); - -} - -void -BlobCollection::generateBuffer(int fieldIndex) -{ - DBUG_ASSERT(table->db2Field(fieldIndex).isBlob()); - - bool protect; - buffers[table->getBlobIdFromField(fieldIndex)].Malloc(getSizeToAllocate(fieldIndex, protect), protect); - - return; -} - -/** - Realloc the read buffer associated with a blob field. - - This is used when the previous allocation for a blob field is found to be - too small (this is discovered when QMY_READ trips over the protected boundary - page). - - @param fieldIndex The field to be reallocated - @param size The size of buffer to allocate for this field. -*/ - -ValidatedPointer& -BlobCollection::reallocBuffer(int fieldIndex, size_t size) -{ - ProtectedBuffer& buf = buffers[table->getBlobIdFromField(fieldIndex)]; - if (size <= buf.allocLen()) - return buf.ptr(); - - table->updateBlobFieldActualSize(fieldIndex, size); - - DBUG_PRINT("BlobCollection::reallocBuffer",("PERF: reallocing %d to %d: ", fieldIndex, size)); - - bool protect; - buf.Free(); - buf.Malloc(getSizeToAllocate(fieldIndex, protect), protect); - return buf.ptr(); -} diff --git a/storage/ibmdb2i/db2i_blobCollection.h b/storage/ibmdb2i/db2i_blobCollection.h deleted file mode 100644 index 6a60394555f..00000000000 --- a/storage/ibmdb2i/db2i_blobCollection.h +++ /dev/null @@ -1,151 +0,0 @@ -/* -Licensed Materials - Property of IBM -DB2 Storage Engine Enablement -Copyright IBM Corporation 2007,2008 -All rights reserved - -Redistribution and use in source and binary forms, with or without modification, -are permitted provided that the following conditions are met: - (a) Redistributions of source code must retain this list of conditions, the - copyright notice in section {d} below, and the disclaimer following this - list of conditions. - (b) Redistributions in binary form must reproduce this list of conditions, the - copyright notice in section (d) below, and the disclaimer following this - list of conditions, in the documentation and/or other materials provided - with the distribution. - (c) The name of IBM may not be used to endorse or promote products derived from - this software without specific prior written permission. - (d) The text of the required copyright notice is: - Licensed Materials - Property of IBM - DB2 Storage Engine Enablement - Copyright IBM Corporation 2007,2008 - All rights reserved - -THIS SOFTWARE IS PROVIDED BY IBM CORPORATION "AS IS" AND ANY EXPRESS OR IMPLIED -WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF -MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT -SHALL IBM CORPORATION BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, -EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT -OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS -INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN -CONTRACT, STRICT LIABILITY, OR TORT INCLUDING NEGLIGENCE OR OTHERWISE) ARISING -IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY -OF SUCH DAMAGE. -*/ - - -#ifndef DB2I_BLOBCOLLECTION_H -#define DB2I_BLOBCOLLECTION_H - -#include "db2i_global.h" -#include "db2i_file.h" - -/** - @class ProtectedBuffer - @brief Implements memory management for (optionally) protected buffers. - - Buffers created with the protection option will have a guard page set on the - page following requested allocation size. The side effect is that the actual - allocation is up to 2*4096-1 bytes larger than the size requested by the - using code. -*/ - -class ProtectedBuffer -{ -public: - ProtectedBuffer() : protectBuf(false) - {;} - - void Malloc(size_t size, bool protect = false) - { - protectBuf = protect; - bufptr.alloc(size + (protectBuf ? 0x1fff : 0x0)); - if ((void*)bufptr != NULL) - { - len = size; - if (protectBuf) - mprotect(protectedPage(), 0x1000, PROT_NONE); -#ifndef DBUG_OFF - // Prevents a problem with DBUG_PRINT over-reading in recent versions of - // MySQL - *((char*)protectedPage()-1) = 0; -#endif - } - } - - void Free() - { - if ((void*)bufptr != NULL) - { - if (protectBuf) - mprotect(protectedPage(), 0x1000, PROT_READ | PROT_WRITE); - bufptr.dealloc(); - } - } - - ~ProtectedBuffer() - { - Free(); - } - - ValidatedPointer& ptr() {return bufptr;} - bool isProtected() const {return protectBuf;} - size_t allocLen() const {return len;} -private: - void* protectedPage() - { - return (void*)(((address64_t)(void*)bufptr + len + 0x1000) & ~0xfff); - } - - ValidatedPointer bufptr; - size_t len; - bool protectBuf; - -}; - - -/** - @class BlobCollection - @brief Manages memory allocation for reading blobs associated with a table. - - Allocations are done on-demand and are protected with a guard page if less - than the max possible size is allocated. -*/ -class BlobCollection -{ - public: - BlobCollection(db2i_table* db2Table, uint32 defaultAllocSize) : - defaultAllocation(defaultAllocSize), table(db2Table) - { - buffers = new ProtectedBuffer[table->getBlobCount()]; - } - - ~BlobCollection() - { - delete[] buffers; - } - - ValidatedPointer& getBufferPtr(int fieldIndex) - { - int blobIndex = table->getBlobIdFromField(fieldIndex); - if ((char*)buffers[blobIndex].ptr() == NULL) - generateBuffer(fieldIndex); - - return buffers[blobIndex].ptr(); - } - - ValidatedPointer& reallocBuffer(int fieldIndex, size_t size); - - - private: - - uint32 getSizeToAllocate(int fieldIndex, bool& shouldProtect); - void generateBuffer(int fieldIndex); - - db2i_table* table; // The table being read - ProtectedBuffer* buffers; // The buffers - uint32 defaultAllocation; - /* The default size to use when first allocating a buffer */ -}; - -#endif diff --git a/storage/ibmdb2i/db2i_charsetSupport.cc b/storage/ibmdb2i/db2i_charsetSupport.cc deleted file mode 100644 index 83bf1b9448b..00000000000 --- a/storage/ibmdb2i/db2i_charsetSupport.cc +++ /dev/null @@ -1,826 +0,0 @@ -/* -Licensed Materials - Property of IBM -DB2 Storage Engine Enablement -Copyright IBM Corporation 2007,2008 -All rights reserved - -Redistribution and use in source and binary forms, with or without modification, -are permitted provided that the following conditions are met: - (a) Redistributions of source code must retain this list of conditions, the - copyright notice in section {d} below, and the disclaimer following this - list of conditions. - (b) Redistributions in binary form must reproduce this list of conditions, the - copyright notice in section (d) below, and the disclaimer following this - list of conditions, in the documentation and/or other materials provided - with the distribution. - (c) The name of IBM may not be used to endorse or promote products derived from - this software without specific prior written permission. - (d) The text of the required copyright notice is: - Licensed Materials - Property of IBM - DB2 Storage Engine Enablement - Copyright IBM Corporation 2007,2008 - All rights reserved - -THIS SOFTWARE IS PROVIDED BY IBM CORPORATION "AS IS" AND ANY EXPRESS OR IMPLIED -WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF -MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT -SHALL IBM CORPORATION BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, -EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT -OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS -INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN -CONTRACT, STRICT LIABILITY, OR TORT INCLUDING NEGLIGENCE OR OTHERWISE) ARISING -IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY -OF SUCH DAMAGE. -*/ - - - -#include "db2i_charsetSupport.h" -#include "as400_types.h" -#include "as400_protos.h" -#include "db2i_ileBridge.h" -#include "qlgusr.h" -#include "db2i_errors.h" - - -/* - The following arrays define a mapping between IANA-style text descriptors and - IBM i CCSID text descriptors. The mapping is a 1-to-1 correlation between - corresponding array slots. -*/ -#define MAX_IANASTRING 23 -static const char ianaStringType[MAX_IANASTRING][10] = -{ - {"ascii"}, - {"Big5"}, //big5 - {"cp1250"}, - {"cp1251"}, - {"cp1256"}, - {"cp850"}, - {"cp852"}, - {"cp866"}, - {"IBM943"}, //cp932 - {"EUC-KR"}, //euckr - {"IBM1381"}, //gb2312 - {"IBM1386"}, //gbk - {"greek"}, - {"hebrew"}, - {"latin1"}, - {"latin2"}, - {"latin5"}, - {"macce"}, - {"tis620"}, - {"Shift_JIS"}, //sjis - {"ucs2"}, - {"EUC-JP"}, //ujis - {"utf8"} -}; -static const char ccsidType[MAX_IANASTRING][6] = -{ - {"367"}, //ascii - {"950"}, //big5 - {"1250"}, //cp1250 - {"1251"}, //cp1251 - {"1256"}, //cp1256 - {"850"}, //cp850 - {"852"}, //cp852 - {"866"}, //cp866 - {"943"}, //cp932 - {"970"}, //euckr - {"1381"}, //gb2312 - {"1386"}, //gbk - {"813"}, //greek - {"916"}, //hebrew - {"923"}, //latin1 - {"912"}, //latin2 - {"920"}, //latin5 - {"1282"}, //macce - {"874"}, //tis620 - {"943"}, //sjis - {"13488"},//ucs2 - {"5050"}, //ujis - {"1208"} //utf8 -}; - -static _ILEpointer *QlgCvtTextDescToDesc_sym; - -/* We keep a cache of the mapping for text descriptions obtained via - QlgTextDescToDesc. The following structures implement this cache. */ -static HASH textDescMapHash; -static MEM_ROOT textDescMapMemroot; -static pthread_mutex_t textDescMapHashMutex; -struct TextDescMap -{ - struct HashKey - { - int32 inType; - int32 outType; - char inDesc[Qlg_MaxDescSize]; - } hashKey; - char outDesc[Qlg_MaxDescSize]; -}; - -/* We keep a cache of the mapping for open iconv descriptors. The following - structures implement this cache. */ -static HASH iconvMapHash; -static MEM_ROOT iconvMapMemroot; -static pthread_mutex_t iconvMapHashMutex; -struct IconvMap -{ - struct HashKey - { - uint32 direction; // These are uint32s to avoid garbage data in the key from compiler padding - uint32 db2CCSID; - const CHARSET_INFO* myCharset; - } hashKey; - iconv_t iconvDesc; -}; - - -/** - Initialize the static structures used by this module. - - This must only be called once per plugin instantiation. - - @return 0 if successful. Failure otherwise -*/ -int32 initCharsetSupport() -{ - DBUG_ENTER("initCharsetSupport"); - - int actmark = _ILELOAD("QSYS/QLGUSR", ILELOAD_LIBOBJ); - if ( actmark == -1 ) - { - DBUG_PRINT("initCharsetSupport", ("conversion srvpgm activation failed")); - DBUG_RETURN(1); - } - - QlgCvtTextDescToDesc_sym = (ILEpointer*)malloc_aligned(sizeof(ILEpointer)); - if (_ILESYM(QlgCvtTextDescToDesc_sym, actmark, "QlgCvtTextDescToDesc") == -1) - { - DBUG_PRINT("initCharsetSupport", - ("resolve of QlgCvtTextDescToDesc failed")); - DBUG_RETURN(errno); - } - - VOID(pthread_mutex_init(&textDescMapHashMutex,MY_MUTEX_INIT_FAST)); - hash_init(&textDescMapHash, &my_charset_bin, 10, offsetof(TextDescMap, hashKey), sizeof(TextDescMap::hashKey), 0, 0, HASH_UNIQUE); - - VOID(pthread_mutex_init(&iconvMapHashMutex,MY_MUTEX_INIT_FAST)); - hash_init(&iconvMapHash, &my_charset_bin, 10, offsetof(IconvMap, hashKey), sizeof(IconvMap::hashKey), 0, 0, HASH_UNIQUE); - - init_alloc_root(&textDescMapMemroot, 2048, 0); - init_alloc_root(&iconvMapMemroot, 256, 0); - - initMyconv(); - - DBUG_RETURN(0); -} - -/** - Cleanup the static structures used by this module. - - This must only be called once per plugin instantiation and only if - initCharsetSupport() was successful. -*/ -void doneCharsetSupport() -{ - cleanupMyconv(); - - free_root(&textDescMapMemroot, 0); - free_root(&iconvMapMemroot, 0); - - pthread_mutex_destroy(&textDescMapHashMutex); - hash_free(&textDescMapHash); - pthread_mutex_destroy(&iconvMapHashMutex); - hash_free(&iconvMapHash); - free_aligned(QlgCvtTextDescToDesc_sym); -} - - -/** - Convert a text description from one type to another. - - This function is just a wrapper for the IBM i QlgTextDescToDesc function plus - some overrides for conversions that the API does not handle correctly and - support for caching the computed conversion. - - @param inType The type of descriptor pointed to by "in". - @param outType The type of descriptor requested for "out". - @param in The descriptor to be convereted. - @param[out] out The equivalent descriptor - @param hashKey The hash key to be used for caching the conversion result. - - @return 0 if successful. Failure otherwise -*/ -static int32 getNewTextDesc(const int32 inType, - const int32 outType, - const char* in, - char* out, - const TextDescMap::HashKey* hashKey) -{ - DBUG_ENTER("db2i_charsetSupport::getNewTextDesc"); - const arg_type_t signature[] = { ARG_INT32, ARG_INT32, ARG_MEMPTR, ARG_INT32, ARG_MEMPTR, ARG_INT32, ARG_INT32, ARG_END }; - struct ArgList - { - ILEarglist_base base; - int32 CRDIInType; - int32 CRDIOutType; - ILEpointer CRDIDesc; - int32 CRDIDescSize; - ILEpointer CRDODesc; - int32 CRDODescSize; - int32 CTDCCSID; - } *arguments; - - if ((inType == Qlg_TypeIANA) && (outType == Qlg_TypeAix41)) - { - // Override non-standard charsets - if (unlikely(strcmp("IBM1381", in) == 0)) - { - strcpy(out, "IBM-1381"); - DBUG_RETURN(0); - } - } - else if ((inType == Qlg_TypeAS400CCSID) && (outType == Qlg_TypeAix41)) - { - // Override non-standard charsets - if (strcmp("1148", in) == 0) - { - strcpy(out, "IBM-1148"); - DBUG_RETURN(0); - } - else if (unlikely(strcmp("1153", in) == 0)) - { - strcpy(out, "IBM-1153"); - DBUG_RETURN(0); - } - } - - char argBuf[sizeof(ArgList)+15]; - arguments = (ArgList*)roundToQuadWordBdy(argBuf); - - arguments->CRDIInType = inType; - arguments->CRDIOutType = outType; - arguments->CRDIDesc.s.addr = (address64_t) in; - arguments->CRDIDescSize = Qlg_MaxDescSize; - arguments->CRDODesc.s.addr = (address64_t) out; - arguments->CRDODescSize = Qlg_MaxDescSize; - arguments->CTDCCSID = 819; - _ILECALL(QlgCvtTextDescToDesc_sym, - &arguments->base, - signature, - RESULT_INT32); - if (unlikely(arguments->base.result.s_int32.r_int32 < 0)) - { - if (arguments->base.result.s_int32.r_int32 == Qlg_InDescriptorNotFound) - { - DBUG_RETURN(DB2I_ERR_UNSUPP_CHARSET); - } - else - { - getErrTxt(DB2I_ERR_ILECALL,"QlgCvtTextDescToDesc",arguments->base.result.s_int32.r_int32); - DBUG_RETURN(DB2I_ERR_ILECALL); - } - } - - // Store the conversion information into a cache entry - TextDescMap* mapping = (TextDescMap*)alloc_root(&textDescMapMemroot, sizeof(TextDescMap)); - if (unlikely(!mapping)) - DBUG_RETURN(HA_ERR_OUT_OF_MEM); - memcpy(&(mapping->hashKey), hashKey, sizeof(hashKey)); - strcpy(mapping->outDesc, out); - pthread_mutex_lock(&textDescMapHashMutex); - my_hash_insert(&textDescMapHash, (const uchar*)mapping); - pthread_mutex_unlock(&textDescMapHashMutex); - - DBUG_RETURN(0); -} - - -/** - Convert a text description from one type to another. - - This function takes a text description in one representation and converts - it into another representation. Although the OS provides some facilities for - doing this, the support is not complete, nor does MySQL always use standard - identifiers. Therefore, there are a lot of hardcoded overrides required. - There is probably some room for optimization here, but this should not be - called frequently under most circumstances. - - @param inType The type of descriptor pointed to by "in". - @param outType The type of descriptor requested for "out". - @param in The descriptor to be convereted. - @param[out] out The equivalent descriptor - - @return 0 if successful. Failure otherwise -*/ -static int32 convertTextDesc(const int32 inType, const int32 outType, const char* inDesc, char* outDesc) -{ - DBUG_ENTER("db2i_charsetSupport::convertTextDesc"); - const char* inDescOverride; - - if (inType == Qlg_TypeIANA) - { - // Override non-standard charsets - if (strcmp("big5", inDesc) == 0) - inDescOverride = "Big5"; - else if (strcmp("cp932", inDesc) == 0) - inDescOverride = "IBM943"; - else if (strcmp("euckr", inDesc) == 0) - inDescOverride = "EUC-KR"; - else if (strcmp("gb2312", inDesc) == 0) - inDescOverride = "IBM1381"; - else if (strcmp("gbk", inDesc) == 0) - inDescOverride = "IBM1386"; - else if (strcmp("sjis", inDesc) == 0) - inDescOverride = "Shift_JIS"; - else if (strcmp("ujis", inDesc) == 0) - inDescOverride = "EUC-JP"; - else - inDescOverride = inDesc; - - // Hardcode non-standard charsets - if (outType == Qlg_TypeAix41) - { - if (strcmp("Big5", inDescOverride) == 0) - { - strcpy(outDesc,"big5"); - DBUG_RETURN(0); - } - else if (strcmp("IBM1386", inDescOverride) == 0) - { - strcpy(outDesc,"GBK"); - DBUG_RETURN(0); - } - else if (strcmp("Shift_JIS", inDescOverride) == 0 || - strcmp("IBM943", inDescOverride) == 0) - { - strcpy(outDesc,"IBM-943"); - DBUG_RETURN(0); - } - else if (strcmp("tis620", inDescOverride) == 0) - { - strcpy(outDesc,"TIS-620"); - DBUG_RETURN(0); - } - else if (strcmp("ucs2", inDescOverride) == 0) - { - strcpy(outDesc,"UCS-2"); - DBUG_RETURN(0); - } - else if (strcmp("cp1250", inDescOverride) == 0) - { - strcpy(outDesc,"IBM-1250"); - DBUG_RETURN(0); - } - else if (strcmp("cp1251", inDescOverride) == 0) - { - strcpy(outDesc,"IBM-1251"); - DBUG_RETURN(0); - } - else if (strcmp("cp1256", inDescOverride) == 0) - { - strcpy(outDesc,"IBM-1256"); - DBUG_RETURN(0); - } - else if (strcmp("macce", inDescOverride) == 0) - { - strcpy(outDesc,"IBM-1282"); - DBUG_RETURN(0); - } - } - else if (outType == Qlg_TypeAS400CCSID) - { - // See if we can fast path the convert - for (int loopCnt = 0; loopCnt < MAX_IANASTRING; ++loopCnt) - { - if (strcmp((char*)ianaStringType[loopCnt],inDescOverride) == 0) - { - strcpy(outDesc,ccsidType[loopCnt]); - DBUG_RETURN(0); - } - } - } - } - else - inDescOverride = inDesc; - - // We call getNewTextDesc for all other conversions and cache the result. - TextDescMap *mapping; - TextDescMap::HashKey hashKey; - hashKey.inType= inType; - hashKey.outType= outType; - uint32 len = strlen(inDescOverride); - memcpy(hashKey.inDesc, inDescOverride, len); - memset(hashKey.inDesc+len, 0, sizeof(hashKey.inDesc) - len); - - if (!(mapping=(TextDescMap *) hash_search(&textDescMapHash, - (const uchar*)&hashKey, - sizeof(hashKey)))) - { - DBUG_RETURN(getNewTextDesc(inType, outType, inDescOverride, outDesc, &hashKey)); - } - else - { - strcpy(outDesc, mapping->outDesc); - } - DBUG_RETURN(0); -} - - -/** - Convert an IANA character set name into a DB2 for i CCSID value. - - @param parmIANADesc An IANA character set name - @param[out] db2Ccsid The equivalent CCSID value - - @return 0 if successful. Failure otherwise -*/ -int32 convertIANAToDb2Ccsid(const char* parmIANADesc, uint16* db2Ccsid) -{ - int32 rc; - uint16 aixCcsid; - char aixCcsidString[Qlg_MaxDescSize]; - int aixEncodingScheme; - int db2EncodingScheme; - rc = convertTextDesc(Qlg_TypeIANA, Qlg_TypeAS400CCSID, parmIANADesc, aixCcsidString); - if (unlikely(rc)) - { - if (rc == DB2I_ERR_UNSUPP_CHARSET) - getErrTxt(DB2I_ERR_UNSUPP_CHARSET, parmIANADesc); - - return rc; - } - aixCcsid = atoi(aixCcsidString); - rc = getEncodingScheme(aixCcsid, aixEncodingScheme); - if (rc != 0) - return rc; - switch(aixEncodingScheme) { // Select on encoding scheme - case 0x1100: // EDCDIC SBCS - case 0x2100: // ASCII SBCS - case 0x4100: // AIX SBCS - case 0x4105: // MS Windows - case 0x5100: // ISO 7 bit ASCII - db2EncodingScheme = 0x1100; - break; - case 0x1200: // EDCDIC DBCS - case 0x2200: // ASCII DBCS - db2EncodingScheme = 0x1200; - break; - case 0x1301: // EDCDIC Mixed - case 0x2300: // ASCII Mixed - case 0x4403: // EUC (ISO 2022) - db2EncodingScheme = 0x1301; - break; - case 0x7200: // UCS2 - db2EncodingScheme = 0x7200; - break; - case 0x7807: // UTF-8 - db2EncodingScheme = 0x7807; - break; - case 0x7500: // UTF-32 - db2EncodingScheme = 0x7500; - break; - default: // Unknown - { - getErrTxt(DB2I_ERR_UNKNOWN_ENCODING,aixEncodingScheme); - return DB2I_ERR_UNKNOWN_ENCODING; - } - break; - } - if (aixEncodingScheme == db2EncodingScheme) - { - *db2Ccsid = aixCcsid; - } - else - { - rc = getAssociatedCCSID(aixCcsid, db2EncodingScheme, db2Ccsid); // EDCDIC SBCS - if (rc != 0) - return rc; - } - - return 0; -} - - -/** - Obtain the encoding scheme of a CCSID. - - @param inCcsid An IBM i CCSID - @param[out] outEncodingScheme The associated encoding scheme - - @return 0 if successful. Failure otherwise -*/ -int32 getEncodingScheme(const uint16 inCcsid, int32& outEncodingScheme) -{ - DBUG_ENTER("db2i_charsetSupport::getEncodingScheme"); - - static bool ptrInited = FALSE; - static char ptrSpace[sizeof(ILEpointer) + 15]; - static ILEpointer* ptrToPtr = (ILEpointer*)roundToQuadWordBdy(ptrSpace); - int rc; - - if (!ptrInited) - { - rc = _RSLOBJ2(ptrToPtr, RSLOBJ_TS_PGM, "QTQGESP", "QSYS"); - - if (rc) - { - getErrTxt(DB2I_ERR_RESOLVE_OBJ,"QTQGESP","QSYS","*PGM",errno); - DBUG_RETURN(DB2I_ERR_RESOLVE_OBJ); - } - ptrInited = TRUE; - } - - DBUG_ASSERT(inCcsid != 0); - - int GESPCCSID = inCcsid; - int GESPLen = 32; - int GESPNbrVal = 0; - int32 GESPES; - int GESPCSCPL[32]; - int GESPFB[3]; - void* ILEArgv[7]; - ILEArgv[0] = &GESPCCSID; - ILEArgv[1] = &GESPLen; - ILEArgv[2] = &GESPNbrVal; - ILEArgv[3] = &GESPES; - ILEArgv[4] = &GESPCSCPL; - ILEArgv[5] = &GESPFB; - ILEArgv[6] = NULL; - - rc = _PGMCALL(ptrToPtr, (void**)&ILEArgv, 0); - - if (rc) - { - getErrTxt(DB2I_ERR_PGMCALL,"QTQGESP","QSYS",rc); - DBUG_RETURN(DB2I_ERR_PGMCALL); - } - if (GESPFB[0] != 0 || - GESPFB[1] != 0 || - GESPFB[2] != 0) - { - getErrTxt(DB2I_ERR_QTQGESP,GESPFB[0],GESPFB[1],GESPFB[2]); - DBUG_RETURN(DB2I_ERR_QTQGESP); - } - outEncodingScheme = GESPES; - - DBUG_RETURN(0); -} - - -/** - Get the best fit equivalent CCSID. (Wrapper for QTQGRDC API) - - @param inCcsid An IBM i CCSID - @param inEncodingScheme The encoding scheme - @param[out] outCcsid The equivalent CCSID - - @return 0 if successful. Failure otherwise -*/ -int32 getAssociatedCCSID(const uint16 inCcsid, const int inEncodingScheme, uint16* outCcsid) -{ - DBUG_ENTER("db2i_charsetSupport::getAssociatedCCSID"); - static bool ptrInited = FALSE; - static char ptrSpace[sizeof(ILEpointer) + 15]; - static ILEpointer* ptrToPtr = (ILEpointer*)roundToQuadWordBdy(ptrSpace); - int rc; - - // Override non-standard charsets - if ((inCcsid == 923) && (inEncodingScheme == 0x1100)) - { - *outCcsid = 1148; - DBUG_RETURN(0); - } - else if ((inCcsid == 1250) && (inEncodingScheme == 0x1100)) - { - *outCcsid = 1153; - DBUG_RETURN(0); - } - - if (!ptrInited) - { - rc = _RSLOBJ2(ptrToPtr, RSLOBJ_TS_PGM, "QTQGRDC", "QSYS"); - - if (rc) - { - getErrTxt(DB2I_ERR_RESOLVE_OBJ,"QTQGRDC","QSYS","*PGM",errno); - DBUG_RETURN(DB2I_ERR_RESOLVE_OBJ); - } - ptrInited = TRUE; - } - - int GRDCCCSID = inCcsid; - int GRDCES = inEncodingScheme; - int GRDCSel = 0; - int GRDCAssCCSID; - int GRDCFB[3]; - void* ILEArgv[7]; - ILEArgv[0] = &GRDCCCSID; - ILEArgv[1] = &GRDCES; - ILEArgv[2] = &GRDCSel; - ILEArgv[3] = &GRDCAssCCSID; - ILEArgv[4] = &GRDCFB; - ILEArgv[5] = NULL; - - rc = _PGMCALL(ptrToPtr, (void**)&ILEArgv, 0); - - if (rc) - { - getErrTxt(DB2I_ERR_PGMCALL,"QTQGRDC","QSYS",rc); - DBUG_RETURN(DB2I_ERR_PGMCALL); - } - if (GRDCFB[0] != 0 || - GRDCFB[1] != 0 || - GRDCFB[2] != 0) - { - getErrTxt(DB2I_ERR_QTQGRDC,GRDCFB[0],GRDCFB[1],GRDCFB[2]); - DBUG_RETURN(DB2I_ERR_QTQGRDC); - } - - *outCcsid = GRDCAssCCSID; - - DBUG_RETURN(0); -} - -/** - Open an iconv conversion between a MySQL charset and the respective IBM i CCSID - - @param direction The direction of the conversion - @param mysqlCSName Name of the MySQL character set - @param db2CCSID The IBM i CCSID - @param hashKey The key to use for inserting the opened conversion into the cache - @param[out] newConversion The iconv descriptor - - @return 0 if successful. Failure otherwise -*/ -static int32 openNewConversion(enum_conversionDirection direction, - const char* mysqlCSName, - uint16 db2CCSID, - IconvMap::HashKey* hashKey, - iconv_t& newConversion) -{ - DBUG_ENTER("db2i_charsetSupport::openNewConversion"); - - char mysqlAix41Desc[Qlg_MaxDescSize]; - char db2Aix41Desc[Qlg_MaxDescSize]; - char db2CcsidString[6] = ""; - int32 rc; - - /* - First we have to convert the MySQL IANA-like name and the DB2 CCSID into - there equivalent iconv descriptions. - */ - rc = convertTextDesc(Qlg_TypeIANA, Qlg_TypeAix41, mysqlCSName, mysqlAix41Desc); - if (unlikely(rc)) - { - if (rc == DB2I_ERR_UNSUPP_CHARSET) - getErrTxt(DB2I_ERR_UNSUPP_CHARSET, mysqlCSName); - - DBUG_RETURN(rc); - } - CHARSET_INFO *cs= &my_charset_bin; - (uint)(cs->cset->long10_to_str)(cs,db2CcsidString,sizeof(db2CcsidString), 10, db2CCSID); - rc = convertTextDesc(Qlg_TypeAS400CCSID, Qlg_TypeAix41, db2CcsidString, db2Aix41Desc); - if (unlikely(rc)) - { - if (rc == DB2I_ERR_UNSUPP_CHARSET) - getErrTxt(DB2I_ERR_UNSUPP_CHARSET, mysqlCSName); - - DBUG_RETURN(rc); - } - - /* Call iconv to open the conversion. */ - if (direction == toDB2) - { - newConversion = iconv_open(db2Aix41Desc, mysqlAix41Desc); - } - else - { - newConversion = iconv_open(mysqlAix41Desc, db2Aix41Desc); - } - - if (unlikely(newConversion == (iconv_t) -1)) - { - getErrTxt(DB2I_ERR_UNSUPP_CHARSET, mysqlCSName); - DBUG_RETURN(DB2I_ERR_UNSUPP_CHARSET); - } - - /* Insert the new conversion into the cache. */ - IconvMap* mapping = (IconvMap*)alloc_root(&iconvMapMemroot, sizeof(IconvMap)); - if (!mapping) - { - my_error(ER_OUTOFMEMORY, MYF(0), sizeof(IconvMap)); - DBUG_RETURN( HA_ERR_OUT_OF_MEM); - } - memcpy(&(mapping->hashKey), hashKey, sizeof(mapping->hashKey)); - mapping->iconvDesc = newConversion; - pthread_mutex_lock(&iconvMapHashMutex); - my_hash_insert(&iconvMapHash, (const uchar*)mapping); - pthread_mutex_unlock(&iconvMapHashMutex); - - DBUG_RETURN(0); -} - - -/** - Open an iconv conversion between a MySQL charset and the respective IBM i CCSID - - @param direction The direction of the conversion - @param cs The MySQL character set - @param db2CCSID The IBM i CCSID - @param[out] newConversion The iconv descriptor - - @return 0 if successful. Failure otherwise -*/ -int32 getConversion(enum_conversionDirection direction, const CHARSET_INFO* cs, uint16 db2CCSID, iconv_t& conversion) -{ - DBUG_ENTER("db2i_charsetSupport::getConversion"); - - int32 rc; - - /* Build the hash key */ - IconvMap::HashKey hashKey; - hashKey.direction= direction; - hashKey.myCharset= cs; - hashKey.db2CCSID= db2CCSID; - - /* Look for the conversion in the cache and add it if it is not there. */ - IconvMap *mapping; - if (!(mapping= (IconvMap *) hash_search(&iconvMapHash, - (const uchar*)&hashKey, - sizeof(hashKey)))) - { - DBUG_PRINT("getConversion", ("Hash miss for direction=%d, cs=%s, ccsid=%d", direction, cs->name, db2CCSID)); - rc= openNewConversion(direction, cs->csname, db2CCSID, &hashKey, conversion); - if (rc) - DBUG_RETURN(rc); - } - else - { - conversion= mapping->iconvDesc; - } - - DBUG_RETURN(0); -} - -/** - Fast-path conversion from ASCII to EBCDIC for use in converting - identifiers to be sent to the QMY APIs. - - @param input ASCII data - @param[out] ouput EBCDIC data - @param ilen Size of input buffer and output buffer -*/ -int convToEbcdic(const char* input, char* output, size_t ilen) -{ - static bool inited = FALSE; - static iconv_t ic; - - if (ilen == 0) - return 0; - - if (!inited) - { - ic = iconv_open( "IBM-037", "ISO8859-1" ); - inited = TRUE; - } - size_t substitutedChars; - size_t olen = ilen; - if (iconv( ic, (char**)&input, &ilen, &output, &olen, &substitutedChars ) == -1) - return errno; - - return 0; -} - - -/** - Fast-path conversion from EBCDIC to ASCII for use in converting - data received from the QMY APIs. - - @param input EBCDIC data - @param[out] ouput ASCII data - @param ilen Size of input buffer and output buffer -*/ -int convFromEbcdic(const char* input, char* output, size_t ilen) -{ - static bool inited = FALSE; - static iconv_t ic; - - if (ilen == 0) - return 0; - - if (!inited) - { - ic = iconv_open("ISO8859-1", "IBM-037"); - inited = TRUE; - } - - size_t substitutedChars; - size_t olen = ilen; - if (iconv( ic, (char**)&input, &ilen, &output, &olen, &substitutedChars) == -1) - return errno; - - return 0; -} diff --git a/storage/ibmdb2i/db2i_charsetSupport.h b/storage/ibmdb2i/db2i_charsetSupport.h deleted file mode 100644 index 77051e1e0db..00000000000 --- a/storage/ibmdb2i/db2i_charsetSupport.h +++ /dev/null @@ -1,65 +0,0 @@ -/* -Licensed Materials - Property of IBM -DB2 Storage Engine Enablement -Copyright IBM Corporation 2007,2008 -All rights reserved - -Redistribution and use in source and binary forms, with or without modification, -are permitted provided that the following conditions are met: - (a) Redistributions of source code must retain this list of conditions, the - copyright notice in section {d} below, and the disclaimer following this - list of conditions. - (b) Redistributions in binary form must reproduce this list of conditions, the - copyright notice in section (d) below, and the disclaimer following this - list of conditions, in the documentation and/or other materials provided - with the distribution. - (c) The name of IBM may not be used to endorse or promote products derived from - this software without specific prior written permission. - (d) The text of the required copyright notice is: - Licensed Materials - Property of IBM - DB2 Storage Engine Enablement - Copyright IBM Corporation 2007,2008 - All rights reserved - -THIS SOFTWARE IS PROVIDED BY IBM CORPORATION "AS IS" AND ANY EXPRESS OR IMPLIED -WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF -MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT -SHALL IBM CORPORATION BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, -EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT -OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS -INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN -CONTRACT, STRICT LIABILITY, OR TORT INCLUDING NEGLIGENCE OR OTHERWISE) ARISING -IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY -OF SUCH DAMAGE. -*/ - - -#ifndef DB2I_CHARSETSUPPORT_H -#define DB2I_CHARSETSUPPORT_H - -#include "db2i_global.h" -#include "mysql_priv.h" -#include -#include "db2i_iconv.h" - -/** - @enum enum_conversionDirection - - Conversion directions for getConversion() -*/ -enum enum_conversionDirection -{ - toMySQL, - toDB2 -}; - -int initCharsetSupport(); -void doneCharsetSupport(); -int32 convertIANAToDb2Ccsid(const char* parmIANADesc, uint16* db2Ccsid); -int32 getEncodingScheme(const uint16 inCcsid, int32& outEncodingScheme); -int32 getAssociatedCCSID(const uint16 inCcsid, const int inEncodingScheme, uint16* outCcsid); -int convToEbcdic(const char* input, char* output, size_t ilen); -int convFromEbcdic(const char* input, char* output, size_t ilen); -int32 getConversion(enum_conversionDirection direction, const CHARSET_INFO* cs, uint16 db2CCSID, iconv_t& conversion); - -#endif diff --git a/storage/ibmdb2i/db2i_collationSupport.cc b/storage/ibmdb2i/db2i_collationSupport.cc deleted file mode 100644 index 65a17fd2452..00000000000 --- a/storage/ibmdb2i/db2i_collationSupport.cc +++ /dev/null @@ -1,355 +0,0 @@ -/* -Licensed Materials - Property of IBM -DB2 Storage Engine Enablement -Copyright IBM Corporation 2007,2008 -All rights reserved - -Redistribution and use in source and binary forms, with or without modification, -are permitted provided that the following conditions are met: - (a) Redistributions of source code must retain this list of conditions, the - copyright notice in section {d} below, and the disclaimer following this - list of conditions. - (b) Redistributions in binary form must reproduce this list of conditions, the - copyright notice in section (d) below, and the disclaimer following this - list of conditions, in the documentation and/or other materials provided - with the distribution. - (c) The name of IBM may not be used to endorse or promote products derived from - this software without specific prior written permission. - (d) The text of the required copyright notice is: - Licensed Materials - Property of IBM - DB2 Storage Engine Enablement - Copyright IBM Corporation 2007,2008 - All rights reserved - -THIS SOFTWARE IS PROVIDED BY IBM CORPORATION "AS IS" AND ANY EXPRESS OR IMPLIED -WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF -MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT -SHALL IBM CORPORATION BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, -EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT -OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS -INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN -CONTRACT, STRICT LIABILITY, OR TORT INCLUDING NEGLIGENCE OR OTHERWISE) ARISING -IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY -OF SUCH DAMAGE. -*/ - - -#include "db2i_collationSupport.h" -#include "db2i_errors.h" - - -/* - The following arrays define a mapping between MySQL collation names and - corresponding IBM i sort sequences. The mapping is a 1-to-1 correlation - between corresponding array slots but is incomplete without case-sensitivity - markers dynamically added to the mySqlSortSequence names. -*/ -#define MAX_COLLATION 87 -static const char* mySQLCollation[MAX_COLLATION] = -{ - {"ascii_general"}, - {"ascii"}, - {"big5_chinese"}, - {"big5"}, - {"cp1250_croatian"}, - {"cp1250_general"}, - {"cp1250_polish"}, - {"cp1250"}, - {"cp1251_bulgarian"}, - {"cp1251_general"}, - {"cp1251"}, - {"cp1256_general"}, - {"cp1256"}, - {"cp850_general"}, - {"cp850"}, - {"cp852_general"}, - {"cp852"}, - {"cp932_japanese"}, - {"cp932"}, - {"euckr_korean"}, - {"euckr"}, - {"gb2312_chinese"}, - {"gb2312"}, - {"gbk_chinese"}, - {"gbk"}, - {"greek_general"}, - {"greek"}, - {"hebrew_general"}, - {"hebrew"}, - {"latin1_danish"}, - {"latin1_general"}, - {"latin1_german1"}, - {"latin1_spanish"}, - {"latin1_swedish"}, - {"latin1"}, - {"latin2_croatian"}, - {"latin2_general"}, - {"latin2_hungarian"}, - {"latin2"}, - {"latin5_turkish"}, - {"latin5"}, - {"macce_general"}, - {"macce"}, - {"sjis_japanese"}, - {"sjis"}, - {"tis620_thai"}, - {"tis620"}, - {"ucs2_czech"}, - {"ucs2_danish"}, - {"ucs2_esperanto"}, - {"ucs2_estonian"}, - {"ucs2_general"}, - {"ucs2_hungarian"}, - {"ucs2_icelandic"}, - {"ucs2_latvian"}, - {"ucs2_lithuanian"}, - {"ucs2_persian"}, - {"ucs2_polish"}, - {"ucs2_romanian"}, - {"ucs2_slovak"}, - {"ucs2_slovenian"}, - {"ucs2_spanish"}, - {"ucs2_swedish"}, - {"ucs2_turkish"}, - {"ucs2_unicode"}, - {"ucs2"}, - {"ujis_japanese"}, - {"ujis"}, - {"utf8_czech"}, - {"utf8_danish"}, - {"utf8_esperanto"}, - {"utf8_estonian"}, - {"utf8_general"}, - {"utf8_hungarian"}, - {"utf8_icelandic"}, - {"utf8_latvian"}, - {"utf8_lithuanian"}, - {"utf8_persian"}, - {"utf8_polish"}, - {"utf8_romanian"}, - {"utf8_slovak"}, - {"utf8_slovenian"}, - {"utf8_spanish"}, - {"utf8_swedish"}, - {"utf8_turkish"}, - {"utf8_unicode"}, - {"utf8"} -}; - - -static const char* mySqlSortSequence[MAX_COLLATION] = -{ - {"QALA101F4"}, - {"QBLA101F4"}, - {"QACHT04B0"}, - {"QBCHT04B0"}, - {"QALA20481"}, - {"QCLA20481"}, - {"QDLA20481"}, - {"QELA20481"}, - {"QACYR0401"}, - {"QBCYR0401"}, - {"QCCYR0401"}, - {"QAARA01A4"}, - {"QBARA01A4"}, - {"QCLA101F4"}, - {"QDLA101F4"}, - {"QALA20366"}, - {"QBLA20366"}, - {"QAJPN04B0"}, - {"QBJPN04B0"}, - {"QAKOR04B0"}, - {"QBKOR04B0"}, - {"QACHS04B0"}, - {"QBCHS04B0"}, - {"QCCHS04B0"}, - {"QDCHS04B0"}, - {"QAELL036B"}, - {"QBELL036B"}, - {"QAHEB01A8"}, - {"QBHEB01A8"}, - {"QALA1047C"}, - {"QBLA1047C"}, - {"QCLA1047C"}, - {"QDLA1047C"}, - {"QELA1047C"}, - {"QFLA1047C"}, - {"QCLA20366"}, - {"QELA20366"}, - {"QFLA20366"}, - {"QGLA20366"}, - {"QATRK0402"}, - {"QBTRK0402"}, - {"QHLA20366"}, - {"QILA20366"}, - {"QCJPN04B0"}, - {"QDJPN04B0"}, - {"QATHA0346"}, - {"QBTHA0346"}, - {"ACS_CZ"}, - {"ADA_DK"}, - {"AEO"}, - {"AET"}, - {"QAUCS04B0"}, - {"AHU"}, - {"AIS"}, - {"ALV"}, - {"ALT"}, - {"AFA"}, - {"APL"}, - {"ARO"}, - {"ASK"}, - {"ASL"}, - {"AES"}, - {"ASW"}, - {"ATR"}, - {"AEN"}, - {"*HEX"}, - {"QEJPN04B0"}, - {"QFJPN04B0"}, - {"ACS_CZ"}, - {"ADA_DK"}, - {"AEO"}, - {"AET"}, - {"QAUCS04B0"}, - {"AHU"}, - {"AIS"}, - {"ALV"}, - {"ALT"}, - {"AFA"}, - {"APL"}, - {"ARO"}, - {"ASK"}, - {"ASL"}, - {"AES"}, - {"ASW"}, - {"ATR"}, - {"AEN"}, - {"*HEX"} -}; - - -/** - Get the IBM i sort sequence that corresponds to the given MySQL collation. - - @param fieldCharSet The collated character set - @param[out] rtnSortSequence The corresponding sort sequence - - @return 0 if successful. Failure otherwise -*/ -static int32 getAssociatedSortSequence(const CHARSET_INFO *fieldCharSet, const char** rtnSortSequence) -{ - DBUG_ENTER("ha_ibmdb2i::getAssociatedSortSequence"); - - if (strcmp(fieldCharSet->csname,"binary") != 0) - { - int collationSearchLen = strlen(fieldCharSet->name); - if (fieldCharSet->state & MY_CS_BINSORT) - collationSearchLen -= 4; - else - collationSearchLen -= 3; - - uint16 loopCnt = 0; - for (loopCnt; loopCnt < MAX_COLLATION; ++loopCnt) - { - if ((strlen(mySQLCollation[loopCnt]) == collationSearchLen) && - (strncmp((char*)mySQLCollation[loopCnt], fieldCharSet->name, collationSearchLen) == 0)) - break; - } - if (loopCnt == MAX_COLLATION) // Did not find associated sort sequence - { - getErrTxt(DB2I_ERR_SRTSEQ); - DBUG_RETURN(DB2I_ERR_SRTSEQ); - } - *rtnSortSequence = mySqlSortSequence[loopCnt]; - } - - DBUG_RETURN(0); -} - - -/** - Update sort sequence information for a key. - - This function accumulates information about a key as it is called for each - field composing the key. The caller should invoke the function for each field - and (with the exception of the charset parm) preserve the values for the - parms across invocations, until a particular key has been evaluated. Once - the last field in the key has been evaluated, the fileSortSequence and - fileSortSequenceLibrary parms will contain the correct information for - creating the corresponding DB2 key. - - @param charset The character set under consideration - @param[in, out] fileSortSequenceType The type of the current key's sort seq - @param[in, out] fileSortSequence The IBM i identifier for the DB2 sort sequence - that corresponds - - @return 0 if successful. Failure otherwise -*/ -int32 updateAssociatedSortSequence(const CHARSET_INFO* charset, - char* fileSortSequenceType, - char* fileSortSequence, - char* fileSortSequenceLibrary) -{ - DBUG_ENTER("ha_ibmdb2i::updateAssociatedSortSequence"); - DBUG_ASSERT(charset); - if (strcmp(charset->csname,"binary") != 0) - { - char newSortSequence[11] = ""; - char newSortSequenceType = ' '; - const char* foundSortSequence; - int rc = getAssociatedSortSequence(charset, &foundSortSequence); - if (rc) DBUG_RETURN (rc); - switch(foundSortSequence[0]) - { - case '*': // Binary - strcat(newSortSequence,foundSortSequence); - newSortSequenceType = 'B'; - break; - case 'Q': // Non-ICU sort sequence - strcat(newSortSequence,foundSortSequence); - if ((charset->state & MY_CS_BINSORT) != 0) - { - strcat(newSortSequence,"U"); - } - else if ((charset->state & MY_CS_CSSORT) != 0) - { - strcat(newSortSequence,"U"); - } - else - { - strcat(newSortSequence,"S"); - } - newSortSequenceType = 'N'; - break; - default: // ICU sort sequence - { - if ((charset->state & MY_CS_CSSORT) == 0) - { - if (osVersion.v >= 6) - strcat(newSortSequence,"I34"); // ICU 3.4 - else - strcat(newSortSequence,"I26"); // ICU 2.6.1 - } - strcat(newSortSequence,foundSortSequence); - newSortSequenceType = 'I'; - } - break; - } - if (*fileSortSequenceType == ' ') // If no sort sequence has been set yet - { - // Set associated sort sequence - strcpy(fileSortSequence,newSortSequence); - strcpy(fileSortSequenceLibrary,"QSYS"); - *fileSortSequenceType = newSortSequenceType; - } - else if (strcmp(fileSortSequence,newSortSequence) != 0) - { - // Only one sort sequence/collation is supported for each DB2 index. - getErrTxt(DB2I_ERR_MIXED_COLLATIONS); - DBUG_RETURN(DB2I_ERR_MIXED_COLLATIONS); - } - } - - DBUG_RETURN(0); -} diff --git a/storage/ibmdb2i/db2i_collationSupport.h b/storage/ibmdb2i/db2i_collationSupport.h deleted file mode 100644 index b2ce09de1ea..00000000000 --- a/storage/ibmdb2i/db2i_collationSupport.h +++ /dev/null @@ -1,48 +0,0 @@ -/* -Licensed Materials - Property of IBM -DB2 Storage Engine Enablement -Copyright IBM Corporation 2007,2008 -All rights reserved - -Redistribution and use in source and binary forms, with or without modification, -are permitted provided that the following conditions are met: - (a) Redistributions of source code must retain this list of conditions, the - copyright notice in section {d} below, and the disclaimer following this - list of conditions. - (b) Redistributions in binary form must reproduce this list of conditions, the - copyright notice in section (d) below, and the disclaimer following this - list of conditions, in the documentation and/or other materials provided - with the distribution. - (c) The name of IBM may not be used to endorse or promote products derived from - this software without specific prior written permission. - (d) The text of the required copyright notice is: - Licensed Materials - Property of IBM - DB2 Storage Engine Enablement - Copyright IBM Corporation 2007,2008 - All rights reserved - -THIS SOFTWARE IS PROVIDED BY IBM CORPORATION "AS IS" AND ANY EXPRESS OR IMPLIED -WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF -MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT -SHALL IBM CORPORATION BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, -EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT -OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS -INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN -CONTRACT, STRICT LIABILITY, OR TORT INCLUDING NEGLIGENCE OR OTHERWISE) ARISING -IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY -OF SUCH DAMAGE. -*/ - - -#ifndef DB2I_COLLATIONSUPPORT_H -#define DB2I_COLLATIONSUPPORT_H - -#include "db2i_global.h" -#include "mysql_priv.h" - -int32 updateAssociatedSortSequence(const CHARSET_INFO* charset, - char* fileSortSequenceType, - char* fileSortSequence, - char* fileSortSequenceLibrary); - -#endif diff --git a/storage/ibmdb2i/db2i_constraints.cc b/storage/ibmdb2i/db2i_constraints.cc deleted file mode 100644 index 1fde0dd3d14..00000000000 --- a/storage/ibmdb2i/db2i_constraints.cc +++ /dev/null @@ -1,672 +0,0 @@ -/* -Licensed Materials - Property of IBM -DB2 Storage Engine Enablement -Copyright IBM Corporation 2007,2008 -All rights reserved - -Redistribution and use in source and binary forms, with or without modification, -are permitted provided that the following conditions are met: - (a) Redistributions of source code must retain this list of conditions, the - copyright notice in section {d} below, and the disclaimer following this - list of conditions. - (b) Redistributions in binary form must reproduce this list of conditions, the - copyright notice in section (d) below, and the disclaimer following this - list of conditions, in the documentation and/or other materials provided - with the distribution. - (c) The name of IBM may not be used to endorse or promote products derived from - this software without specific prior written permission. - (d) The text of the required copyright notice is: - Licensed Materials - Property of IBM - DB2 Storage Engine Enablement - Copyright IBM Corporation 2007,2008 - All rights reserved - -THIS SOFTWARE IS PROVIDED BY IBM CORPORATION "AS IS" AND ANY EXPRESS OR IMPLIED -WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF -MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT -SHALL IBM CORPORATION BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, -EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT -OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS -INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN -CONTRACT, STRICT LIABILITY, OR TORT INCLUDING NEGLIGENCE OR OTHERWISE) ARISING -IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY -OF SUCH DAMAGE. -*/ - - - -#include "ha_ibmdb2i.h" -#include "db2i_safeString.h" - -// This function is called when building the CREATE TABLE information for -// foreign key constraints. It converts a constraint, table, schema, or -// field name from EBCDIC to ASCII. If the DB2 name is quoted, it removes -// those quotes. It then adds the appropriate quotes for a MySQL identifier. - -static void convNameForCreateInfo(THD *thd, SafeString& info, char* fromName, int len) -{ - int quote; - char cquote; // Quote character - char convName[MAX_DB2_FILENAME_LENGTH]; // Converted name - - memset(convName, 0, sizeof(convName)); - convFromEbcdic(fromName, convName, len); - quote = get_quote_char_for_identifier(thd, convName, len); - cquote = (char) quote; - if (quote != EOF) - info.strcat(cquote); - if (convName[0] == '"') // If DB2 name was quoted, remove quotes - { - if (strstr(convName, "\"\"")) - stripExtraQuotes(convName+1, len-1); - info.strncat((char*)(convName+1), len-2); - } - else // DB2 name was not quoted - info.strncat(convName, len); - if (quote != EOF) - info.strcat(cquote); -} - -/** - Evaluate the parse tree to build foreign key constraint clauses - - @parm lex The parse tree - @parm appendHere The DB2 string to receive the constraint clauses - @parm path The path to the table under consideration - @parm fields Pointer to the table's list of field pointers - @parm[in, out] fileSortSequenceType The sort sequence type associated with the table - @parm[in, out] fileSortSequence The sort sequence associated with the table - @parm[in, out] fileSortSequenceLibrary The sort sequence library associated with the table - - @return 0 if successful; HA_ERR_CANNOT_ADD_FOREIGN otherwise -*/ -int ha_ibmdb2i::buildDB2ConstraintString(LEX* lex, - String& appendHere, - const char* path, - Field** fields, - char* fileSortSequenceType, - char* fileSortSequence, - char* fileSortSequenceLibrary) -{ - List_iterator keyIter(lex->alter_info.key_list); - char colName[MAX_DB2_COLNAME_LENGTH+1]; - - Key* curKey; - - while (curKey = keyIter++) - { - if (curKey->type == Key::FOREIGN_KEY) - { - appendHere.append(STRING_WITH_LEN(", ")); - - Foreign_key* fk = (Foreign_key*)curKey; - - char db2LibName[MAX_DB2_SCHEMANAME_LENGTH+1]; - if (fk->name) - { - char db2FKName[MAX_DB2_FILENAME_LENGTH+1]; - appendHere.append(STRING_WITH_LEN("CONSTRAINT ")); - if (fk->ref_table->db.str) - { - convertMySQLNameToDB2Name(fk->ref_table->db.str, db2LibName, sizeof(db2LibName)); - } - else - { - db2i_table::getDB2LibNameFromPath(path, db2LibName); - } - if (lower_case_table_names == 1) - my_casedn_str(files_charset_info, db2LibName); - appendHere.append(db2LibName); - - appendHere.append('.'); - - convertMySQLNameToDB2Name(fk->name, db2FKName, sizeof(db2FKName)); - appendHere.append(db2FKName); - } - - appendHere.append(STRING_WITH_LEN(" FOREIGN KEY (")); - - bool firstTime = true; - - List_iterator column(fk->columns); - Key_part_spec* curColumn; - - while (curColumn = column++) - { - if (!firstTime) - { - appendHere.append(','); - } - firstTime = false; - - convertMySQLNameToDB2Name(curColumn->field_name, colName, sizeof(colName)); - appendHere.append(colName); - - // DB2 requires that the sort sequence on the child table match the parent table's - // sort sequence. We ensure that happens by updating the sort sequence according - // to the constrained fields. - Field** field = fields; - do - { - if (strcmp((*field)->field_name, curColumn->field_name) == 0) - { - int rc = updateAssociatedSortSequence((*field)->charset(), - fileSortSequenceType, - fileSortSequence, - fileSortSequenceLibrary); - - if (unlikely(rc)) return rc; - } - } while (*(++field)); - } - - firstTime = true; - - appendHere.append(STRING_WITH_LEN(") REFERENCES ")); - - if (fk->ref_table->db.str) - { - convertMySQLNameToDB2Name(fk->ref_table->db.str, db2LibName, sizeof(db2LibName)); - } - else - { - db2i_table::getDB2LibNameFromPath(path, db2LibName); - } - if (lower_case_table_names == 1) - my_casedn_str(files_charset_info, db2LibName); - appendHere.append(db2LibName); - appendHere.append('.'); - - char db2FileName[MAX_DB2_FILENAME_LENGTH+1]; - convertMySQLNameToDB2Name(fk->ref_table->table.str, db2FileName, sizeof(db2FileName)); - if (lower_case_table_names) - my_casedn_str(files_charset_info, db2FileName); - appendHere.append(db2FileName); - - - if (!fk->ref_columns.is_empty()) - { - List_iterator ref(fk->ref_columns); - Key_part_spec* curRef; - appendHere.append(STRING_WITH_LEN(" (")); - - - while (curRef = ref++) - { - if (!firstTime) - { - appendHere.append(','); - } - firstTime = false; - - convertMySQLNameToDB2Name(curRef->field_name, colName, sizeof(colName)); - appendHere.append(colName); - } - - appendHere.append(STRING_WITH_LEN(") ")); - } - - if (fk->delete_opt != Foreign_key::FK_OPTION_UNDEF) - { - appendHere.append(STRING_WITH_LEN("ON DELETE ")); - switch (fk->delete_opt) - { - case Foreign_key::FK_OPTION_RESTRICT: - appendHere.append(STRING_WITH_LEN("RESTRICT ")); break; - case Foreign_key::FK_OPTION_CASCADE: - appendHere.append(STRING_WITH_LEN("CASCADE ")); break; - case Foreign_key::FK_OPTION_SET_NULL: - appendHere.append(STRING_WITH_LEN("SET NULL ")); break; - case Foreign_key::FK_OPTION_NO_ACTION: - appendHere.append(STRING_WITH_LEN("NO ACTION ")); break; - case Foreign_key::FK_OPTION_DEFAULT: - appendHere.append(STRING_WITH_LEN("SET DEFAULT ")); break; - default: - return HA_ERR_CANNOT_ADD_FOREIGN; break; - } - } - - if (fk->update_opt != Foreign_key::FK_OPTION_UNDEF) - { - appendHere.append(STRING_WITH_LEN("ON UPDATE ")); - switch (fk->update_opt) - { - case Foreign_key::FK_OPTION_RESTRICT: - appendHere.append(STRING_WITH_LEN("RESTRICT ")); break; - case Foreign_key::FK_OPTION_NO_ACTION: - appendHere.append(STRING_WITH_LEN("NO ACTION ")); break; - default: - return HA_ERR_CANNOT_ADD_FOREIGN; break; - } - } - - } - - } - - return 0; -} - - -/*********************************************************************** -Get the foreign key information in the form of a character string so -that it can be inserted into a CREATE TABLE statement. This is used by -the SHOW CREATE TABLE statement. The string will later be freed by the -free_foreign_key_create_info() method. -************************************************************************/ - -char* ha_ibmdb2i::get_foreign_key_create_info(void) -{ - DBUG_ENTER("ha_ibmdb2i::get_foreign_key_create_info"); - int rc = 0; - char* infoBuffer = NULL; // Pointer to string returned to MySQL - uint32 constraintSpaceLength;// Length of space passed to DB2 - ValidatedPointer constraintSpace; // Space pointer passed to DB2 - uint32 neededLen; // Length returned from DB2 - uint32 cstCnt; // Number of foreign key constraints from DB2 - uint32 fld; // - constraint_hdr* cstHdr; // Pointer to constraint header structure - FK_constraint* FKCstDef; // Pointer to constraint definition structure - cst_name* fieldName; // Pointer to field name structure - char* tempPtr; // Temp pointer for traversing constraint space - char convName[128]; - - /* Allocate space to retrieve the DB2 constraint information. */ - - if (!(share = get_share(table_share->path.str, table))) - DBUG_RETURN(NULL); - - constraintSpaceLength = 5000; // Try allocating 5000 bytes and see if enough. - - initBridge(); - - constraintSpace.alloc(constraintSpaceLength); - rc = bridge()->expectErrors(QMY_ERR_NEED_MORE_SPACE) - ->constraints(db2Table->dataFile()->getMasterDefnHandle(), - constraintSpace, - constraintSpaceLength, - &neededLen, - &cstCnt); - - if (unlikely(rc == QMY_ERR_NEED_MORE_SPACE)) - { - constraintSpaceLength = neededLen; // Get length of space that's needed - constraintSpace.realloc(constraintSpaceLength); - rc = bridge()->expectErrors(QMY_ERR_NEED_MORE_SPACE) - ->constraints(db2Table->dataFile()->getMasterDefnHandle(), - constraintSpace, - constraintSpaceLength, - &neededLen, - &cstCnt); - } - - /* If constraint information was returned by DB2, build a text string */ - /* to return to MySQL. */ - - if ((rc == 0) && (cstCnt > 0)) - { - THD* thd = ha_thd(); - infoBuffer = (char*) my_malloc(MAX_FOREIGN_LEN + 1, MYF(MY_WME)); - if (infoBuffer == NULL) - { - free_share(share); - DBUG_RETURN(NULL); - } - - SafeString info(infoBuffer, MAX_FOREIGN_LEN + 1); - - /* Loop through the DB2 constraints and build a text string for each foreign */ - /* key constraint that is found. */ - - tempPtr = constraintSpace; - cstHdr = (constraint_hdr_t*)(void*)constraintSpace; // Address first constraint definition - for (int i = 0; i < cstCnt && !info.overflowed(); ++i) - { - if (cstHdr->CstType[0] == QMY_CST_FK) // If this is a foreign key constraint - { - tempPtr = (char*)(tempPtr + cstHdr->CstDefOff); - FKCstDef = (FK_constraint_t*)tempPtr; - - /* Process the constraint name. */ - - info.strncat(STRING_WITH_LEN(",\n CONSTRAINT ")); - convNameForCreateInfo(thd, info, - FKCstDef->CstName.Name, FKCstDef->CstName.Len); - - /* Process the names of the foreign keys. */ - - info.strncat(STRING_WITH_LEN(" FOREIGN KEY (")); - tempPtr = (char*)(tempPtr + FKCstDef->KeyColOff); - fieldName= (cst_name_t*)tempPtr; - for (fld = 0; fld < FKCstDef->KeyCnt; ++fld) - { - convNameForCreateInfo(thd, info, fieldName->Name, fieldName->Len); - if ((fld + 1) < FKCstDef->KeyCnt) - { - info.strncat(STRING_WITH_LEN(", ")); - fieldName = fieldName + 1; - } - } - - /* Process the schema-name and name of the referenced table. */ - - info.strncat(STRING_WITH_LEN(") REFERENCES ")); - convNameForCreateInfo(thd, info, - FKCstDef->RefSchema.Name, FKCstDef->RefSchema.Len); - info.strcat('.'); - convNameForCreateInfo(thd, info, - FKCstDef->RefTable.Name, FKCstDef->RefTable.Len); - info.strncat(STRING_WITH_LEN(" (")); - - /* Process the names of the referenced keys. */ - - tempPtr = (char*)FKCstDef; - tempPtr = (char*)(tempPtr + FKCstDef->RefColOff); - fieldName= (cst_name_t*)tempPtr; - for (fld = 0; fld < FKCstDef->RefCnt; ++fld) - { - convNameForCreateInfo(thd, info, fieldName->Name, fieldName->Len); - if ((fld + 1) < FKCstDef->RefCnt) - { - info.strncat(STRING_WITH_LEN(", ")); - fieldName = fieldName + 1; - } - } - - /* Process the ON UPDATE and ON DELETE rules. */ - - info.strncat(STRING_WITH_LEN(") ON UPDATE ")); - switch(FKCstDef->UpdMethod) - { - case QMY_NOACTION: info.strncat(STRING_WITH_LEN("NO ACTION")); break; - case QMY_RESTRICT: info.strncat(STRING_WITH_LEN("RESTRICT")); break; - default: break; - } - info.strncat(STRING_WITH_LEN(" ON DELETE ")); - switch(FKCstDef->DltMethod) - { - case QMY_CASCADE: info.strncat(STRING_WITH_LEN("CASCADE")); break; - case QMY_SETDFT: info.strncat(STRING_WITH_LEN("SET DEFAULT")); break; - case QMY_SETNULL: info.strncat(STRING_WITH_LEN("SET NULL")); break; - case QMY_NOACTION: info.strncat(STRING_WITH_LEN("NO ACTION")); break; - case QMY_RESTRICT: info.strncat(STRING_WITH_LEN("RESTRICT")); break; - default: break; - } - } - - /* Address the next constraint, if any. */ - - if ((i+1) < cstCnt) - { - tempPtr = (char*)cstHdr + cstHdr->CstLen; - cstHdr = (constraint_hdr_t*)(tempPtr); - } - } - } - - /* Cleanup and return */ - free_share(share); - - DBUG_RETURN(infoBuffer); -} - -/*********************************************************************** -Free the foreign key create info (for a table) that was acquired by the -get_foreign_key_create_info() method. -***********************************************************************/ - -void ha_ibmdb2i::free_foreign_key_create_info(char* info) -{ - DBUG_ENTER("ha_ibmdb2i::free_foreign_key_create_info"); - - if (info) - { - my_free(info, MYF(0)); - } - DBUG_VOID_RETURN; -} - -/*********************************************************************** -This method returns to MySQL a list, with one entry in the list describing -each foreign key constraint. -***********************************************************************/ - -int ha_ibmdb2i::get_foreign_key_list(THD *thd, List *f_key_list) -{ - DBUG_ENTER("ha_ibmdb2i::get_foreign_key_list"); - int rc = 0; - uint32 constraintSpaceLength; // Length of space passed to DB2 - ValidatedPointer constraintSpace; // Space pointer passed to DB2 - uint16 rtnCode; // Return code from DB2 - uint32 neededLen; // Bytes needed to contain DB2 constraint info - uint32 cstCnt; // Number of constraints returned by DB2 - uint32 fld; - constraint_hdr* cstHdr; // Pointer to a cst header structure - FK_constraint* FKCstDef; // Pointer to definition of foreign key constraint - cst_name* fieldName; // Pointer to field name structure - const char *method; - ulong methodLen; - char* tempPtr; // Temp pointer for traversing constraint space - char convName[128]; - - if (!(share = get_share(table_share->path.str, table))) - DBUG_RETURN(0); - - // Allocate space to retrieve the DB2 constraint information. - constraintSpaceLength = 5000; // Try allocating 5000 bytes and see if enough. - - constraintSpace.alloc(constraintSpaceLength); - rc = bridge()->expectErrors(QMY_ERR_NEED_MORE_SPACE) - ->constraints(db2Table->dataFile()->getMasterDefnHandle(), - constraintSpace, - constraintSpaceLength, - &neededLen, - &cstCnt); - - if (unlikely(rc == QMY_ERR_NEED_MORE_SPACE)) - { - constraintSpaceLength = neededLen; // Get length of space that's needed - constraintSpace.realloc(constraintSpaceLength); - rc = bridge()->expectErrors(QMY_ERR_NEED_MORE_SPACE) - ->constraints(db2Table->dataFile()->getMasterDefnHandle(), - constraintSpace, - constraintSpaceLength, - &neededLen, - &cstCnt); - } - - /* If constraint information was returned by DB2, build a text string */ - /* to return to MySQL. */ - if ((rc == 0) && (cstCnt > 0)) - { - tempPtr = constraintSpace; - cstHdr = (constraint_hdr_t*)(void*)constraintSpace; // Address first constraint definition - for (int i = 0; i < cstCnt; ++i) - { - if (cstHdr->CstType[0] == QMY_CST_FK) // If this is a foreign key constraint - { - FOREIGN_KEY_INFO f_key_info; - LEX_STRING *name= 0; - tempPtr = (char*)(tempPtr + cstHdr->CstDefOff); - FKCstDef = (FK_constraint_t*)tempPtr; - - /* Process the constraint name. */ - - convFromEbcdic(FKCstDef->CstName.Name, convName,FKCstDef->CstName.Len); - if (convName[0] == '"') // If quoted, exclude quotes. - f_key_info.forein_id = thd_make_lex_string(thd, 0, - convName + 1, (uint) (FKCstDef->CstName.Len - 2), 1); - else // Not quoted - f_key_info.forein_id = thd_make_lex_string(thd, 0, - convName, (uint) FKCstDef->CstName.Len, 1); - - /* Process the names of the foreign keys. */ - - - tempPtr = (char*)(tempPtr + FKCstDef->KeyColOff); - fieldName = (cst_name_t*)tempPtr; - for (fld = 0; fld < FKCstDef->KeyCnt; ++fld) - { - convFromEbcdic(fieldName->Name, convName, fieldName->Len); - if (convName[0] == '"') // If quoted, exclude quotes. - name = thd_make_lex_string(thd, name, - convName + 1, (uint) (fieldName->Len - 2), 1); - else - name = thd_make_lex_string(thd, name, convName, (uint) fieldName->Len, 1); - f_key_info.foreign_fields.push_back(name); - if ((fld + 1) < FKCstDef->KeyCnt) - fieldName = fieldName + 1; - } - - /* Process the schema and name of the referenced table. */ - - convFromEbcdic(FKCstDef->RefSchema.Name, convName, FKCstDef->RefSchema.Len); - if (convName[0] == '"') // If quoted, exclude quotes. - f_key_info.referenced_db = thd_make_lex_string(thd, 0, - convName + 1, (uint) (FKCstDef->RefSchema.Len -2), 1); - else - f_key_info.referenced_db = thd_make_lex_string(thd, 0, - convName, (uint) FKCstDef->RefSchema.Len, 1); - convFromEbcdic(FKCstDef->RefTable.Name, convName, FKCstDef->RefTable.Len); - if (convName[0] == '"') // If quoted, exclude quotes. - f_key_info.referenced_table = thd_make_lex_string(thd, 0, - convName +1, (uint) (FKCstDef->RefTable.Len -2), 1); - else - f_key_info.referenced_table = thd_make_lex_string(thd, 0, - convName, (uint) FKCstDef->RefTable.Len, 1); - - /* Process the names of the referenced keys. */ - - tempPtr = (char*)FKCstDef; - tempPtr = (char*)(tempPtr + FKCstDef->RefColOff); - fieldName= (cst_name_t*)tempPtr; - for (fld = 0; fld < FKCstDef->RefCnt; ++fld) - { - convFromEbcdic(fieldName->Name, convName, fieldName->Len); - if (convName[0] == '"') // If quoted, exclude quotes. - name = thd_make_lex_string(thd, name, - convName + 1, (uint) (fieldName->Len -2), 1); - else - name = thd_make_lex_string(thd, name, convName, (uint) fieldName->Len, 1); - f_key_info.referenced_fields.push_back(name); - if ((fld + 1) < FKCstDef->RefCnt) - fieldName = fieldName + 1; - } - - /* Process the ON UPDATE and ON DELETE rules. */ - - switch(FKCstDef->UpdMethod) - { - case QMY_NOACTION: - { - method = "NO ACTION"; - methodLen=9; - } - break; - case QMY_RESTRICT: - { - method = "RESTRICT"; - methodLen = 8; - } - break; - default: break; - } - f_key_info.update_method = thd_make_lex_string( - thd, f_key_info.update_method, method, methodLen, 1); - switch(FKCstDef->DltMethod) - { - case QMY_CASCADE: - { - method = "CASCADE"; - methodLen = 7; - } - break; - case QMY_SETDFT: - { - method = "SET DEFAULT"; - methodLen = 11; - } - break; - case QMY_SETNULL: - { - method = "SET NULL"; - methodLen = 8; - } - break; - case QMY_NOACTION: - { - method = "NO ACTION"; - methodLen = 9; - } - break; - case QMY_RESTRICT: - { - method = "RESTRICT"; - methodLen = 8; - } - break; - default: break; - } - f_key_info.delete_method = thd_make_lex_string( - thd, f_key_info.delete_method, method, methodLen, 1); - f_key_info.referenced_key_name= thd_make_lex_string(thd, 0, (char *)"", 1, 1); - FOREIGN_KEY_INFO *pf_key_info = (FOREIGN_KEY_INFO *) - thd_memdup(thd, &f_key_info, sizeof(FOREIGN_KEY_INFO)); - f_key_list->push_back(pf_key_info); - } - - /* Address the next constraint, if any. */ - - if ((i+1) < cstCnt) - { - tempPtr = (char*)cstHdr + cstHdr->CstLen; - cstHdr = (constraint_hdr_t*)(tempPtr); - } - } - } - - /* Cleanup and return. */ - - free_share(share); - DBUG_RETURN(0); -} - -/*********************************************************************** -Checks if the table is referenced by a foreign key. -Returns: 0 if not referenced (or error occurs), - > 0 if is referenced -***********************************************************************/ - -uint ha_ibmdb2i::referenced_by_foreign_key(void) -{ - DBUG_ENTER("ha_ibmdb2i::referenced_by_foreign_key"); - - int rc = 0; - FILE_HANDLE queryFile = 0; - uint32 resultRowLen; - uint32 count = 0; - - const char* libName = db2Table->getDB2LibName(db2i_table::ASCII_SQL); - const char* fileName = db2Table->getDB2TableName(db2i_table::ASCII_SQL); - - String query(128); - query.append(STRING_WITH_LEN(" SELECT COUNT(*) FROM SYSIBM.SQLFOREIGNKEYS WHERE PKTABLE_SCHEM = '")); - query.append(libName+1, strlen(libName)-2); // parent library name - query.append(STRING_WITH_LEN("' AND PKTABLE_NAME = '")); - query.append(fileName+1, strlen(fileName)-2); // parent file name - query.append(STRING_WITH_LEN("'")); - - SqlStatementStream sqlStream(query); - - rc = bridge()->prepOpen(sqlStream.getPtrToData(), - &queryFile, - &resultRowLen); - if (rc == 0) - { - IOReadBuffer rowBuffer(1, resultRowLen); - rc = bridge()->read(queryFile, rowBuffer.ptr(), QMY_READ_ONLY, QMY_NONE, QMY_FIRST); - if (!rc) count = *((uint32*)rowBuffer.getRowN(0)); - bridge()->deallocateFile(queryFile); - } - DBUG_RETURN(count); -} diff --git a/storage/ibmdb2i/db2i_conversion.cc b/storage/ibmdb2i/db2i_conversion.cc deleted file mode 100644 index 9a85eb01c9b..00000000000 --- a/storage/ibmdb2i/db2i_conversion.cc +++ /dev/null @@ -1,1459 +0,0 @@ -/* -Licensed Materials - Property of IBM -DB2 Storage Engine Enablement -Copyright IBM Corporation 2007,2008 -All rights reserved - -Redistribution and use in source and binary forms, with or without modification, -are permitted provided that the following conditions are met: - (a) Redistributions of source code must retain this list of conditions, the - copyright notice in section {d} below, and the disclaimer following this - list of conditions. - (b) Redistributions in binary form must reproduce this list of conditions, the - copyright notice in section (d) below, and the disclaimer following this - list of conditions, in the documentation and/or other materials provided - with the distribution. - (c) The name of IBM may not be used to endorse or promote products derived from - this software without specific prior written permission. - (d) The text of the required copyright notice is: - Licensed Materials - Property of IBM - DB2 Storage Engine Enablement - Copyright IBM Corporation 2007,2008 - All rights reserved - -THIS SOFTWARE IS PROVIDED BY IBM CORPORATION "AS IS" AND ANY EXPRESS OR IMPLIED -WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF -MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT -SHALL IBM CORPORATION BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, -EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT -OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS -INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN -CONTRACT, STRICT LIABILITY, OR TORT INCLUDING NEGLIGENCE OR OTHERWISE) ARISING -IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY -OF SUCH DAMAGE. -*/ - - - -#include "db2i_ileBridge.h" -#include "mysql_priv.h" -#include "db2i_charsetSupport.h" -#include "ctype.h" -#include "ha_ibmdb2i.h" -#include "db2i_errors.h" -#include "wchar.h" - -const char ZERO_DATETIME_VALUE[] = "0000-00-00 00:00:00"; -const char ZERO_DATETIME_VALUE_SUBST[] = "0001-01-01 00:00:00"; -const char ZERO_DATE_VALUE[] = "0000-00-00"; -const char ZERO_DATE_VALUE_SUBST[] = "0001-01-01"; - - -/** - Put a BCD digit into a BCD string. - - @param[out] bcdString The BCD string to be modified - @param pos The position within the string to be updated. - @param val The value to be assigned into the string at pos. -*/ -static inline void bcdAssign(char* bcdString, uint pos, uint val) -{ - bcdString[pos/2] |= val << ((pos % 2) ? 0 : 4); -} - -/** - Read a BCD digit from a BCD string. - - @param[out] bcdString The BCD string to be read - @param pos The position within the string to be read. - - @return bcdGet The value of the BCD digit at pos. -*/ -static inline uint bcdGet(const char* bcdString, uint pos) -{ - return (bcdString[pos/2] >> ((pos % 2) ? 0 : 4)) & 0xf; -} - -/** - In-place convert a number in ASCII represenation to EBCDIC representation. - - @param string The string of ASCII characters - @param len The length of string -*/ -static inline void convertNumericToEbcdicFast(char* string, int len) -{ - for (int i = 0; i < len; ++i, ++string) - { - switch(*string) - { - case '-': - *string = 0x60; break; - case ':': - *string = 0x7A; break; - case '.': - *string = 0x4B; break; - default: - DBUG_ASSERT(isdigit(*string)); - *string += 0xF0 - '0'; - break; - } - } -} - - -/** - atoi()-like function for a 4-character EBCDIC string. - - @param string The EBCDIC string - @return a4toi_ebcdic The decimal value of the EBCDIC string -*/ -static inline uint16 a4toi_ebcdic(const uchar* string) -{ - return ((string[0]-0xF0) * 1000 + - (string[1]-0xF0) * 100 + - (string[2]-0xF0) * 10 + - (string[3]-0xF0)); -}; - - -/** - atoi()-like function for a 4-character EBCDIC string. - - @param string The EBCDIC string - @return a4toi_ebcdic The decimal value of the EBCDIC string -*/ -static inline uint8 a2toi_ebcdic(const uchar* string) -{ - return ((string[0]-0xF0) * 10 + - (string[1]-0xF0)); -}; - -/** - Perform character conversion for textual field data. -*/ -int ha_ibmdb2i::convertFieldChars(enum_conversionDirection direction, - uint16 fieldID, - const char* input, - char* output, - size_t ilen, - size_t olen, - size_t* outDataLen, - bool tacitErrors, - size_t* substChars) -{ - DBUG_PRINT("ha_ibmdb2i::convertFieldChars",("Direction: %d; length = %d", direction, ilen)); - - if (unlikely(ilen == 0)) - { - if (outDataLen) *outDataLen = 0; - return (0); - } - - iconv_t& conversion = db2Table->getConversionDefinition(direction, fieldID); - - if (unlikely(conversion == (iconv_t)(-1))) - { - return (DB2I_ERR_UNSUPP_CHARSET); - } - - size_t initOLen= olen; - size_t substitutedChars = 0; - int rc = iconv(conversion, (char**)&input, &ilen, &output, &olen, &substitutedChars ); - if (outDataLen) *outDataLen = initOLen - olen; - if (substChars) *substChars = substitutedChars; - if (unlikely(rc < 0)) - { - int er = errno; - if (er == EILSEQ) - { - if (!tacitErrors) getErrTxt(DB2I_ERR_ILL_CHAR, table->field[fieldID]->field_name); - return (DB2I_ERR_ILL_CHAR); - } - else - { - if (!tacitErrors) getErrTxt(DB2I_ERR_ICONV,er); - return (DB2I_ERR_ICONV); - } - } - if (unlikely(substitutedChars) && (!tacitErrors)) - { - warning(ha_thd(), DB2I_ERR_SUB_CHARS, table->field[fieldID]->field_name); - } - - return (0); -} - -/** - Append the appropriate default value clause onto a CREATE TABLE definition - - This was inspired by get_field_default_value in sql/sql_show.cc. - - @param field The field whose value is to be obtained - @param statement The string to receive the DEFAULT clause - @param quoteIt Does the data type require single quotes around the value? - @param ccsid The ccsid of the field value (if a string type); 0 if no conversion needed -*/ -static void get_field_default_value(Field *field, - String &statement, - bool quoteIt, - uint32 ccsid, - bool substituteZeroDates) -{ - if ((field->type() != FIELD_TYPE_BLOB && - !(field->flags & NO_DEFAULT_VALUE_FLAG) && - field->unireg_check != Field::NEXT_NUMBER)) - { - my_ptrdiff_t old_ptr= (my_ptrdiff_t) (field->table->s->default_values - field->table->record[0]); - field->move_field_offset(old_ptr); - - String defaultClause(64); - defaultClause.length(0); - defaultClause.append(" DEFAULT "); - if (!field->is_null()) - { - my_bitmap_map *old_map = tmp_use_all_columns(field->table, field->table->read_set); - char tmp[MAX_FIELD_WIDTH]; - - if (field->real_type() == MYSQL_TYPE_ENUM || - field->real_type() == MYSQL_TYPE_SET) - { - CHARSET_INFO *cs= &my_charset_bin; - uint len = (uint)(cs->cset->longlong10_to_str)(cs,tmp,sizeof(tmp), 10, field->val_int()); - tmp[len]=0; - defaultClause.append(tmp); - } - else - { - String type(tmp, sizeof(tmp), field->charset()); - field->val_str(&type); - if (type.length()) - { - if (field->type() == MYSQL_TYPE_DATE && - memcmp(type.ptr(), STRING_WITH_LEN(ZERO_DATE_VALUE)) == 0) - { - if (substituteZeroDates) - type.set(STRING_WITH_LEN(ZERO_DATE_VALUE_SUBST), field->charset()); - else - { - warning(current_thd, DB2I_ERR_WARN_COL_ATTRS, field->field_name); - return; - } - } - else if ((field->type() == MYSQL_TYPE_DATETIME || - field->type() == MYSQL_TYPE_TIMESTAMP) && - memcmp(type.ptr(), STRING_WITH_LEN(ZERO_DATETIME_VALUE)) == 0) - { - if (substituteZeroDates) - type.set(STRING_WITH_LEN(ZERO_DATETIME_VALUE_SUBST), field->charset()); - else - { - warning(current_thd, DB2I_ERR_WARN_COL_ATTRS, field->field_name); - return; - } - } - - - if (field->type() != MYSQL_TYPE_STRING && - field->type() != MYSQL_TYPE_VARCHAR && - field->type() != MYSQL_TYPE_BLOB && - field->type() != MYSQL_TYPE_BIT) - { - if (quoteIt) - defaultClause.append('\''); - defaultClause.append(type); - if (quoteIt) - defaultClause.append('\''); - } - else - { - int length; - char* out; - - // If a ccsid is specified, we need to make sure that the DEFAULT - // string is converted to that encoding. - if (ccsid != 0) - { - iconv_t iconvD; - if (getConversion(toDB2, field->charset(), ccsid, iconvD)) - { - warning(current_thd, DB2I_ERR_WARN_COL_ATTRS, field->field_name); - return; - } - - size_t ilen = type.length(); - size_t olen = 6 * ilen; - size_t origOlen = olen; - const char* in = type.ptr(); - const char* tempIn = in; - out = (char*)my_malloc(olen, MYF(MY_WME)); - char* tempOut = out; - size_t substitutedChars; - - if (iconv(iconvD, (char**)&tempIn, &ilen, &tempOut, &olen, &substitutedChars) < 0) - { - warning(current_thd, DB2I_ERR_WARN_COL_ATTRS, field->field_name); - my_free(out, MYF(0)); - return; - } - // Now we process the converted string to represent it as - // hexadecimal values. - - length = origOlen - olen; - } - else - { - length = type.length(); - out = (char*)my_malloc(length*2, MYF(MY_WME)); - memcpy(out, (char*)type.ptr(), length); - } - - if (length > 16370) - { - warning(current_thd, DB2I_ERR_WARN_COL_ATTRS, field->field_name); - my_free(out, MYF(0)); - return; - } - - if (ccsid == 1200) - defaultClause.append("ux'"); - else if (ccsid == 13488) - defaultClause.append("gx'"); - else if (field->charset() == &my_charset_bin) - defaultClause.append("binary(x'"); - else - defaultClause.append("x'"); - - const char hexMap[] = {'0','1','2','3','4','5','6','7','8','9','A','B','C','D','E','F'}; - for (int c = length-1; c >= 0; --c) - { - out[c*2+1] = hexMap[out[c] & 0xF]; - out[c*2] = hexMap[out[c] >> 4]; - } - - defaultClause.append(out, length*2); - defaultClause.append('\''); - if (field->charset() == &my_charset_bin) - defaultClause.append(")"); - - my_free(out, MYF(0)); - } - } - else - defaultClause.length(0); - } - tmp_restore_column_map(field->table->read_set, old_map); - } - else if (field->maybe_null()) - defaultClause.append(STRING_WITH_LEN("NULL")); - - if (old_ptr) - field->move_field_offset(-old_ptr); - - statement.append(defaultClause); - } -} - - - - -/** - Convert a MySQL field definition into its corresponding DB2 type. - - The result will be appended to mapping as a DB2 SQL phrase. - - @param field The MySQL field to be evaluated - @param[out] mapping The receiver for the DB2 SQL syntax - @param timeFormat The format to be used for mapping the TIME type -*/ -int ha_ibmdb2i::getFieldTypeMapping(Field* field, - String& mapping, - enum_TimeFormat timeFormat, - enum_BlobMapping blobMapping, - enum_ZeroDate zeroDateHandling, - bool propagateDefaults, - enum_YearFormat yearFormat) -{ - char stringBuildBuffer[257]; - uint32 fieldLength; - bool defaultNeedsQuotes = false; - uint16 db2Ccsid = 0; - - CHARSET_INFO* fieldCharSet = field->charset(); - switch (field->type()) - { - case MYSQL_TYPE_NEWDECIMAL: - { - uint precision= ((Field_new_decimal*)field)->precision; - uint scale= field->decimals(); - - if (precision <= MAX_DEC_PRECISION) - { - sprintf(stringBuildBuffer,"DECIMAL(%d, %d)",precision,scale); - } - else - { - if (scale > precision - MAX_DEC_PRECISION) - { - scale = scale - (precision - MAX_DEC_PRECISION); - precision = MAX_DEC_PRECISION; - sprintf(stringBuildBuffer,"DECIMAL(%d, %d)",precision,scale); - } - else - { - return HA_ERR_UNSUPPORTED; - } - warning(ha_thd(), DB2I_ERR_PRECISION); - } - - mapping.append(stringBuildBuffer); - } - break; - case MYSQL_TYPE_TINY: - mapping.append(STRING_WITH_LEN("SMALLINT")); - break; - case MYSQL_TYPE_SHORT: - if (((Field_num*)field)->unsigned_flag) - mapping.append(STRING_WITH_LEN("INT")); - else - mapping.append(STRING_WITH_LEN("SMALLINT")); - break; - case MYSQL_TYPE_LONG: - if (((Field_num*)field)->unsigned_flag) - mapping.append(STRING_WITH_LEN("BIGINT")); - else - mapping.append(STRING_WITH_LEN("INT")); - break; - case MYSQL_TYPE_FLOAT: - mapping.append(STRING_WITH_LEN("REAL")); - break; - case MYSQL_TYPE_DOUBLE: - mapping.append(STRING_WITH_LEN("DOUBLE")); - break; - case MYSQL_TYPE_LONGLONG: - if (((Field_num*)field)->unsigned_flag) - mapping.append(STRING_WITH_LEN("DECIMAL(20,0)")); - else - mapping.append(STRING_WITH_LEN("BIGINT")); - break; - case MYSQL_TYPE_INT24: - mapping.append(STRING_WITH_LEN("INTEGER")); - break; - case MYSQL_TYPE_DATE: - case MYSQL_TYPE_NEWDATE: - mapping.append(STRING_WITH_LEN("DATE")); - defaultNeedsQuotes = true; - break; - case MYSQL_TYPE_TIME: - if (timeFormat == TIME_OF_DAY) - { - mapping.append(STRING_WITH_LEN("TIME")); - defaultNeedsQuotes = true; - } - else - mapping.append(STRING_WITH_LEN("INTEGER")); - break; - case MYSQL_TYPE_DATETIME: - mapping.append(STRING_WITH_LEN("TIMESTAMP")); - defaultNeedsQuotes = true; - break; - case MYSQL_TYPE_TIMESTAMP: - mapping.append(STRING_WITH_LEN("TIMESTAMP")); - - if (table_share->timestamp_field == field && propagateDefaults) - { - switch (((Field_timestamp*)field)->get_auto_set_type()) - { - case TIMESTAMP_NO_AUTO_SET: - break; - case TIMESTAMP_AUTO_SET_ON_INSERT: - mapping.append(STRING_WITH_LEN(" DEFAULT CURRENT_TIMESTAMP")); - break; - case TIMESTAMP_AUTO_SET_ON_UPDATE: - if (osVersion.v >= 6 && - !field->is_null()) - { - mapping.append(STRING_WITH_LEN(" GENERATED BY DEFAULT FOR EACH ROW ON UPDATE AS ROW CHANGE TIMESTAMP")); - warning(ha_thd(), DB2I_ERR_WARN_COL_ATTRS, field->field_name); - } - else - warning(ha_thd(), DB2I_ERR_WARN_COL_ATTRS, field->field_name); - break; - case TIMESTAMP_AUTO_SET_ON_BOTH: - if (osVersion.v >= 6 && - !field->is_null()) - mapping.append(STRING_WITH_LEN(" GENERATED BY DEFAULT FOR EACH ROW ON UPDATE AS ROW CHANGE TIMESTAMP")); - else - { - mapping.append(STRING_WITH_LEN(" DEFAULT CURRENT_TIMESTAMP")); - warning(ha_thd(), DB2I_ERR_WARN_COL_ATTRS, field->field_name); - } - break; - } - } - else - defaultNeedsQuotes = true; - break; - case MYSQL_TYPE_YEAR: - if (yearFormat == CHAR4) - { - mapping.append(STRING_WITH_LEN("CHAR(4) CCSID 1208")); - defaultNeedsQuotes = true; - } - else - { - mapping.append(STRING_WITH_LEN("SMALLINT")); - defaultNeedsQuotes = false; - } - break; - case MYSQL_TYPE_BIT: - sprintf(stringBuildBuffer, "BINARY(%d)", (field->max_display_length() / 8) + 1); - mapping.append(stringBuildBuffer); - break; - case MYSQL_TYPE_BLOB: - case MYSQL_TYPE_VARCHAR: - case MYSQL_TYPE_STRING: - { - if (field->real_type() == MYSQL_TYPE_ENUM || - field->real_type() == MYSQL_TYPE_SET) - { - mapping.append(STRING_WITH_LEN("BIGINT")); - } - else - { - defaultNeedsQuotes = true; - - fieldLength = field->max_display_length(); // Get field byte length - - if (fieldCharSet == &my_charset_bin) - { - if (field->type() == MYSQL_TYPE_STRING) - { - sprintf(stringBuildBuffer, "BINARY(%d)", max(fieldLength, 1)); - } - else - { - if (fieldLength <= MAX_VARCHAR_LENGTH) - { - sprintf(stringBuildBuffer, "VARBINARY(%d)", max(fieldLength, 1)); - } - else if (blobMapping == AS_VARCHAR && - (field->flags & PART_KEY_FLAG)) - { - sprintf(stringBuildBuffer, "LONG VARBINARY "); - } - else - { - fieldLength = min(MAX_BLOB_LENGTH, fieldLength); - sprintf(stringBuildBuffer, "BLOB(%d)", max(fieldLength, 1)); - } - } - mapping.append(stringBuildBuffer); - } - else - { - if (field->type() == MYSQL_TYPE_STRING) - { - if (fieldLength > MAX_CHAR_LENGTH) - return 1; - if (fieldCharSet->mbmaxlen > 1) - { - if (memcmp(fieldCharSet->name, "ucs2_", sizeof("ucs2_")-1) == 0 ) // UCS2 - { - sprintf(stringBuildBuffer, "GRAPHIC(%d)", max(fieldLength / fieldCharSet->mbmaxlen, 1)); // Number of characters - db2Ccsid = 13488; - } - else if (memcmp(fieldCharSet->name, "utf8_", sizeof("utf8_")-1) == 0 && - strcmp(fieldCharSet->name, "utf8_general_ci") != 0) - { - sprintf(stringBuildBuffer, "CHAR(%d)", max(fieldLength, 1)); // Number of bytes - db2Ccsid = 1208; - } - else - { - sprintf(stringBuildBuffer, "GRAPHIC(%d)", max(fieldLength / fieldCharSet->mbmaxlen, 1)); // Number of characters - db2Ccsid = 1200; - } - } - else - { - sprintf(stringBuildBuffer, "CHAR(%d)", max(fieldLength, 1)); - } - mapping.append(stringBuildBuffer); - } - else - { - if (fieldLength <= MAX_VARCHAR_LENGTH) - { - if (fieldCharSet->mbmaxlen > 1) - { - if (memcmp(fieldCharSet->name, "ucs2_", sizeof("ucs2_")-1) == 0 ) // UCS2 - { - sprintf(stringBuildBuffer, "VARGRAPHIC(%d)", max(fieldLength / fieldCharSet->mbmaxlen, 1)); // Number of characters - db2Ccsid = 13488; - } - else if (memcmp(fieldCharSet->name, "utf8_", sizeof("utf8_")-1) == 0 && - strcmp(fieldCharSet->name, "utf8_general_ci") != 0) - { - sprintf(stringBuildBuffer, "VARCHAR(%d)", max(fieldLength, 1)); // Number of bytes - db2Ccsid = 1208; - } - else - { - sprintf(stringBuildBuffer, "VARGRAPHIC(%d)", max(fieldLength / fieldCharSet->mbmaxlen, 1)); // Number of characters - db2Ccsid = 1200; - } - } - else - { - sprintf(stringBuildBuffer, "VARCHAR(%d)", max(fieldLength, 1)); - } - } - else if (blobMapping == AS_VARCHAR && - (field->flags & PART_KEY_FLAG)) - { - if (fieldCharSet->mbmaxlen > 1) - { - if (memcmp(fieldCharSet->name, "ucs2_", sizeof("ucs2_")-1) == 0 ) // UCS2 - { - sprintf(stringBuildBuffer, "LONG VARGRAPHIC "); - db2Ccsid = 13488; - } - else if (memcmp(fieldCharSet->name, "utf8_", sizeof("utf8_")-1) == 0 && - strcmp(fieldCharSet->name, "utf8_general_ci") != 0) - { - sprintf(stringBuildBuffer, "LONG VARCHAR "); - db2Ccsid = 1208; - } - else - { - sprintf(stringBuildBuffer, "LONG VARGRAPHIC "); - db2Ccsid = 1200; - } - } - else - { - sprintf(stringBuildBuffer, "LONG VARCHAR "); - } - } - else - { - fieldLength = min(MAX_BLOB_LENGTH, fieldLength); - - if (fieldCharSet->mbmaxlen > 1) - { - if (memcmp(fieldCharSet->name, "ucs2_", sizeof("ucs2_")-1) == 0 ) // UCS2 - { - sprintf(stringBuildBuffer, "DBCLOB(%d)", max(fieldLength / fieldCharSet->mbmaxlen, 1)); // Number of characters - db2Ccsid = 13488; - } - else if (memcmp(fieldCharSet->name, "utf8_", sizeof("utf8_")-1) == 0 && - strcmp(fieldCharSet->name, "utf8_general_ci") != 0) - { - sprintf(stringBuildBuffer, "CLOB(%d)", max(fieldLength, 1)); // Number of bytes - db2Ccsid = 1208; - } - else - { - sprintf(stringBuildBuffer, "DBCLOB(%d)", max(fieldLength / fieldCharSet->mbmaxlen, 1)); // Number of characters - db2Ccsid = 1200; - } - } - else - { - sprintf(stringBuildBuffer, "CLOB(%d)", max(fieldLength, 1)); // Number of characters - } - } - - mapping.append(stringBuildBuffer); - } - if (db2Ccsid == 0) // If not overriding CCSID - { - int32 rtnCode = convertIANAToDb2Ccsid(fieldCharSet->csname, &db2Ccsid); - if (rtnCode) - return rtnCode; - } - - if (db2Ccsid != 1208 && - db2Ccsid != 13488) - { - // Check whether there is a character conversion available. - iconv_t temp; - int32 rc = getConversion(toDB2, fieldCharSet, db2Ccsid, temp); - if (unlikely(rc)) - return rc; - } - - sprintf(stringBuildBuffer, " CCSID %d ", db2Ccsid); - mapping.append(stringBuildBuffer); - } - } - } - break; - - } - - if (propagateDefaults) - get_field_default_value(field, - mapping, - defaultNeedsQuotes, - db2Ccsid, - (zeroDateHandling==SUBSTITUTE_0001_01_01)); - - return 0; -} - - -/** - Convert MySQL field data into the equivalent DB2 format - - @param field The MySQL field to be converted - @param db2Field The corresponding DB2 field definition - @param db2Buf The buffer to receive the converted data - @param data NULL if field points to the correct data; otherwise, - the data to be converted (for use with keys) -*/ -int32 ha_ibmdb2i::convertMySQLtoDB2(Field* field, const DB2Field& db2Field, char* db2Buf, const uchar* data) -{ - enum_field_types fieldType = field->type(); - switch (fieldType) - { - case MYSQL_TYPE_NEWDECIMAL: - { - uint precision= ((Field_new_decimal*)field)->precision; - uint scale= field->decimals(); - uint db2Precision = min(precision, MAX_DEC_PRECISION); - uint truncationAmount = precision - db2Precision; - - if (scale >= truncationAmount) - { - String tempString(precision+2); - - if (data == NULL) - { - field->val_str((String*)&tempString, (String*)(NULL)); - } - else - { - field->val_str(&tempString, data); - } - const char* temp = tempString.ptr(); - char packed[32]; - memset(&packed, 0, sizeof(packed)); - - int bcdPos = db2Precision - (db2Precision % 2 ? 1 : 0); - bcdAssign(packed, bcdPos+1, (temp[0] == '-' ? 0xD : 0xF)); - - int strPos=tempString.length() - 1 - truncationAmount; - - for (;strPos >= 0 && bcdPos >= 0; strPos--) - { - if (my_isdigit(&my_charset_latin1, temp[strPos])) - { - bcdAssign(packed, bcdPos, temp[strPos]-'0'); - --bcdPos; - } - } - memcpy(db2Buf, &packed, (db2Precision/2)+1); - } - - } - break; - case MYSQL_TYPE_TINY: - { - int16 temp = (data == NULL ? field->val_int() : field->val_int(data)); - memcpy(db2Buf , &temp, sizeof(temp)); - } - break; - case MYSQL_TYPE_SHORT: - { - if (((Field_num*)field)->unsigned_flag) - { - memset(db2Buf, 0, 2); - memcpy(db2Buf+2, (data == NULL ? field->ptr : data), 2); - } - else - { - memcpy(db2Buf, (data == NULL ? field->ptr : data), 2); - } - } - break; - case MYSQL_TYPE_LONG: - { - if (((Field_num*)field)->unsigned_flag) - { - memset(db2Buf, 0, 4); - memcpy(db2Buf+4, (data == NULL ? field->ptr : data), 4); - } - else - { - memcpy(db2Buf, (data == NULL ? field->ptr : data), 4); - } - } - break; - case MYSQL_TYPE_FLOAT: - { - memcpy(db2Buf, (data == NULL ? field->ptr : data), 4); - } - break; - case MYSQL_TYPE_DOUBLE: - { - memcpy(db2Buf, (data == NULL ? field->ptr : data), 8); - } - break; - case MYSQL_TYPE_TIMESTAMP: - case MYSQL_TYPE_DATETIME: - { - String tempString(27); - if (data == NULL) - { - field->val_str(&tempString, &tempString); - } - else - { - field->val_str(&tempString, data); - } - memset(db2Buf, '0', 26); - memcpy(db2Buf, tempString.ptr(), tempString.length()); - if (strncmp(db2Buf,ZERO_DATETIME_VALUE,strlen(ZERO_DATETIME_VALUE)) == 0) - { - if (cachedZeroDateOption == SUBSTITUTE_0001_01_01) - memcpy(db2Buf, ZERO_DATETIME_VALUE_SUBST, sizeof(ZERO_DATETIME_VALUE_SUBST)); - else - { - getErrTxt(DB2I_ERR_INVALID_COL_VALUE, field->field_name); - return(DB2I_ERR_INVALID_COL_VALUE); - } - } - (db2Buf)[10] = '-'; - (db2Buf)[13] = (db2Buf)[16] = (db2Buf)[19] = '.'; - - convertNumericToEbcdicFast(db2Buf, 26); - } - break; - case MYSQL_TYPE_LONGLONG: - { - if (((Field_num*)field)->unsigned_flag) - { - char temp[23]; - String tempString(temp, sizeof(temp), &my_charset_latin1); - - if (data == NULL) - { - field->val_str((String*)&tempString, (String*)(NULL)); - } - else - { - field->val_str(&tempString, data); - } - char packed[11]; - memset(packed, 0, sizeof(packed)); - bcdAssign(packed, 21, (temp[0] == '-' ? 0xD : 0xF)); - int strPos=tempString.length()-1; - int bcdPos=20; - - for (;strPos >= 0; strPos--) - { - if (my_isdigit(&my_charset_latin1, temp[strPos])) - { - bcdAssign(packed, bcdPos, temp[strPos]-'0'); - --bcdPos; - } - } - memcpy(db2Buf, &packed, 11); - } - else - { - *(uint64*)db2Buf = *(uint64*)(data == NULL ? field->ptr : data); - } - } - break; - case MYSQL_TYPE_INT24: - { - int32 temp= (data == NULL ? field->val_int() : field->val_int(data)); - memcpy(db2Buf , &temp, sizeof(temp)); - } - break; - case MYSQL_TYPE_DATE: - case MYSQL_TYPE_NEWDATE: - { - String tempString(11); - if (data == NULL) - { - field->val_str(&tempString, (String*)NULL); - } - else - { - field->val_str(&tempString, data); - } - memcpy(db2Buf, tempString.ptr(), 10); - if (strncmp(db2Buf,ZERO_DATE_VALUE,strlen(ZERO_DATE_VALUE)) == 0) - { - if (cachedZeroDateOption == SUBSTITUTE_0001_01_01) - memcpy(db2Buf, ZERO_DATE_VALUE_SUBST, sizeof(ZERO_DATE_VALUE_SUBST)); - else - { - getErrTxt(DB2I_ERR_INVALID_COL_VALUE,field->field_name); - return(DB2I_ERR_INVALID_COL_VALUE); - } - } - - convertNumericToEbcdicFast(db2Buf,10); - } - break; - case MYSQL_TYPE_TIME: - { - if (db2Field.getType() == QMY_TIME) - { - String tempString(10); - if (data == NULL) - { - field->val_str(&tempString, (String*)NULL); - } - else - { - field->val_str(&tempString, data); - } - memcpy(db2Buf, tempString.ptr(), 8); - (db2Buf)[2]=(db2Buf)[5] = '.'; - - convertNumericToEbcdicFast(db2Buf, 8); - } - else - { - int32 temp = sint3korr(data == NULL ? field->ptr : data); - memcpy(db2Buf, &temp, sizeof(temp)); - } - } - break; - case MYSQL_TYPE_YEAR: - { - String tempString(5); - if (db2Field.getType() == QMY_CHAR) - { - if (data == NULL) - { - field->val_str(&tempString, (String*)NULL); - } - else - { - field->val_str(&tempString, data); - } - memcpy(db2Buf, tempString.ptr(), 4); - } - else - { - uint8 temp = *(uint8*)(data == NULL ? field->ptr : data); - *(uint16*)(db2Buf) = (temp ? temp + 1900 : 0); - } - } - break; - case MYSQL_TYPE_BIT: - { - int bytesToCopy = db2Field.getByteLengthInRecord(); - - if (data == NULL) - { - uint64 temp = field->val_int(); - memcpy(db2Buf, - ((char*)&temp) + (sizeof(temp) - bytesToCopy), - bytesToCopy); - } - else - { - memcpy(db2Buf, - data, - bytesToCopy); - } - } - break; - case MYSQL_TYPE_VARCHAR: - case MYSQL_TYPE_STRING: - case MYSQL_TYPE_BLOB: - { - if (field->real_type() == MYSQL_TYPE_ENUM || - field->real_type() == MYSQL_TYPE_SET) - { - int64 temp= (data == NULL ? field->val_int() : field->val_int(data)); - *(int64*)db2Buf = temp; - } - else - { - const uchar* dataToStore; - uint32 bytesToStore; - uint32 bytesToPad = 0; - CHARSET_INFO* fieldCharSet = field->charset(); - uint32 maxDisplayLength = field->max_display_length(); - switch (fieldType) - { - case MYSQL_TYPE_STRING: - { - bytesToStore = maxDisplayLength; - if (data == NULL) - dataToStore = field->ptr; - else - dataToStore = data; - } - break; - case MYSQL_TYPE_VARCHAR: - { - - if (data == NULL) - { - bytesToStore = field->data_length(); - dataToStore = field->ptr + ((Field_varstring*)field)->length_bytes; - } - else - { - // Key lens are stored little-endian - bytesToStore = *(uint8*)data + ((*(uint8*)(data+1)) << 8); - dataToStore = data + 2; - } - bytesToPad = maxDisplayLength - bytesToStore; - } - break; - case MYSQL_TYPE_BLOB: - { - if (data == NULL) - { - bytesToStore = ((Field_blob*)field)->get_length(); - bytesToPad = maxDisplayLength - bytesToStore; - ((Field_blob*)field)->get_ptr((uchar**)&dataToStore); - } - else - { - // Key lens are stored little-endian - bytesToStore = *(uint8*)data + ((*(uint8*)(data+1)) << 8); - dataToStore = data + 2; - } - } - break; - } - - int32 rc; - uint16 db2FieldType = db2Field.getType(); - switch(db2FieldType) - { - case QMY_CHAR: - if (maxDisplayLength == 0) - bytesToPad = 1; - case QMY_VARCHAR: - if (db2FieldType == QMY_VARCHAR) - { - db2Buf += sizeof(uint16); - bytesToPad = 0; - } - - if (bytesToStore > db2Field.getDataLengthInRecord()) - { - bytesToStore = db2Field.getDataLengthInRecord(); - field->set_warning(MYSQL_ERROR::WARN_LEVEL_WARN, WARN_DATA_TRUNCATED, 1); - } - - if (fieldCharSet == &my_charset_bin) // If binary - { - if (bytesToStore) - memcpy(db2Buf, dataToStore, bytesToStore); - if (bytesToPad) - memset(db2Buf + bytesToStore, 0x00, bytesToPad); - } - else if (db2Field.getCCSID() == 1208) // utf8 - { - if (bytesToStore) - memcpy(db2Buf, dataToStore, bytesToStore); - if (bytesToPad) - memset(db2Buf + bytesToStore, ' ', bytesToPad); - } - else // single-byte ASCII to EBCDIC - { - DBUG_ASSERT(fieldCharSet->mbmaxlen == 1); - if (bytesToStore) - { - rc = convertFieldChars(toDB2, field->field_index, (char*)dataToStore, db2Buf, bytesToStore, bytesToStore, NULL); - if (rc) - return rc; - } - if (bytesToPad) - memset(db2Buf + bytesToStore, 0x40, bytesToPad); - } - - if (db2FieldType == QMY_VARCHAR) - *(uint16*)(db2Buf - sizeof(uint16)) = bytesToStore; - break; - case QMY_VARGRAPHIC: - db2Buf += sizeof(uint16); - bytesToPad = 0; - case QMY_GRAPHIC: - if (maxDisplayLength == 0 && db2FieldType == QMY_GRAPHIC) - bytesToPad = 2; - - if (db2Field.getCCSID() == 13488) - { - if (bytesToStore) - memcpy(db2Buf, dataToStore, bytesToStore); - if (bytesToPad) - memset16((db2Buf + bytesToStore), 0x0020, bytesToPad/2); - } - else - { - size_t db2BytesToStore; - size_t maxDb2BytesToStore; - - if (maxDisplayLength == 0 && db2FieldType == QMY_GRAPHIC) - maxDb2BytesToStore = 2; - else - maxDb2BytesToStore = min(((bytesToStore * 2) / fieldCharSet->mbminlen), - ((maxDisplayLength * 2) / fieldCharSet->mbmaxlen)); - - if (bytesToStore == 0) - db2BytesToStore = 0; - else - { - rc = convertFieldChars(toDB2, field->field_index, (char*)dataToStore, db2Buf, bytesToStore, maxDb2BytesToStore, &db2BytesToStore); - if (rc) - return rc; - bytesToStore = db2BytesToStore; - } - if (db2BytesToStore < maxDb2BytesToStore) // If need to pad - memset16((db2Buf + db2BytesToStore), 0x0020, (maxDb2BytesToStore - db2BytesToStore)/2); - } - - if (db2FieldType == QMY_VARGRAPHIC) - *(uint16*)(db2Buf-sizeof(uint16)) = bytesToStore/2; - break; - case QMY_BLOBCLOB: - case QMY_DBCLOB: - { - DBUG_ASSERT(data == NULL); - DB2LobField* lobField = (DB2LobField*)(db2Buf + db2Field.calcBlobPad()); - - if ((fieldCharSet == &my_charset_bin) || // binary or - (db2Field.getCCSID()==13488) || - (db2Field.getCCSID()==1208)) // binary UTF8 - { - } - else - { - char* temp; - int32 rc; - size_t db2BytesToStore; - if (fieldCharSet->mbmaxlen == 1) // single-byte ASCII to EBCDIC - { - temp = getCharacterConversionBuffer(field->field_index, bytesToStore); - rc = convertFieldChars(toDB2, field->field_index, (char*)dataToStore,temp,bytesToStore, bytesToStore, NULL); - if (rc) - return (rc); - } - else // Else Far East, special UTF8 or non-special UTF8/UCS2 - { - size_t maxDb2BytesToStore; - maxDb2BytesToStore = min(((bytesToStore * 2) / fieldCharSet->mbminlen), - ((maxDisplayLength * 2) / fieldCharSet->mbmaxlen)); - temp = getCharacterConversionBuffer(field->field_index, maxDb2BytesToStore); - rc = convertFieldChars(toDB2, field->field_index, (char*)dataToStore,temp,bytesToStore, maxDb2BytesToStore, &db2BytesToStore); - if (rc) - return (rc); - bytesToStore = db2BytesToStore; - } - dataToStore = (uchar*)temp; - } - - uint16 blobID = db2Table->getBlobIdFromField(field->field_index); - if (blobWriteBuffers[blobID] != (char*)dataToStore) - blobWriteBuffers[blobID].reassign((char*)dataToStore); - if ((void*)blobWriteBuffers[blobID]) - lobField->dataHandle = (ILEMemHandle)blobWriteBuffers[blobID]; - else - lobField->dataHandle = 0; - lobField->length = bytesToStore / (db2FieldType == QMY_DBCLOB ? 2 : 1); - } - break; - } - } - } - break; - default: - DBUG_ASSERT(0); - break; - } - - return (ha_thd()->is_error()); -} - - -/** - Convert DB2 field data into the equivalent MySQL format - - @param db2Field The DB2 field definition - @param field The MySQL field to receive the converted data - @param buf The DB2 data to be converted -*/ -int32 ha_ibmdb2i::convertDB2toMySQL(const DB2Field& db2Field, Field* field, const char* buf) -{ - int32 storeRC = 0; // Result of the field->store() operation - - const char* bufPtr = buf + db2Field.getBufferOffset(); - - switch (field->type()) - { - case MYSQL_TYPE_NEWDECIMAL: - { - uint precision= ((Field_new_decimal*)field)->precision; - uint scale= field->decimals(); - uint db2Precision = min(precision, MAX_DEC_PRECISION); - uint decimalPlace = precision-scale+1; - char temp[80]; - - if (precision <= MAX_DEC_PRECISION || - scale > precision - MAX_DEC_PRECISION) - { - uint numNibbles = db2Precision + (db2Precision % 2 ? 0 : 1); - - temp[0] = (bcdGet(bufPtr, numNibbles) == 0xD ? '-' : ' '); - int strPos=1; - int bcdPos=(db2Precision % 2 ? 0 : 1); - - for (;bcdPos < numNibbles; bcdPos++, strPos++) - { - if (strPos == decimalPlace) - { - temp[strPos] = '.'; - strPos++; - } - - temp[strPos] = bcdGet(bufPtr, bcdPos) + '0'; - } - - temp[strPos] = 0; - - storeRC = field->store(temp, strPos, &my_charset_latin1); - } - } - break; - case MYSQL_TYPE_TINY: - { - storeRC = field->store(*(int16*)bufPtr, ((Field_num*)field)->unsigned_flag); - } - break; - case MYSQL_TYPE_SHORT: - { - if (((Field_num*)field)->unsigned_flag) - { - storeRC = field->store(*(int32*)bufPtr, TRUE); - } - else - { - storeRC = field->store(*(int16*)bufPtr, FALSE); - } - } - break; - case MYSQL_TYPE_LONG: - { - if (((Field_num*)field)->unsigned_flag) - { - storeRC = field->store(*(int64*)bufPtr, TRUE); - } - else - { - storeRC = field->store(*(int32*)bufPtr, FALSE); - } - } - break; - case MYSQL_TYPE_FLOAT: - { - storeRC = field->store(*(float*)bufPtr); - } - break; - case MYSQL_TYPE_DOUBLE: - { - storeRC = field->store(*(double*)bufPtr); - } - break; - case MYSQL_TYPE_LONGLONG: - { - char temp[23]; - if (((Field_num*)field)->unsigned_flag) - { - temp[0] = (bcdGet(bufPtr, 21) == 0xD ? '-' : ' '); - int strPos=1; - int bcdPos=0; - - for (;bcdPos <= 20; bcdPos++, strPos++) - { - temp[strPos] = bcdGet(bufPtr, bcdPos) + '0'; - } - - temp[strPos] = 0; - - storeRC = field->store(temp, strPos, &my_charset_latin1); - } - else - { - storeRC = field->store(*(int64*)bufPtr, FALSE); - } - } - break; - case MYSQL_TYPE_INT24: - { - storeRC = field->store(*(int32*)bufPtr, ((Field_num*)field)->unsigned_flag); - } - break; - case MYSQL_TYPE_DATE: - case MYSQL_TYPE_NEWDATE: - { - longlong value= a4toi_ebcdic((uchar*)bufPtr) * 10000 + - a2toi_ebcdic((uchar*)bufPtr+5) * 100 + - a2toi_ebcdic((uchar*)bufPtr+8); - - if (cachedZeroDateOption == SUBSTITUTE_0001_01_01 && - value == (10000 + 100 + 1)) - value = 0; - - storeRC = field->store(value); - } - break; - case MYSQL_TYPE_TIME: - { - if (db2Field.getType() == QMY_TIME) - { - longlong value= a2toi_ebcdic((uchar*)bufPtr) * 10000 + - a2toi_ebcdic((uchar*)bufPtr+3) * 100 + - a2toi_ebcdic((uchar*)bufPtr+6); - - storeRC = field->store(value); - } - else - storeRC = field->store(*((int32*)bufPtr)); - } - break; - case MYSQL_TYPE_TIMESTAMP: - case MYSQL_TYPE_DATETIME: - { - longlong value= (a4toi_ebcdic((uchar*)bufPtr) * 10000 + - a2toi_ebcdic((uchar*)bufPtr+5) * 100 + - a2toi_ebcdic((uchar*)bufPtr+8)) * 1000000LL + - (a2toi_ebcdic((uchar*)bufPtr+11) * 10000 + - a2toi_ebcdic((uchar*)bufPtr+14) * 100 + - a2toi_ebcdic((uchar*)bufPtr+17)); - - if (cachedZeroDateOption == SUBSTITUTE_0001_01_01 && - value == (10000 + 100 + 1) * 1000000LL) - value = 0; - - storeRC = field->store(value); - } - break; - case MYSQL_TYPE_YEAR: - { - if (db2Field.getType() == QMY_CHAR) - { - storeRC = field->store(bufPtr, 4, &my_charset_bin); - } - else - { - storeRC = field->store(*((uint16*)bufPtr)); - } - } - break; - case MYSQL_TYPE_BIT: - { - uint64 temp= 0; - int bytesToCopy= db2Field.getByteLengthInRecord(); - memcpy(((char*)&temp) + (sizeof(temp) - bytesToCopy), bufPtr, bytesToCopy); - storeRC = field->store(temp, TRUE); - } - break; - case MYSQL_TYPE_VARCHAR: - case MYSQL_TYPE_STRING: - case MYSQL_TYPE_BLOB: - { - if (field->real_type() == MYSQL_TYPE_ENUM || - field->real_type() == MYSQL_TYPE_SET) - { - storeRC = field->store(*(int64*)bufPtr); - } - else - { - - const char* dataToStore = NULL; - uint32 bytesToStore = 0; - CHARSET_INFO* fieldCharSet = field->charset(); - switch(db2Field.getType()) - { - case QMY_CHAR: - case QMY_GRAPHIC: - { - bytesToStore = db2Field.getByteLengthInRecord(); - if (bytesToStore == 0) - bytesToStore = 1; - dataToStore = bufPtr; - } - break; - case QMY_VARCHAR: - { - bytesToStore = *(uint16*)bufPtr; - dataToStore = bufPtr+sizeof(uint16); - } - break; - case QMY_VARGRAPHIC: - { - /* For VARGRAPHIC, convert the number of double-byte characters - to the number of bytes. */ - bytesToStore = (*(uint16*)bufPtr)*2; - dataToStore = bufPtr+sizeof(uint16); - } - break; - case QMY_DBCLOB: - case QMY_BLOBCLOB: - { - DB2LobField* lobField = (DB2LobField* )(bufPtr + db2Field.calcBlobPad()); - bytesToStore = lobField->length * (db2Field.getType() == QMY_DBCLOB ? 2 : 1); - dataToStore = (char*)blobReadBuffers->getBufferPtr(field->field_index); - } - break; - - } - - if ((fieldCharSet != &my_charset_bin) && // not binary & - (db2Field.getCCSID() != 13488) && // not UCS2 & - (db2Field.getCCSID() != 1208)) - { - char* temp; - size_t db2BytesToStore; - int rc; - if (fieldCharSet->mbmaxlen > 1) - { - size_t maxDb2BytesToStore = ((bytesToStore / 2) * fieldCharSet->mbmaxlen); // Worst case for number of bytes - temp = getCharacterConversionBuffer(field->field_index, maxDb2BytesToStore); - rc = convertFieldChars(toMySQL, field->field_index, dataToStore, temp, bytesToStore, maxDb2BytesToStore, &db2BytesToStore); - bytesToStore = db2BytesToStore; - } - else // single-byte ASCII to EBCDIC - { - temp = getCharacterConversionBuffer(field->field_index, bytesToStore); - rc = convertFieldChars(toMySQL, field->field_index, dataToStore, temp, bytesToStore, bytesToStore, NULL); - } - if (rc) - return (rc); - dataToStore = temp; - } - - if ((field)->flags & BLOB_FLAG) - ((Field_blob*)(field))->set_ptr(bytesToStore, (uchar*)dataToStore); - else - storeRC = field->store(dataToStore, bytesToStore, &my_charset_bin); - } - } - break; - default: - DBUG_ASSERT(0); - break; - - } - - if (storeRC) - { - invalidDataFound = true; - } - - return 0; -} diff --git a/storage/ibmdb2i/db2i_errors.cc b/storage/ibmdb2i/db2i_errors.cc deleted file mode 100644 index dd50e40e61b..00000000000 --- a/storage/ibmdb2i/db2i_errors.cc +++ /dev/null @@ -1,297 +0,0 @@ -/* -Licensed Materials - Property of IBM -DB2 Storage Engine Enablement -Copyright IBM Corporation 2007,2008 -All rights reserved - -Redistribution and use in source and binary forms, with or without modification, -are permitted provided that the following conditions are met: - (a) Redistributions of source code must retain this list of conditions, the - copyright notice in section {d} below, and the disclaimer following this - list of conditions. - (b) Redistributions in binary form must reproduce this list of conditions, the - copyright notice in section (d) below, and the disclaimer following this - list of conditions, in the documentation and/or other materials provided - with the distribution. - (c) The name of IBM may not be used to endorse or promote products derived from - this software without specific prior written permission. - (d) The text of the required copyright notice is: - Licensed Materials - Property of IBM - DB2 Storage Engine Enablement - Copyright IBM Corporation 2007,2008 - All rights reserved - -THIS SOFTWARE IS PROVIDED BY IBM CORPORATION "AS IS" AND ANY EXPRESS OR IMPLIED -WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF -MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT -SHALL IBM CORPORATION BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, -EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT -OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS -INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN -CONTRACT, STRICT LIABILITY, OR TORT INCLUDING NEGLIGENCE OR OTHERWISE) ARISING -IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY -OF SUCH DAMAGE. -*/ - - -#include "db2i_errors.h" -#include "db2i_ileBridge.h" -#include "db2i_charsetSupport.h" -#include "mysql_priv.h" -#include "stdarg.h" - -#define MAX_MSGSTRING 109 - -/* - The following strings are associated with errors that can be produced - within the storage engine proper. -*/ -static const char* engineErrors[MAX_MSGSTRING] = -{ - {""}, - {"Error opening codeset conversion from %.64s to %.64s (errno = %d)"}, - {"Invalid %-.10s name '%-.128s'"}, - {"Unsupported move from '%-.128s' to '%-.128s' on RENAME TABLE statement"}, - {"The %-.64s character set is not supported."}, - {"Auto_increment is not allowed for a partitioned table"}, - {"Character set conversion error due to unknown encoding scheme %d"}, - {""}, - {"Table '%-.128s' was not found by the storage engine"}, - {"Could not resolve to %-.128s in library %-.10s type %-.10s (errno = %d)"}, - {"Error on _PGMCALL for program %-.10s in library %-.10s (error = %d)"}, - {"Error on _ILECALL for API '%.128s' (error = %d)"}, - {"Error in iconv() function during character set conversion (errno = %d)"}, - {"Error from Get Encoding Scheme (QTQGESP) API: %d, %d, %d"}, - {"Error from Get Related Default CCSID (QTQGRDC) API: %d, %d, %d"}, - {"Data out of range for column '%.192s'"}, - {"Schema name '%.128s' exceeds maximum length of %d characters"}, - {"Multiple collations not supported in a single index or constraint"}, - {"Sort sequence was not found"}, - {"One or more characters in column %.128s were substituted during conversion"}, - {"A decimal column exceeded the maximum precision. Data may be truncated."}, - {"Some data returned by DB2 for table %s could not be converted for MySQL"}, - {""}, - {"Column %.128s contains characters that cannot be converted"}, - {"An invalid name was specified for ibmdb2i_rdb_name."}, - {"A duplicate key was encountered for index '%.128s'"}, - {"A table with the same name exists but has incompatible column definitions."}, - {"The created table was discovered as an existing DB2 object."}, - {"Some attribute(s) defined for column '%.128s' may not be honored by accesses from DB2."}, -}; - -/* - The following strings are associated with errors that can be returned - by the operating system via the QMY_* APIs. Most are very uncommon and - indicate a bug somewhere. -*/ -static const char* systemErrors[MAX_MSGSTRING] = -{ - {"Thread ID is too long"}, - {"Error creating a SPACE memory object"}, - {"Error creating a FILE memory object"}, - {"Error creating a SPACE synchronization token"}, - {"Error creating a FILE synchronization token"}, - {"See message %-.7s in joblog for job %-.6s/%-.10s/%-.10s."}, - {"Error unlocking a synchronization token when closing a connection"}, - {"Invalid action specified for an 'object lock' request"}, - {"Invalid action specified for a savepoint request"}, - {"Partial keys are not supported with an ICU sort sequence"}, - {"Error retrieving an ICU sort key"}, - {"Error converting single-byte sort sequence to UCS-2"}, - {"An unsupported collation was specified"}, - {"Validation failed for referenced table of foreign key constraint"}, - {"Error extracting table for constraint information"}, - {"Error extracting referenced table for constraint information"}, - {"Invalid action specified for a 'commitment control' request"}, - {"Invalid commitment control isolation level specified on 'open' request"}, - {"Invalid file handle"}, - {" "}, - {"Invalid option specified for returning data on 'read' request"}, - {"Invalid orientation specified for 'read' request"}, - {"Invalid option type specified for 'read' request"}, - {"Invalid isolation level for starting commitment control"}, - {"Error unlocking a synchronization token in module QMYALC"}, - {"Length of space for returned format is not long enough"}, - {"SQL XA transactions are currently unsupported by this interface"}, - {"The associated QSQSRVR job was killed or ended unexpectedly."}, - {"Error unlocking a synchronization token in module QMYSEI"}, - {"Error unlocking a synchronization token in module QMYSPO"}, - {"Error converting input CCSID from short form to long form"}, - {" "}, - {"Error getting associated CCSID for CCSID conversion"}, - {"Error converting a string from one CCSID to another"}, - {"Error unlocking a synchronization token"}, - {"Error destroying a synchronization token"}, - {"Error locking a synchronization token"}, - {"Error recreating a synchronization token"}, - {"A space handle was not specified for a constraint request"}, - {"An SQL cursor was specified for a delete request"}, - {" "}, - {"Error on delete request because current UFCB for connection is not open"}, - {"An SQL cursor was specified for an object initialization request"}, - {"An SQL cursor was specified for an object override request"}, - {"A space handle was not specified for an object override request"}, - {"An SQL cursor was specified for an information request"}, - {"An SQL cursor was specified for an object lock request"}, - {"An SQL cursor was specified for an optimize request"}, - {"A data handle was not specified for a read request"}, - {"A row number handle was not specified for a read request"}, - {"A key handle was not specified for a read request"}, - {"An SQL cursor was specified for an row estimation request"}, - {"A space handle was not specified for a row estimation request"}, - {"An SQL cursor was specified for a release record request"}, - {"A statement handle was not specified for an 'execute immediate' request"}, - {"A statement handle was not specified for a 'prepare open' request"}, - {"An SQL cursor was specified for an update request"}, - {"The UFCB was not open for read"}, - {"Error on update request because current UFCB for connection is not open"}, - {"A data handle was not specified for an update request"}, - {"An SQL cursor was specified for a write request"}, - {"A data handle was not specified for a write request"}, - {"An unknown function was specified on a process request"}, - {"A share definition was not specified for an 'allocate share' request"}, - {"A share handle was not specified for an 'allocate share' request"}, - {"A use count handle was not specified for an 'allocate share' request"}, - {"A 'records per key' handle was not specified for an information request"}, - {"Error resolving LOB addresss"}, - {"Length of a LOB space is too small"}, - {"An unknown function was specified for a server request"}, - {"Object authorization failed. See message %-.7s in joblog for job %-.6s/%-.10s/%-.10s. for more information."}, - {" "}, - {"Error locking mutex on server"}, - {"Error unlocking mutex on server"}, - {"Error checking for RDB name in RDB Directory"}, - {"Error creating mutex on server"}, - {"A table with that name already exists"}, - {" "}, - {"Error unlocking mutex"}, - {"Error connecting to server job"}, - {"Error connecting to server job"}, - {" "}, - {"Function check occurred while registering parameter spaces. See joblog."}, - {" "}, - {" "}, - {"End of block"}, - {"The file has changed and might not be compatible with the MySQL table definition"}, - {"Error giving pipe to server job"}, - {"There are open object locks when attempting to deallocate"}, - {"There is no open lock"}, - {" "}, - {" "}, - {"The maximum value for the auto_increment data type was exceeded"}, - {"Error occurred closing the pipe "}, - {"Error occurred taking a descriptor for the pipe"}, - {"Error writing to pipe "}, - {"Server was interrupted "}, - {"No pipe descriptor exists for reuse "}, - {"Error occurred during an SQL prepare statement "}, - {"Error occurred during an SQL open "}, - {" "}, - {" "}, - {" "}, - {" "}, - {" "}, - {" "}, - {"An unspecified error was returned from the system."}, - {" "} -}; - -/** - This function builds the text string for an error code, and substitutes - a variable number of replacement variables into the string. -*/ -void getErrTxt(int errCode, ...) -{ - va_list args; - va_start(args,errCode); - char* buffer = db2i_ileBridge::getBridgeForThread()->getErrorStorage(); - const char* msg; - - if (errCode >= QMY_ERR_MIN && errCode <= QMY_ERR_SQ_OPEN) - msg = systemErrors[errCode - QMY_ERR_MIN]; - else - { - DBUG_ASSERT(errCode >= DB2I_FIRST_ERR && errCode <= DB2I_LAST_ERR); - msg = engineErrors[errCode - DB2I_FIRST_ERR]; - } - - (void) my_vsnprintf (buffer, MYSQL_ERRMSG_SIZE, msg, args); - va_end(args); - fprintf(stderr,"ibmdb2i error %d: %s\n",errCode,buffer); - DBUG_PRINT("error", ("ibmdb2i error %d: %s",errCode,buffer)); -} - -static inline void trimSpace(char* str) -{ - char* end = strchr(str, ' '); - if (end) *end = 0; -} - - -/** - Generate the error text specific to an API error returned by a QMY_* API. - - @parm errCode The error value - @parm errInfo The structure containing the message and job identifiers. -*/ -void reportSystemAPIError(int errCode, const Qmy_Error_output *errInfo) -{ - if (errCode >= QMY_ERR_MIN && errCode <= QMY_ERR_SQ_OPEN) - { - switch(errCode) - { - case QMY_ERR_MSGID: - case QMY_ERR_NOT_AUTH: - { - DBUG_ASSERT(errInfo); - char jMsg[8]; // Error message ID - char jName[11]; // Job name - char jUser[11]; // Job user - char jNbr[7]; // Job number - memset(jMsg, 0, sizeof(jMsg)); - memset(jName, 0, sizeof(jMsg)); - memset(jUser, 0, sizeof(jMsg)); - memset(jMsg, 0, sizeof(jMsg)); - - convFromEbcdic(errInfo->MsgId,jMsg,sizeof(jMsg)-1); - convFromEbcdic(errInfo->JobName,jName,sizeof(jName)-1); - trimSpace(jName); - convFromEbcdic(errInfo->JobUser,jUser,sizeof(jUser)-1); - trimSpace(jUser); - convFromEbcdic(errInfo->JobNbr,jNbr,sizeof(jNbr)-1); - getErrTxt(errCode,jMsg,jNbr,jUser,jName); - } - break; - case QMY_ERR_RTNFMT: - { - getErrTxt(QMY_ERR_LVLID_MISMATCH); - } - break; - default: - getErrTxt(errCode); - break; - } - } -} - - -/** - Generate a warning for the specified error. -*/ -void warning(THD *thd, int errCode, ...) -{ - va_list args; - va_start(args,errCode); - char buffer[MYSQL_ERRMSG_SIZE]; - const char* msg; - - DBUG_ASSERT(errCode >= DB2I_FIRST_ERR && errCode <= DB2I_LAST_ERR); - msg = engineErrors[errCode - DB2I_FIRST_ERR]; - - (void) my_vsnprintf (buffer, MYSQL_ERRMSG_SIZE, msg, args); - va_end(args); - DBUG_PRINT("warning", ("ibmdb2i warning %d: %s",errCode,buffer)); - push_warning(thd, MYSQL_ERROR::WARN_LEVEL_WARN, errCode, buffer); -} - - diff --git a/storage/ibmdb2i/db2i_errors.h b/storage/ibmdb2i/db2i_errors.h deleted file mode 100644 index b6dd314ef50..00000000000 --- a/storage/ibmdb2i/db2i_errors.h +++ /dev/null @@ -1,93 +0,0 @@ -/* -Licensed Materials - Property of IBM -DB2 Storage Engine Enablement -Copyright IBM Corporation 2007,2008 -All rights reserved - -Redistribution and use in source and binary forms, with or without modification, -are permitted provided that the following conditions are met: - (a) Redistributions of source code must retain this list of conditions, the - copyright notice in section {d} below, and the disclaimer following this - list of conditions. - (b) Redistributions in binary form must reproduce this list of conditions, the - copyright notice in section (d) below, and the disclaimer following this - list of conditions, in the documentation and/or other materials provided - with the distribution. - (c) The name of IBM may not be used to endorse or promote products derived from - this software without specific prior written permission. - (d) The text of the required copyright notice is: - Licensed Materials - Property of IBM - DB2 Storage Engine Enablement - Copyright IBM Corporation 2007,2008 - All rights reserved - -THIS SOFTWARE IS PROVIDED BY IBM CORPORATION "AS IS" AND ANY EXPRESS OR IMPLIED -WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF -MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT -SHALL IBM CORPORATION BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, -EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT -OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS -INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN -CONTRACT, STRICT LIABILITY, OR TORT INCLUDING NEGLIGENCE OR OTHERWISE) ARISING -IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY -OF SUCH DAMAGE. -*/ - - -#ifndef DB2I_ERRORS_H -#define DB2I_ERRORS_H - -#include "qmyse.h" -class THD; - -/** - @enum DB2I_errors - - @brief These are the errors that can be returned by the storage engine proper - and that are specific to the engine. Refer to db2i_errors.cc for text - descriptions of the errors. -*/ - -enum DB2I_errors -{ - DB2I_FIRST_ERR = 2500, - DB2I_ERR_ICONV_OPEN, - DB2I_ERR_INVALID_NAME, - DB2I_ERR_RENAME_MOVE, - DB2I_ERR_UNSUPP_CHARSET, - DB2I_ERR_PART_AUTOINC, - DB2I_ERR_UNKNOWN_ENCODING, - DB2I_ERR_RESERVED, - DB2I_ERR_TABLE_NOT_FOUND, - DB2I_ERR_RESOLVE_OBJ, - DB2I_ERR_PGMCALL, - DB2I_ERR_ILECALL, - DB2I_ERR_ICONV, - DB2I_ERR_QTQGESP, - DB2I_ERR_QTQGRDC, - DB2I_ERR_INVALID_COL_VALUE, - DB2I_ERR_TOO_LONG_SCHEMA, - DB2I_ERR_MIXED_COLLATIONS, - DB2I_ERR_SRTSEQ, - DB2I_ERR_SUB_CHARS, - DB2I_ERR_PRECISION, - DB2I_ERR_INVALID_DATA, - DB2I_ERR_RESERVED2, - DB2I_ERR_ILL_CHAR, - DB2I_ERR_BAD_RDB_NAME, - DB2I_ERR_UNKNOWN_IDX, - DB2I_ERR_DISCOVERY_MISMATCH, - DB2I_ERR_WARN_CREATE_DISCOVER, - DB2I_ERR_WARN_COL_ATTRS, - DB2I_LAST_ERR = DB2I_ERR_WARN_COL_ATTRS -}; - -void getErrTxt(int errcode, ...); -void reportSystemAPIError(int errCode, const Qmy_Error_output *errInfo); -void warning(THD *thd, int errCode, ...); - -const char* DB2I_SQL0350 = "\xE2\xD8\xD3\xF0\xF3\xF5\xF0"; // SQL0350 in EBCDIC -const char* DB2I_CPF503A = "\xC3\xD7\xC6\xF5\xF0\xF3\xC1"; // CPF503A in EBCDIC -const char* DB2I_SQL0538 = "\xE2\xD8\xD3\xF0\xF5\xF3\xF8"; // SQL0538 in EBCDIC - -#endif diff --git a/storage/ibmdb2i/db2i_file.cc b/storage/ibmdb2i/db2i_file.cc deleted file mode 100644 index a16aa927527..00000000000 --- a/storage/ibmdb2i/db2i_file.cc +++ /dev/null @@ -1,556 +0,0 @@ -/* -Licensed Materials - Property of IBM -DB2 Storage Engine Enablement -Copyright IBM Corporation 2007,2008 -All rights reserved - -Redistribution and use in source and binary forms, with or without modification, -are permitted provided that the following conditions are met: - (a) Redistributions of source code must retain this list of conditions, the - copyright notice in section {d} below, and the disclaimer following this - list of conditions. - (b) Redistributions in binary form must reproduce this list of conditions, the - copyright notice in section (d) below, and the disclaimer following this - list of conditions, in the documentation and/or other materials provided - with the distribution. - (c) The name of IBM may not be used to endorse or promote products derived from - this software without specific prior written permission. - (d) The text of the required copyright notice is: - Licensed Materials - Property of IBM - DB2 Storage Engine Enablement - Copyright IBM Corporation 2007,2008 - All rights reserved - -THIS SOFTWARE IS PROVIDED BY IBM CORPORATION "AS IS" AND ANY EXPRESS OR IMPLIED -WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF -MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT -SHALL IBM CORPORATION BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, -EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT -OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS -INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN -CONTRACT, STRICT LIABILITY, OR TORT INCLUDING NEGLIGENCE OR OTHERWISE) ARISING -IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY -OF SUCH DAMAGE. -*/ - - - -#include "db2i_file.h" -#include "db2i_charsetSupport.h" -#include "db2i_collationSupport.h" -#include "db2i_misc.h" -#include "db2i_errors.h" -#include "my_dir.h" - -db2i_table::db2i_table(const TABLE_SHARE* myTable, const char* path) : - mysqlTable(myTable), - db2StartId(0), - blobFieldCount(0), - blobFields(NULL), - blobFieldActualSizes(NULL), - logicalFiles(NULL), - physicalFile(NULL), - db2TableNameSQLAscii(NULL), - db2LibNameSQLAscii(NULL) -{ - char asciiLibName[MAX_DB2_SCHEMANAME_LENGTH + 1]; - getDB2LibNameFromPath(path, asciiLibName, ASCII_NATIVE); - - char asciiFileName[MAX_DB2_FILENAME_LENGTH + 1]; - getDB2FileNameFromPath(path, asciiFileName, ASCII_NATIVE); - - size_t libNameLen = strlen(asciiLibName); - size_t fileNameLen = strlen(asciiFileName); - - db2LibNameEbcdic=(char *) - my_multi_malloc(MYF(MY_WME | MY_ZEROFILL), - &db2LibNameEbcdic, libNameLen+1, - &db2LibNameAscii, libNameLen+1, - &db2LibNameSQLAscii, libNameLen*2 + 1, - &db2TableNameEbcdic, fileNameLen+1, - &db2TableNameAscii, fileNameLen+1, - &db2TableNameSQLAscii, fileNameLen*2 + 1, - NullS); - - if (likely(db2LibNameEbcdic)) - { - memcpy(db2LibNameAscii, asciiLibName, libNameLen); - convertNativeToSQLName(db2LibNameAscii, db2LibNameSQLAscii); - convToEbcdic(db2LibNameAscii, db2LibNameEbcdic, libNameLen); - memcpy(db2TableNameAscii, asciiFileName, fileNameLen); - convertNativeToSQLName(db2TableNameAscii, db2TableNameSQLAscii); - convToEbcdic(db2TableNameAscii, db2TableNameEbcdic, fileNameLen); - } - - conversionDefinitions[toMySQL] = NULL; - conversionDefinitions[toDB2] = NULL; - - isTemporaryTable = (strstr(mysqlTable->path.str, mysql_tmpdir) == mysqlTable->path.str); -} - - -int32 db2i_table::initDB2Objects(const char* path) -{ - uint fileObjects = 1 + mysqlTable->keys; - ValidatedPointer fileDefnSpace(sizeof(ShrDef) * fileObjects); - - physicalFile = new db2i_file(this); - physicalFile->fillILEDefn(&fileDefnSpace[0], true); - - logicalFileCount = mysqlTable->keys; - if (logicalFileCount > 0) - { - logicalFiles = new db2i_file*[logicalFileCount]; - for (int k = 0; k < logicalFileCount; k++) - { - logicalFiles[k] = new db2i_file(this, k); - logicalFiles[k]->fillILEDefn(&fileDefnSpace[k+1], false); - } - } - - ValidatedPointer fileDefnHandles(sizeof(FILE_HANDLE) * fileObjects); - size_t formatSpaceLen = sizeof(format_hdr_t) + mysqlTable->fields * sizeof(DB2Field); - formatSpace.alloc(formatSpaceLen); - - int rc = db2i_ileBridge::getBridgeForThread()-> - expectErrors(QMY_ERR_RTNFMT)-> - allocateFileDefn(fileDefnSpace, - fileDefnHandles, - fileObjects, - db2LibNameEbcdic, - strlen(db2LibNameEbcdic), - formatSpace, - formatSpaceLen); - - if (rc) - { - // We have to handle a format space error as a special case of a FID - // mismatch. We should only get the space error if columns have been added - // to the DB2 table without MySQL's knowledge, which is effectively a - // FID problem. - if (rc == QMY_ERR_RTNFMT) - { - rc = QMY_ERR_LVLID_MISMATCH; - getErrTxt(rc); - } - return rc; - } - - convFromEbcdic(((format_hdr_t*)formatSpace)->FilLvlId, fileLevelID, sizeof(fileLevelID)); - - if (!doFileIDsMatch(path)) - { - getErrTxt(QMY_ERR_LVLID_MISMATCH); - return QMY_ERR_LVLID_MISMATCH; - } - - physicalFile->setMasterDefnHandle(fileDefnHandles[0]); - for (int k = 0; k < mysqlTable->keys; k++) - { - logicalFiles[k]->setMasterDefnHandle(fileDefnHandles[k+1]); - } - - db2StartId = (uint64)(((format_hdr_t*)formatSpace)->StartIdVal); - db2Fields = (DB2Field*)((char*)(void*)formatSpace + ((format_hdr_t*)formatSpace)->ColDefOff); - - uint fields = mysqlTable->fields; - for (int i = 0; i < fields; ++i) - { - if (db2Field(i).isBlob()) - { - blobFieldCount++; - } - } - - if (blobFieldCount) - { - blobFieldActualSizes = (uint*)my_multi_malloc(MYF(MY_WME | MY_ZEROFILL), - &blobFieldActualSizes, blobFieldCount * sizeof(uint), - &blobFields, blobFieldCount * sizeof(uint16), - NullS); - - int b = 0; - for (int i = 0; i < fields; ++i) - { - if (db2Field(i).isBlob()) - { - blobFields[b++] = i; - } - } - } - - my_multi_malloc(MYF(MY_WME), - &conversionDefinitions[toMySQL], fields * sizeof(iconv_t), - &conversionDefinitions[toDB2], fields * sizeof(iconv_t), - NullS); - for (int i = 0; i < fields; ++i) - { - conversionDefinitions[toMySQL][i] = (iconv_t)(-1); - conversionDefinitions[toDB2][i] = (iconv_t)(-1); - } - - return 0; -} - -int db2i_table::fastInitForCreate(const char* path) -{ - ValidatedPointer fileDefnSpace(sizeof(ShrDef)); - - physicalFile = new db2i_file(this); - physicalFile->fillILEDefn(fileDefnSpace, true); - - ValidatedPointer fileDefnHandles(sizeof(FILE_HANDLE)); - - size_t formatSpaceLen = sizeof(format_hdr_t) + - mysqlTable->fields * sizeof(DB2Field); - formatSpace.alloc(formatSpaceLen); - - int rc = db2i_ileBridge::getBridgeForThread()->allocateFileDefn(fileDefnSpace, - fileDefnHandles, - 1, - db2LibNameEbcdic, - strlen(db2LibNameEbcdic), - formatSpace, - formatSpaceLen); - - if (rc) - return rc; - - convFromEbcdic(((format_hdr_t*)formatSpace)->FilLvlId, fileLevelID, sizeof(fileLevelID)); - doFileIDsMatch(path); - - return 0; -} - -bool db2i_table::doFileIDsMatch(const char* path) -{ - char name_buff[FN_REFLEN]; - - fn_format(name_buff, path, "", FID_EXT, (MY_REPLACE_EXT | MY_UNPACK_FILENAME)); - - File fd = my_open(name_buff, O_RDONLY, MYF(0)); - - if (fd == -1) - { - if (errno == ENOENT) - { - fd = my_create(name_buff, 0, O_WRONLY, MYF(MY_WME)); - - if (fd == -1) - { - // TODO: Report errno here - return false; - } - my_write(fd, (uchar*)fileLevelID, sizeof(fileLevelID), MYF(MY_WME)); - my_close(fd, MYF(0)); - return true; - } - else - { - // TODO: Report errno here - return false; - } - } - - char diskFID[sizeof(fileLevelID)]; - - bool match = false; - - if (my_read(fd, (uchar*)diskFID, sizeof(diskFID), MYF(MY_WME)) == sizeof(diskFID) && - (memcmp(diskFID, fileLevelID, sizeof(diskFID)) == 0)) - match = true; - - my_close(fd, MYF(0)); - - return match; -} - -void db2i_table::deleteAssocFiles(const char* name) -{ - char name_buff[FN_REFLEN]; - fn_format(name_buff, name, "", FID_EXT, (MY_REPLACE_EXT | MY_UNPACK_FILENAME)); - my_delete(name_buff, MYF(0)); -} - -void db2i_table::renameAssocFiles(const char* from, const char* to) -{ - rename_file_ext(from, to, FID_EXT); -} - - -db2i_table::~db2i_table() -{ - if (blobFieldActualSizes) - my_free(blobFieldActualSizes, MYF(0)); - - if (conversionDefinitions[toMySQL]) - my_free(conversionDefinitions[toMySQL], MYF(0)); - - if (logicalFiles) - { - for (int k = 0; k < logicalFileCount; ++k) - { - delete logicalFiles[k]; - } - - delete[] logicalFiles; - } - delete physicalFile; - - my_free(db2LibNameEbcdic, 0); -} - -void db2i_table::getDB2QualifiedName(char* to) -{ - strcat(to, getDB2LibName(ASCII_SQL)); - strcat(to, "."); - strcat(to, getDB2TableName(ASCII_SQL)); -} - - -void db2i_table::getDB2QualifiedNameFromPath(const char* path, char* to) -{ - getDB2LibNameFromPath(path, to); - strcat(to, "."); - getDB2FileNameFromPath(path, strend(to)); -} - - -size_t db2i_table::smartFilenameToTableName(const char *in, char* out, size_t outlen) -{ - if (strchr(in, '@') == NULL) - { - return filename_to_tablename(in, out, outlen); - } - - char* test = (char*) my_malloc(outlen, MYF(MY_WME)); - - filename_to_tablename(in, test, outlen); - - char* cur = test; - - while (*cur) - { - if ((*cur <= 0x20) || (*cur >= 0x80)) - { - strncpy(out, in, outlen); - my_free(test, MYF(0)); - return min(outlen, strlen(out)); - } - ++cur; - } - - strncpy(out, test, outlen); - my_free(test, MYF(0)); - return min(outlen, strlen(out)); -} - -void db2i_table::filenameToTablename(const char* in, char* out, size_t outlen) -{ - if (strchr(in, '#') == NULL) - { - smartFilenameToTableName(in, out, outlen); - return; - } - - char* temp = (char*)sql_alloc(outlen); - - const char* part1, *part2, *part3, *part4; - part1 = in; - part2 = strstr(part1, "#P#"); - if (part2); - { - part3 = part2 + 3; - part4 = strchr(part3, '#'); - if (!part4) - part4 = strend(in); - } - - memcpy(temp, part1, min(outlen, part2 - part1)); - temp[min(outlen-1, part2-part1)] = 0; - - int32 accumLen = smartFilenameToTableName(temp, out, outlen); - - if (part2 && (accumLen + 4 < outlen)) - { - strcat(out, "#P#"); - accumLen += 4; - - memset(temp, 0, min(outlen, part2-part1)); - memcpy(temp, part3, min(outlen, part4-part3)); - temp[min(outlen-1, part4-part3)] = 0; - - accumLen += smartFilenameToTableName(temp, strend(out), outlen-accumLen); - - if (part4 && (accumLen + (strend(in) - part4 + 1) < outlen)) - { - strcat(out, part4); - } - } -} - -void db2i_table::getDB2LibNameFromPath(const char* path, char* lib, NameFormatFlags format) -{ - if (strstr(path, mysql_tmpdir) == path) - { - strcpy(lib, DB2I_TEMP_TABLE_SCHEMA); - } - else - { - const char* c = strend(path) - 1; - while (c > path && *c != '\\' && *c != '/') - --c; - - if (c != path) - { - const char* dbEnd = c; - do { - --c; - } while (c >= path && *c != '\\' && *c != '/'); - - if (c >= path) - { - const char* dbStart = c+1; - char fileName[FN_REFLEN]; - memcpy(fileName, dbStart, dbEnd - dbStart); - fileName[dbEnd-dbStart] = 0; - - char dbName[MAX_DB2_SCHEMANAME_LENGTH+1]; - filenameToTablename(fileName, dbName , sizeof(dbName)); - - convertMySQLNameToDB2Name(dbName, lib, sizeof(dbName), true, (format==ASCII_SQL) ); - } - else - DBUG_ASSERT(0); // This should never happen! - } - } -} - -void db2i_table::getDB2FileNameFromPath(const char* path, char* file, NameFormatFlags format) -{ - const char* fileEnd = strend(path); - const char* c = fileEnd; - while (c > path && *c != '\\' && *c != '/') - --c; - - if (c != path) - { - const char* fileStart = c+1; - char fileName[FN_REFLEN]; - memcpy(fileName, fileStart, fileEnd - fileStart); - fileName[fileEnd - fileStart] = 0; - char db2Name[MAX_DB2_FILENAME_LENGTH+1]; - filenameToTablename(fileName, db2Name, sizeof(db2Name)); - convertMySQLNameToDB2Name(db2Name, file, sizeof(db2Name), true, (format==ASCII_SQL) ); - } -} - -// Generates the DB2 index name when given the MySQL index and table names. -int32 db2i_table::appendQualifiedIndexFileName(const char* indexName, - const char* tableName, - String& to, - NameFormatFlags format, - enum_DB2I_INDEX_TYPE type) -{ - char generatedName[MAX_DB2_FILENAME_LENGTH+1]; - strncpy(generatedName, indexName, DB2I_INDEX_NAME_LENGTH_TO_PRESERVE); - generatedName[DB2I_INDEX_NAME_LENGTH_TO_PRESERVE] = 0; - char* endOfGeneratedName; - - if (type == typeDefault) - { - strcat(generatedName, DB2I_DEFAULT_INDEX_NAME_DELIMITER); - endOfGeneratedName = strend(generatedName); - } - else if (type != typeNone) - { - strcat(generatedName, DB2I_ADDL_INDEX_NAME_DELIMITER); - endOfGeneratedName = strend(generatedName); - *(endOfGeneratedName-2) = char(type); - } - - uint lenWithoutFile = endOfGeneratedName - generatedName; - - char strippedTableName[MAX_DB2_FILENAME_LENGTH+1]; - if (format == ASCII_SQL) - { - strcpy(strippedTableName, tableName); - stripExtraQuotes(strippedTableName+1, sizeof(strippedTableName)); - tableName = strippedTableName; - } - - if (strlen(tableName) > (MAX_DB2_FILENAME_LENGTH-lenWithoutFile)) - return -1; - - strncat(generatedName, - tableName+1, - min(strlen(tableName), (MAX_DB2_FILENAME_LENGTH-lenWithoutFile))-2 ); - - char finalName[MAX_DB2_FILENAME_LENGTH+1]; - convertMySQLNameToDB2Name(generatedName, finalName, sizeof(finalName), true, (format==ASCII_SQL)); - to.append(finalName); - - return 0; -} - - -void db2i_table::findConversionDefinition(enum_conversionDirection direction, uint16 fieldID) -{ - getConversion(direction, - mysqlTable->field[fieldID]->charset(), - db2Field(fieldID).getCCSID(), - conversionDefinitions[direction][fieldID]); -} - - -db2i_file::db2i_file(db2i_table* table) : db2Table(table) -{ - commonCtorInit(); - - DBUG_ASSERT(table->getMySQLTable()->table_name.length <= MAX_DB2_FILENAME_LENGTH-2); - - db2FileName = (char*)table->getDB2TableName(db2i_table::EBCDIC_NATIVE); -} - -db2i_file::db2i_file(db2i_table* table, int index) : db2Table(table) -{ - commonCtorInit(); - - if ((index == table->getMySQLTable()->primary_key) && !table->isTemporary()) - { - db2FileName = (char*)table->getDB2TableName(db2i_table::EBCDIC_NATIVE); - } - else - { - // Generate the index name (in index___table form); quote and EBCDICize it. - String qualifiedPath; - qualifiedPath.length(0); - - const char* asciiFileName = table->getDB2TableName(db2i_table::ASCII_NATIVE); - - db2i_table::appendQualifiedIndexFileName(table->getMySQLTable()->key_info[index].name, - asciiFileName, - qualifiedPath, - db2i_table::ASCII_NATIVE, - typeDefault); - - db2FileName = (char*)my_malloc(qualifiedPath.length()+1, MYF(MY_WME | MY_ZEROFILL)); - convToEbcdic(qualifiedPath.ptr(), db2FileName, qualifiedPath.length()); - } -} - -void db2i_file::commonCtorInit() -{ - masterDefn = 0; - memset(&formats, 0, maxRowFormats*sizeof(RowFormat)); -} - - -void db2i_file::fillILEDefn(ShrDef* defn, bool readInArrivalSeq) -{ - defn->ObjNamLen = strlen(db2FileName); - DBUG_ASSERT(defn->ObjNamLen <= sizeof(defn->ObjNam)); - memcpy(defn->ObjNam, db2FileName, defn->ObjNamLen); - defn->ArrSeq[0] = (readInArrivalSeq ? QMY_YES : QMY_NO); -} - diff --git a/storage/ibmdb2i/db2i_file.h b/storage/ibmdb2i/db2i_file.h deleted file mode 100644 index 7b63b18c315..00000000000 --- a/storage/ibmdb2i/db2i_file.h +++ /dev/null @@ -1,445 +0,0 @@ -/* -Licensed Materials - Property of IBM -DB2 Storage Engine Enablement -Copyright IBM Corporation 2007,2008 -All rights reserved - -Redistribution and use in source and binary forms, with or without modification, -are permitted provided that the following conditions are met: - (a) Redistributions of source code must retain this list of conditions, the - copyright notice in section {d} below, and the disclaimer following this - list of conditions. - (b) Redistributions in binary form must reproduce this list of conditions, the - copyright notice in section (d) below, and the disclaimer following this - list of conditions, in the documentation and/or other materials provided - with the distribution. - (c) The name of IBM may not be used to endorse or promote products derived from - this software without specific prior written permission. - (d) The text of the required copyright notice is: - Licensed Materials - Property of IBM - DB2 Storage Engine Enablement - Copyright IBM Corporation 2007,2008 - All rights reserved - -THIS SOFTWARE IS PROVIDED BY IBM CORPORATION "AS IS" AND ANY EXPRESS OR IMPLIED -WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF -MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT -SHALL IBM CORPORATION BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, -EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT -OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS -INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN -CONTRACT, STRICT LIABILITY, OR TORT INCLUDING NEGLIGENCE OR OTHERWISE) ARISING -IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY -OF SUCH DAMAGE. -*/ - - -#ifndef DB2I_FILE_H -#define DB2I_FILE_H - -#include "db2i_global.h" -#include "db2i_ileBridge.h" -#include "db2i_validatedPointer.h" -#include "db2i_iconv.h" -#include "db2i_charsetSupport.h" - -const char FID_EXT[] = ".FID"; - -class db2i_file; - -#pragma pack(1) -struct DB2LobField -{ - char reserved1; - uint32 length; - char reserved2[4]; - uint32 ordinal; - ILEMemHandle dataHandle; - char reserved3[8]; -}; -#pragma pack(pop) - -class DB2Field -{ - public: - uint16 getType() const { return *(uint16*)(&definition.ColType); } - uint16 getByteLengthInRecord() const { return definition.ColLen; } - uint16 getDataLengthInRecord() const - { - return (getType() == QMY_VARCHAR || getType() == QMY_VARGRAPHIC ? definition.ColLen - 2 : definition.ColLen); - } - uint16 getCCSID() const { return *(uint16*)(&definition.ColCCSID); } - bool isBlob() const - { - uint16 type = getType(); - return (type == QMY_BLOBCLOB || type == QMY_DBCLOB); - } - uint16 getBufferOffset() const { return definition.ColBufOff; } - uint16 calcBlobPad() const - { - DBUG_ASSERT(isBlob()); - return getByteLengthInRecord() - sizeof (DB2LobField); - } - DB2LobField* asBlobField(char* buf) const - { - DBUG_ASSERT(isBlob()); - return (DB2LobField*)(buf + getBufferOffset() + calcBlobPad()); - } - private: - col_def_t definition; -}; - - -/** - @class db2i_table - - @details - This class describes the logical SQL table provided by DB2. - It stores "table-scoped" information such as the name of the - DB2 schema, BLOB descriptions, and the corresponding MySQL table definition. - Only one instance exists per SQL table. -*/ -class db2i_table -{ - public: - enum NameFormatFlags - { - ASCII_SQL, - ASCII_NATIVE, - EBCDIC_NATIVE - }; - - db2i_table(const TABLE_SHARE* myTable, const char* path = NULL); - - ~db2i_table(); - - int32 initDB2Objects(const char* path); - - const TABLE_SHARE* getMySQLTable() const - { - return mysqlTable; - } - - uint64 getStartId() const - { - return db2StartId; - } - - void updateStartId(uint64 newStartId) - { - db2StartId = newStartId; - } - - bool hasBlobs() const - { - return (blobFieldCount > 0); - } - - uint16 getBlobCount() const - { - return blobFieldCount; - } - - uint getBlobFieldActualSize(uint fieldIndex) const - { - return blobFieldActualSizes[getBlobIdFromField(fieldIndex)]; - } - - void updateBlobFieldActualSize(uint fieldIndex, uint32 newSize) - { - // It's OK that this isn't threadsafe, since this is just an advisory - // value. If a race condition causes the lesser of two values to be stored, - // that's OK. - uint16 blobID = getBlobIdFromField(fieldIndex); - DBUG_ASSERT(blobID < blobFieldCount); - - if (blobFieldActualSizes[blobID] < newSize) - { - blobFieldActualSizes[blobID] = newSize; - } - } - - - - const char* getDB2LibName(NameFormatFlags format = EBCDIC_NATIVE) - { - switch (format) - { - case EBCDIC_NATIVE: - return db2LibNameEbcdic; break; - case ASCII_NATIVE: - return db2LibNameAscii; break; - case ASCII_SQL: - return db2LibNameSQLAscii; break; - default: - DBUG_ASSERT(0); - } - return NULL; - } - - const char* getDB2TableName(NameFormatFlags format = EBCDIC_NATIVE) const - { - switch (format) - { - case EBCDIC_NATIVE: - return db2TableNameEbcdic; break; - case ASCII_NATIVE: - return db2TableNameAscii; break; - case ASCII_SQL: - return db2TableNameAscii; break; - break; - default: - DBUG_ASSERT(0); - } - return NULL; - } - - DB2Field& db2Field(int fieldID) const { return db2Fields[fieldID]; } - DB2Field& db2Field(const Field* field) const { return db2Field(field->field_index); } - - void processFormatSpace(); - - void* getFormatSpace(size_t& spaceNeeded) - { - DBUG_ASSERT(formatSpace == NULL); - spaceNeeded = sizeof(format_hdr_t) + mysqlTable->fields * sizeof(DB2Field); - formatSpace.alloc(spaceNeeded); - return (void*)formatSpace; - } - - bool isTemporary() const - { - return isTemporaryTable; - } - - void getDB2QualifiedName(char* to); - static void getDB2LibNameFromPath(const char* path, char* lib, NameFormatFlags format=ASCII_SQL); - static void getDB2FileNameFromPath(const char* path, char* file, NameFormatFlags format=ASCII_SQL); - static void getDB2QualifiedNameFromPath(const char* path, char* to); - static int32 appendQualifiedIndexFileName(const char* indexName, - const char* tableName, - String& to, - NameFormatFlags format=ASCII_SQL, - enum_DB2I_INDEX_TYPE type=typeDefault); - - uint16 getBlobIdFromField(uint16 fieldID) const - { - for (int i = 0; i < blobFieldCount; ++i) - { - if (blobFields[i] == fieldID) - return i; - } - DBUG_ASSERT(0); - return 0; - } - - iconv_t& getConversionDefinition(enum_conversionDirection direction, - uint16 fieldID) - { - if (conversionDefinitions[direction][fieldID] == (iconv_t)(-1)) - findConversionDefinition(direction, fieldID); - - return conversionDefinitions[direction][fieldID]; - } - - const db2i_file* dataFile() const - { - return physicalFile; - } - - const db2i_file* indexFile(uint idx) const - { - return logicalFiles[idx]; - } - - const char* getFileLevelID() const - { - return fileLevelID; - } - - static void deleteAssocFiles(const char* name); - static void renameAssocFiles(const char* from, const char* to); - - int fastInitForCreate(const char* path); - int initDiscoveredTable(const char* path); - - uint16* blobFields; - -private: - - void findConversionDefinition(enum_conversionDirection direction, uint16 fieldID); - static void filenameToTablename(const char* in, char* out, size_t outlen); - static size_t smartFilenameToTableName(const char *in, char* out, size_t outlen); - void convertNativeToSQLName(const char* input, - char* output) - { - - output[0] = input[0]; - - uint o = 1; - uint i = 1; - do - { - output[o++] = input[i]; - if (input[i] == '"' && input[i+1]) - output[o++] = '"'; - } while (input[++i]); - - output[o] = 0; // This isn't the most user-friendly way to handle overflows, - // but at least its safe. - } - - bool doFileIDsMatch(const char* path); - - ValidatedPointer formatSpace; - DB2Field* db2Fields; - uint64 db2StartId; // Starting value for identity column - uint16 blobFieldCount; // Count of LOB fields in the DB2 table - uint* blobFieldActualSizes; // Array of LOB field lengths (actual vs. allocated). - // This is updated as LOBs are read and will contain - // the length of the longest known LOB in that field. - iconv_t* conversionDefinitions[2]; - - const TABLE_SHARE* mysqlTable; - uint16 logicalFileCount; - char* db2LibNameEbcdic; // Quoted and in EBCDIC - char* db2LibNameAscii; - char* db2TableNameEbcdic; - char* db2TableNameAscii; - char* db2TableNameSQLAscii; - char* db2LibNameSQLAscii; - - db2i_file* physicalFile; - db2i_file** logicalFiles; - - bool isTemporaryTable; - char fileLevelID[13]; -}; - -/** - @class db2i_file - - @details This class describes a file object underlaying a particular SQL - table. Both "physical files" (data) and "logical files" (indices) are - described by this class. Only one instance of the class exists per DB2 file - object. The single instance is responsible for de/allocating the multiple - handles used by the handlers. -*/ -class db2i_file -{ - -public: - struct RowFormat - { - uint16 readRowLen; - uint16 readRowNullOffset; - uint16 writeRowLen; - uint16 writeRowNullOffset; - char inited; - }; - -public: - - // Construct an instance for a physical file. - db2i_file(db2i_table* table); - - // Construct an instance for a logical file. - db2i_file(db2i_table* table, int index); - - ~db2i_file() - { - if (masterDefn) - db2i_ileBridge::getBridgeForThread()->deallocateFile(masterDefn); - - if (db2FileName != (char*)db2Table->getDB2TableName(db2i_table::EBCDIC_NATIVE)) - my_free(db2FileName, MYF(0)); - } - - // This is roughly equivalent to an "open". It tells ILE to allocate a descriptor - // for the file. The associated handle is returned to the caller. - int allocateNewInstance(FILE_HANDLE* newHandle, ILEMemHandle inuseSpace) const - { - int rc; - - rc = db2i_ileBridge::getBridgeForThread()->allocateFileInstance(masterDefn, - inuseSpace, - newHandle); - - if (rc) *newHandle = 0; - - return rc; - } - - // This obtains the row layout associated with a particular access intent for - // an open instance of the file. - int obtainRowFormat(FILE_HANDLE instanceHandle, - char intent, - char commitLevel, - const RowFormat** activeFormat) const - { - DBUG_ENTER("db2i_file::obtainRowFormat"); - RowFormat* rowFormat; - - if (intent == QMY_UPDATABLE) - rowFormat = &(formats[readWrite]); - else if (intent == QMY_READ_ONLY) - rowFormat = &(formats[readOnly]); - - if (unlikely(!rowFormat->inited)) - { - int rc = db2i_ileBridge::getBridgeForThread()-> - initFileForIO(instanceHandle, - intent, - commitLevel, - &(rowFormat->writeRowLen), - &(rowFormat->writeRowNullOffset), - &(rowFormat->readRowLen), - &(rowFormat->readRowNullOffset)); - if (rc) DBUG_RETURN(rc); - rowFormat->inited = 1; - } - - *activeFormat = rowFormat; - DBUG_RETURN(0); - } - - const char* getDB2FileName() const - { - return db2FileName; - } - - void fillILEDefn(ShrDef* defn, bool readInArrivalSeq); - - void setMasterDefnHandle(FILE_HANDLE handle) - { - masterDefn = handle; - } - - FILE_HANDLE getMasterDefnHandle() const - { - return masterDefn; - } - -private: - enum RowFormats - { - readOnly = 0, - readWrite, - maxRowFormats - }; - - mutable RowFormat formats[maxRowFormats]; - - void commonCtorInit(); - - char* db2FileName; // Quoted and in EBCDIC - - db2i_table* db2Table; // The logical SQL table contained by this file. - - bool db2CanSort; - - FILE_HANDLE masterDefn; -}; - - -#endif diff --git a/storage/ibmdb2i/db2i_global.h b/storage/ibmdb2i/db2i_global.h deleted file mode 100644 index d201fbd8124..00000000000 --- a/storage/ibmdb2i/db2i_global.h +++ /dev/null @@ -1,138 +0,0 @@ -/* -Licensed Materials - Property of IBM -DB2 Storage Engine Enablement -Copyright IBM Corporation 2007,2008 -All rights reserved - -Redistribution and use in source and binary forms, with or without modification, -are permitted provided that the following conditions are met: - (a) Redistributions of source code must retain this list of conditions, the - copyright notice in section {d} below, and the disclaimer following this - list of conditions. - (b) Redistributions in binary form must reproduce this list of conditions, the - copyright notice in section (d) below, and the disclaimer following this - list of conditions, in the documentation and/or other materials provided - with the distribution. - (c) The name of IBM may not be used to endorse or promote products derived from - this software without specific prior written permission. - (d) The text of the required copyright notice is: - Licensed Materials - Property of IBM - DB2 Storage Engine Enablement - Copyright IBM Corporation 2007,2008 - All rights reserved - -THIS SOFTWARE IS PROVIDED BY IBM CORPORATION "AS IS" AND ANY EXPRESS OR IMPLIED -WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF -MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT -SHALL IBM CORPORATION BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, -EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT -OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS -INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN -CONTRACT, STRICT LIABILITY, OR TORT INCLUDING NEGLIGENCE OR OTHERWISE) ARISING -IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY -OF SUCH DAMAGE. -*/ - - -#ifndef DB2I_GLOBAL_H -#define DB2I_GLOBAL_H - -#define MYSQL_SERVER 1 - -#include "my_global.h" -#include "my_sys.h" - -const uint MAX_DB2_KEY_PARTS=120; -const int MAX_DB2_V5R4_LIBNAME_LENGTH = 10; -const int MAX_DB2_V6R1_LIBNAME_LENGTH = 30; -const int MAX_DB2_SCHEMANAME_LENGTH=258; -const int MAX_DB2_FILENAME_LENGTH=258; -const int MAX_DB2_COLNAME_LENGTH=128; -const int MAX_DB2_SAVEPOINTNAME_LENGTH=128; -const int MAX_DB2_QUALIFIEDNAME_LENGTH=MAX_DB2_V6R1_LIBNAME_LENGTH + 1 + MAX_DB2_FILENAME_LENGTH; -const uint32 MAX_CHAR_LENGTH = 32765; -const uint32 MAX_VARCHAR_LENGTH = 32739; -const uint32 MAX_DEC_PRECISION = 63; -const uint32 MAX_BLOB_LENGTH = 2147483646; -const uint32 MAX_BINARY_LENGTH = MAX_CHAR_LENGTH; -const uint32 MAX_VARBINARY_LENGTH = MAX_VARCHAR_LENGTH; -const uint32 MAX_FULL_ALLOCATE_BLOB_LENGTH = 65536; -const uint32 MAX_FOREIGN_LEN = 64000; -const char* DB2I_TEMP_TABLE_SCHEMA = "QTEMP"; -const char DB2I_ADDL_INDEX_NAME_DELIMITER[5] = {'_','_','_','_','_'}; -const char DB2I_DEFAULT_INDEX_NAME_DELIMITER[3] = {'_','_','_'}; -const int DB2I_INDEX_NAME_LENGTH_TO_PRESERVE = 110; - -enum enum_DB2I_INDEX_TYPE -{ - typeNone = 0, - typeDefault = 'D', - typeHex = 'H', - typeAscii = 'A' -}; - -void* roundToQuadWordBdy(void* ptr) -{ - return (void*)(((uint64)(ptr)+0xf) & ~0xf); -} - -typedef uint64_t ILEMemHandle; - -struct OSVersion -{ - uint8 v; - uint8 r; -}; -extern OSVersion osVersion; - - -/** - Allocate 16-byte aligned space using the MySQL heap allocator - - @details Many of the spaces used by the QMY_* APIS are required to be - aligned on 16 byte boundaries. The standard system malloc will do this - alignment by default. However, in order to use the heap debug and tracking - features of the mysql allocator, we chose to implement an aligning wrapper - around my_malloc. Essentially, we overallocate the storage space, find the - first aligned address in the space, store a pointer to the true malloc - allocation in the bytes immediately preceding the aligned address, and return - the aligned address to the caller. - - @parm size The size of heap storage needed - - @return A 16-byte aligned pointer to the storage requested. -*/ -void* malloc_aligned(size_t size) -{ - char* p; - char* base; - base = (char*)my_malloc(size + sizeof(void*) + 15, MYF(MY_WME)); - if (likely(base)) - { - p = (char*)roundToQuadWordBdy(base + sizeof(void*)); - char** p2 = (char**)(p - sizeof(void*)); - *p2 = base; - } - else - p = NULL; - - return p; -} - -/** - Free a 16-byte aligned space alloced by malloc_aligned - - @details We know that a pointer to the true malloced storage immediately - precedes the aligned address, so we pull that out and call my_free(). - - @parm p A 16-byte aligned pointer generated by malloc_aligned -*/ -void free_aligned(void* p) -{ - if (likely(p)) - { - my_free(*(char**)((char*)p-sizeof(void*)), MYF(0)); - } -} - -#endif diff --git a/storage/ibmdb2i/db2i_iconv.h b/storage/ibmdb2i/db2i_iconv.h deleted file mode 100644 index 9fc6e4ed636..00000000000 --- a/storage/ibmdb2i/db2i_iconv.h +++ /dev/null @@ -1,51 +0,0 @@ -/* -Licensed Materials - Property of IBM -DB2 Storage Engine Enablement -Copyright IBM Corporation 2007,2008 -All rights reserved - -Redistribution and use in source and binary forms, with or without modification, -are permitted provided that the following conditions are met: - (a) Redistributions of source code must retain this list of conditions, the - copyright notice in section {d} below, and the disclaimer following this - list of conditions. - (b) Redistributions in binary form must reproduce this list of conditions, the - copyright notice in section (d) below, and the disclaimer following this - list of conditions, in the documentation and/or other materials provided - with the distribution. - (c) The name of IBM may not be used to endorse or promote products derived from - this software without specific prior written permission. - (d) The text of the required copyright notice is: - Licensed Materials - Property of IBM - DB2 Storage Engine Enablement - Copyright IBM Corporation 2007,2008 - All rights reserved - -THIS SOFTWARE IS PROVIDED BY IBM CORPORATION "AS IS" AND ANY EXPRESS OR IMPLIED -WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF -MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT -SHALL IBM CORPORATION BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, -EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT -OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS -INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN -CONTRACT, STRICT LIABILITY, OR TORT INCLUDING NEGLIGENCE OR OTHERWISE) ARISING -IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY -OF SUCH DAMAGE. -*/ - -/** - @file - - @brief Used to redefine iconv symbols to the optimized "myconv" ones -*/ - -#ifndef DB2I_ICONV_H -#define DB2I_ICONV_H - -#include "db2i_myconv.h" -#define iconv_open(A, B) myconv_open(A, B, CONVERTER_DMAP) -#define iconv_close myconv_close -#define iconv myconv_dmap -#define iconv_t myconv_t - -#endif diff --git a/storage/ibmdb2i/db2i_ileBridge.cc b/storage/ibmdb2i/db2i_ileBridge.cc deleted file mode 100644 index 68ae2c2bb72..00000000000 --- a/storage/ibmdb2i/db2i_ileBridge.cc +++ /dev/null @@ -1,1342 +0,0 @@ -/* -Licensed Materials - Property of IBM -DB2 Storage Engine Enablement -Copyright IBM Corporation 2007,2008 -All rights reserved - -Redistribution and use in source and binary forms, with or without modification, -are permitted provided that the following conditions are met: - (a) Redistributions of source code must retain this list of conditions, the - copyright notice in section {d} below, and the disclaimer following this - list of conditions. - (b) Redistributions in binary form must reproduce this list of conditions, the - copyright notice in section (d) below, and the disclaimer following this - list of conditions, in the documentation and/or other materials provided - with the distribution. - (c) The name of IBM may not be used to endorse or promote products derived from - this software without specific prior written permission. - (d) The text of the required copyright notice is: - Licensed Materials - Property of IBM - DB2 Storage Engine Enablement - Copyright IBM Corporation 2007,2008 - All rights reserved - -THIS SOFTWARE IS PROVIDED BY IBM CORPORATION "AS IS" AND ANY EXPRESS OR IMPLIED -WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF -MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT -SHALL IBM CORPORATION BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, -EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT -OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS -INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN -CONTRACT, STRICT LIABILITY, OR TORT INCLUDING NEGLIGENCE OR OTHERWISE) ARISING -IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY -OF SUCH DAMAGE. -*/ - - - -#include "db2i_ileBridge.h" -#include "my_dbug.h" -#include "db2i_global.h" -#include "db2i_charsetSupport.h" -#include "db2i_errors.h" - - -// static class member data -ILEpointer* db2i_ileBridge::functionSymbols; -db2i_ileBridge* db2i_ileBridge::globalBridge; -#ifndef DBUG_OFF -uint32 db2i_ileBridge::registeredPtrs; -#endif - -pthread_key(IleParms*, THR_ILEPARMS); - -static void ileParmsDtor(void* parmsToFree) -{ - if (parmsToFree) - { - free_aligned(parmsToFree); - DBUG_PRINT("db2i_ileBridge", ("Freeing space for parms")); - } -} - - -/** - Convert a timestamp in ILE time format into a unix time_t -*/ -static inline time_t convertILEtime(const ILE_time_t& input) -{ - tm temp; - - temp.tm_sec = input.Second; - temp.tm_min = input.Minute; - temp.tm_hour = input.Hour; - temp.tm_mday = input.Day; - temp.tm_mon = input.Month-1; - temp.tm_year = input.Year - 1900; - temp.tm_isdst = -1; - - return mktime(&temp); -} - -/** - Allocate and intialize a new bridge structure -*/ -db2i_ileBridge* db2i_ileBridge::createNewBridge(CONNECTION_HANDLE connID) -{ - DBUG_PRINT("db2i_ileBridge::createNewBridge",("Building new bridge...")); - db2i_ileBridge* newBridge = (db2i_ileBridge*)my_malloc(sizeof(db2i_ileBridge), MYF(MY_WME)); - - if (unlikely(newBridge == NULL)) - return NULL; - - newBridge->stmtTxActive = false; - newBridge->connErrText = NULL; - newBridge->pendingLockedHandles.head = NULL; - newBridge->cachedConnectionID = connID; - - return newBridge; -} - - -void db2i_ileBridge::destroyBridge(db2i_ileBridge* bridge) -{ - bridge->freeErrorStorage(); - my_free(bridge, MYF(0)); -} - - -void db2i_ileBridge::destroyBridgeForThread(const THD* thd) -{ - void* thdData = *thd_ha_data(thd, ibmdb2i_hton); - if (thdData != NULL) - { - destroyBridge((db2i_ileBridge*)thdData); - } -} - - -void db2i_ileBridge::registerPtr(const void* ptr, ILEMemHandle* receiver) -{ - static const arg_type_t ileSignature[] = { ARG_MEMPTR, ARG_END }; - - if (unlikely(ptr == NULL)) - { - *receiver = 0; - return; - } - - struct ArgList - { - ILEarglist_base base; - ILEpointer ptr; - } *arguments; - - char argBuf[sizeof(ArgList)+15]; - arguments = (ArgList*)roundToQuadWordBdy(argBuf); - - arguments->ptr.s.addr = (address64_t)(ptr); - - _ILECALL(&functionSymbols[funcRegisterSpace], - &arguments->base, - ileSignature, - RESULT_INT64); - -#ifndef DBUG_OFF - uint32 truncHandle = arguments->base.result.r_uint64; - DBUG_PRINT("db2i_ileBridge::registerPtr",("Register 0x%p with handle %d", ptr, truncHandle)); - getBridgeForThread()->registeredPtrs++; -#endif - - *receiver = arguments->base.result.r_uint64; - return; -} - -void db2i_ileBridge::unregisterPtr(ILEMemHandle handle) -{ - static const arg_type_t ileSignature[] = { ARG_UINT64, ARG_END }; - - if (unlikely(handle == NULL)) - return; - - struct ArgList - { - ILEarglist_base base; - uint64 handle; - } *arguments; - - char argBuf[sizeof(ArgList)+15]; - arguments = (ArgList*)roundToQuadWordBdy(argBuf); - - arguments->handle = (uint64)(handle); - - _ILECALL(&functionSymbols[funcUnregisterSpace], - &arguments->base, - ileSignature, - RESULT_VOID); - -#ifndef DBUG_OFF - DBUG_PRINT("db2i_ileBridge::unregisterPtr",("Unregister handle %d", (uint32)handle)); - getBridgeForThread()->registeredPtrs--; -#endif -} - - - -/** - Initialize the bridge component - - @details Resolves srvpgm and function names of the APIs. If this fails, - the approrpiate operating system support (PTFs) is probably not installed. - - WARNING: - Must be called before any other functions in this class are used!!!! - Can only be called by a single thread! -*/ -int db2i_ileBridge::setup() -{ - static const char funcNames[db2i_ileBridge::funcListEnd][32] = - { - {"QmyRegisterParameterSpaces"}, - {"QmyRegisterSpace"}, - {"QmyUnregisterSpace"}, - {"QmyProcessRequest"} - }; - - DBUG_ENTER("db2i_ileBridge::setup"); - - int actmark = _ILELOAD("QSYS/QMYSE", ILELOAD_LIBOBJ); - if ( actmark == -1 ) - { - DBUG_PRINT("db2i_ileBridge::setup", ("srvpgm activation failed")); - DBUG_RETURN(1); - } - - functionSymbols = (ILEpointer*)malloc_aligned(sizeof(ILEpointer) * db2i_ileBridge::funcListEnd); - - for (int i = 0; i < db2i_ileBridge::funcListEnd; i++) - { - if (_ILESYM(&functionSymbols[i], actmark, funcNames[i]) == -1) - { - DBUG_PRINT("db2i_ileBridge::setup", - ("resolve of %s failed", funcNames[i])); - DBUG_RETURN(errno); - } - } - - pthread_key_create(&THR_ILEPARMS, &ileParmsDtor); - -#ifndef DBUG_OFF - registeredPtrs = 0; -#endif - - globalBridge = createNewBridge(0); - - DBUG_RETURN(0); -} - -/** - Cleanup any resources before shutting down plug-in -*/ -void db2i_ileBridge::takedown() -{ - if (globalBridge) - destroyBridge(globalBridge); - free_aligned(functionSymbols); -} - -/** - Call off to QmyProcessRequest to perform the API that the caller prepared -*/ -inline int32 db2i_ileBridge::doIt() -{ - static const arg_type_t ileSignature[] = {ARG_END}; - - struct ArgList - { - ILEarglist_base base; - } *arguments; - - char argBuf[sizeof(ArgList)+15]; - arguments = (ArgList*)roundToQuadWordBdy(argBuf); - - _ILECALL(&functionSymbols[funcProcessRequest], - &arguments->base, - ileSignature, - RESULT_INT32); - - return translateErrorCode(arguments->base.result.s_int32.r_int32); -} - -/** - Call off to QmyProcessRequest to perform the API that the caller prepared and - log any errors that may occur. -*/ -inline int32 db2i_ileBridge::doItWithLog() -{ - int32 rc = doIt(); - - if (unlikely(rc)) - { - // Only report errors that we weren't expecting - if (rc != tacitErrors[0] && - rc != tacitErrors[1] && - rc != QMY_ERR_END_OF_BLOCK) - reportSystemAPIError(rc, (Qmy_Error_output_t*)parms()->outParms); - } - memset(tacitErrors, 0, sizeof(tacitErrors)); - - return rc; -} - - -/** - Interface to QMY_ALLOCATE_SHARE API - - See QMY_ALLOCATE_SHARE documentation for more information about - parameters and return codes. -*/ -int32 db2i_ileBridge::allocateFileDefn(ILEMemHandle definitionSpace, - ILEMemHandle handleSpace, - uint16 fileCount, - const char* schemaName, - uint16 schemaNameLength, - ILEMemHandle formatSpace, - uint32 formatSpaceLen) -{ - DBUG_ASSERT(cachedStateIsCoherent()); - - IleParms* parmBlock = parms(); - Qmy_MAOS0100 *input = (Qmy_MAOS0100*)&(parmBlock->inParms); - memset(input, 0, sizeof(*input)); - - input->Format = QMY_ALLOCATE_SHARE; - input->ShrDefSpcHnd = definitionSpace; - input->ShrHndSpcHnd = handleSpace; - input->ShrDefCnt = fileCount; - input->FmtSpcHnd = formatSpace; - input->FmtSpcLen = formatSpaceLen; - - if (schemaNameLength > sizeof(input->SchNam)) - { - // This should never happen! - DBUG_ASSERT(0); - return HA_ERR_GENERIC; - } - - memcpy(input->SchNam, schemaName, schemaNameLength); - input->SchNamLen = schemaNameLength; - - input->CnnHnd = cachedConnectionID; - - int32 rc = doItWithLog(); - - return rc; -} - - -/** - Interface to QMY_ALLOCATE_INSTANCE API - - See QMY_ALLOCATE_INSTANCE documentation for more information about - parameters and return codes. -*/ -int32 db2i_ileBridge::allocateFileInstance(FILE_HANDLE defnHandle, - ILEMemHandle inuseSpace, - FILE_HANDLE* instance) -{ - DBUG_ASSERT(cachedStateIsCoherent()); - - IleParms* parmBlock = parms(); - Qmy_MAOI0100 *input = (Qmy_MAOI0100*)&(parmBlock->inParms); - memset(input, 0, sizeof(*input)); - - input->Format = QMY_ALLOCATE_INSTANCE; - input->ShrHnd = defnHandle; - input->CnnHnd = cachedConnectionID; - input->UseSpcHnd = inuseSpace; - - int32 rc = doItWithLog(); - - if (likely(rc == 0)) - { - Qmy_MAOI0100_output* output = (Qmy_MAOI0100_output*)parmBlock->outParms; - DBUG_ASSERT(instance); - *instance = output->ObjHnd; - } - - return rc; -} - - -/** - Interface to QMY_DEALLOCATE_OBJECT API - - See QMY_DEALLOCATE_OBJECT documentation for more information about - parameters and return codes. -*/ -int32 db2i_ileBridge::deallocateFile(FILE_HANDLE rfileHandle, - bool postDropTable) -{ - IleParms* parmBlock = parms(); - Qmy_MDLC0100 *input = (Qmy_MDLC0100*)&(parmBlock->inParms); - memset(input, 0, sizeof(*input)); - - input->Format = QMY_DEALLOCATE_OBJECT; - input->ObjHnd = rfileHandle; - input->ObjDrp[0] = (postDropTable ? QMY_YES : QMY_NO); - - DBUG_PRINT("db2i_ileBridge::deallocateFile", ("Deallocating %d", (uint32)rfileHandle)); - - int32 rc = doItWithLog(); - - return rc; -} - - -/** - Interface to QMY_OBJECT_INITIALIZATION API - - See QMY_OBJECT_INITIALIZATION documentation for more information about - parameters and return codes. -*/ -int32 db2i_ileBridge::initFileForIO(FILE_HANDLE rfileHandle, - char accessIntent, - char commitLevel, - uint16* inRecSize, - uint16* inRecNullOffset, - uint16* outRecSize, - uint16* outRecNullOffset) -{ - DBUG_ASSERT(cachedStateIsCoherent()); - IleParms* parmBlock = parms(); - Qmy_MOIX0100 *input = (Qmy_MOIX0100*)&(parmBlock->inParms); - memset(input, 0, sizeof(*input)); - - input->Format = QMY_OBJECT_INITIALIZATION; - input->CmtLvl[0] = commitLevel; - input->Intent[0] = accessIntent; - input->ObjHnd = rfileHandle; - input->CnnHnd = cachedConnectionID; - - int32 rc = doItWithLog(); - - if (likely(rc == 0)) - { - Qmy_MOIX0100_output* output = (Qmy_MOIX0100_output*)parmBlock->outParms; - *inRecSize = output->InNxtRowOff; - *inRecNullOffset = output->InNullMapOff; - *outRecSize = output->OutNxtRowOff; - *outRecNullOffset = output->OutNullMapOff; - } - - return rc; -} - - -/** - Interface to QMY_READ_ROWS API for reading a row with a specific RRN. - - See QMY_READ_ROWS documentation for more information about - parameters and return codes. -*/ -int32 db2i_ileBridge::readByRRN(FILE_HANDLE rfileHandle, - ILEMemHandle buf, - uint32 inRRN, - char accessIntent, - char commitLevel) -{ - DBUG_ASSERT(cachedStateIsCoherent()); - IleParms* parmBlock = parms(); - Qmy_MRDX0100 *input = (Qmy_MRDX0100*)&(parmBlock->inParms); - memset(input, 0, sizeof(*input)); - - input->Format = QMY_READ_ROWS; - input->CmtLvl[0] = commitLevel; - input->ObjHnd = rfileHandle; - input->Intent[0] = accessIntent; - input->OutSpcHnd = (uint64)buf; - input->RelRowNbr = inRRN; - input->CnnHnd = cachedConnectionID; - - int32 rc = doItWithLog(); - - if (rc == QMY_ERR_END_OF_BLOCK) - { - rc = 0; - DBUG_PRINT("db2i_ileBridge::readByRRN", ("End of block signalled")); - } - - return rc; -} - - -/** - Interface to QMY_WRITE_ROWS API. - - See QMY_WRITE_ROWS documentation for more information about - parameters and return codes. -*/ -int32 db2i_ileBridge::writeRows(FILE_HANDLE rfileHandle, - ILEMemHandle buf, - char commitLevel, - int64* outIdVal, - bool* outIdGen, - uint32* dupKeyRRN, - char** dupKeyName, - uint32* dupKeyNameLen, - uint32* outIdIncrement) -{ - DBUG_ASSERT(cachedStateIsCoherent()); - IleParms* parmBlock = parms(); - Qmy_MWRT0100 *input = (Qmy_MWRT0100*)&(parmBlock->inParms); - memset(input, 0, sizeof(*input)); - - input->Format = QMY_WRITE_ROWS; - input->CmtLvl[0] = commitLevel; - - input->ObjHnd = rfileHandle; - input->InSpcHnd = (uint64_t) buf; - input->CnnHnd = cachedConnectionID; - - int32 rc = doItWithLog(); - - Qmy_MWRT0100_output_t* output = (Qmy_MWRT0100_output_t*)parmBlock->outParms; - if (likely(rc == 0 || rc == HA_ERR_FOUND_DUPP_KEY)) - { - DBUG_ASSERT(dupKeyRRN && dupKeyName && dupKeyNameLen && outIdGen && outIdIncrement && outIdVal); - *dupKeyRRN = output->DupRRN; - *dupKeyName = (char*)parmBlock->outParms + output->DupObjNamOff; - *dupKeyNameLen = output->DupObjNamLen; - *outIdGen = (output->NewIdGen[0] == QMY_YES ? TRUE : FALSE); - if (*outIdGen == TRUE) - { - *outIdIncrement = output->IdIncrement; - *outIdVal = output->NewIdVal; - } - } - - return rc; - -} - -/** - Interface to QMY_EXECUTE_IMMEDIATE API. - - See QMY_EXECUTE_IMMEDIATE documentation for more information about - parameters and return codes. -*/ -uint32 db2i_ileBridge::execSQL(const char* statement, - uint32 statementCount, - uint8 commitLevel, - bool autoCreateSchema, - bool dropSchema, - bool noCommit, - FILE_HANDLE fileHandle) - -{ - IleParms* parmBlock = parms(); - Qmy_MSEI0100 *input = (Qmy_MSEI0100*)&(parmBlock->inParms); - memset(input, 0, sizeof(*input)); - - input->Format = QMY_EXECUTE_IMMEDIATE; - - registerPtr(statement, &input->StmtsSpcHnd); - - input->NbrStmts = statementCount; - *(uint16*)(&input->StmtCCSID) = 850; - input->AutoCrtSchema[0] = (autoCreateSchema == TRUE ? QMY_YES : QMY_NO); - input->DropSchema[0] = (dropSchema == TRUE ? QMY_YES : QMY_NO); - input->CmtLvl[0] = commitLevel; - if ((commitLevel == QMY_NONE && statementCount == 1) || noCommit) - { - input->CmtBefore[0] = QMY_NO; - input->CmtAfter[0] = QMY_NO; - } - else - { - input->CmtBefore[0] = QMY_YES; - input->CmtAfter[0] = QMY_YES; - } - input->CnnHnd = current_thd->thread_id; - input->ObjHnd = fileHandle; - - int32 rc = doItWithLog(); - - unregisterPtr(input->StmtsSpcHnd); - - return rc; -} - -/** - Interface to QMY_PREPARE_OPEN_CURSOR API. - - See QMY_PREPARE_OPEN_CURSOR documentation for more information about - parameters and return codes. -*/ -int32 db2i_ileBridge::prepOpen(const char* statement, - FILE_HANDLE* rfileHandle, - uint32* recLength) -{ - IleParms* parmBlock = parms(); - Qmy_MSPO0100 *input = (Qmy_MSPO0100*)&(parmBlock->inParms); - memset(input, 0, sizeof(*input)); - - input->Format = QMY_PREPARE_OPEN_CURSOR; - - registerPtr(statement, &input->StmtsSpcHnd ); - *(uint16*)(&input->StmtCCSID) = 850; - input->CnnHnd = current_thd->thread_id; - - int32 rc = doItWithLog(); - - if (likely(rc == 0)) - { - Qmy_MSPO0100_output* output = (Qmy_MSPO0100_output*)parmBlock->outParms; - *rfileHandle = output->ObjHnd; - *recLength = max(output->InNxtRowOff, output->OutNxtRowOff); - } - - - unregisterPtr(input->StmtsSpcHnd); - - return rc; -} - - -/** - Interface to QMY_DELETE_ROW API. - - See QMY_DELETE_ROW documentation for more information about - parameters and return codes. -*/ -int32 db2i_ileBridge::deleteRow(FILE_HANDLE rfileHandle, - uint32 rrn) -{ - DBUG_ASSERT(cachedStateIsCoherent()); - IleParms* parmBlock = parms(); - Qmy_MDLT0100 *input = (Qmy_MDLT0100*)&(parmBlock->inParms); - memset(input, 0, sizeof(*input)); - - input->Format = QMY_DELETE_ROW; - input->ObjHnd = rfileHandle; - input->RelRowNbr = rrn; - input->CnnHnd = cachedConnectionID; - - int32 rc = doItWithLog(); - - return rc; -} - - -/** - Interface to QMY_UPDATE_ROW API. - - See QMY_UPDATE_ROW documentation for more information about - parameters and return codes. -*/ -int32 db2i_ileBridge::updateRow(FILE_HANDLE rfileHandle, - uint32 rrn, - ILEMemHandle buf, - uint32* dupKeyRRN, - char** dupKeyName, - uint32* dupKeyNameLen) -{ - DBUG_ASSERT(cachedStateIsCoherent()); - IleParms* parmBlock = parms(); - Qmy_MUPD0100 *input = (Qmy_MUPD0100*)&(parmBlock->inParms); - memset(input, 0, sizeof(*input)); - - input->Format = QMY_UPDATE_ROW; - input->ObjHnd = rfileHandle; - input->InSpcHnd = (uint64)buf; - input->RelRowNbr = rrn; - input->CnnHnd = cachedConnectionID; - - int32 rc = doItWithLog(); - - if (rc == HA_ERR_FOUND_DUPP_KEY) - { - Qmy_MUPD0100_output* output = (Qmy_MUPD0100_output*)parmBlock->outParms; - DBUG_ASSERT(dupKeyRRN && dupKeyName && dupKeyNameLen); - *dupKeyRRN = output->DupRRN; - *dupKeyName = (char*)parmBlock->outParms + output->DupObjNamOff; - *dupKeyNameLen = output->DupObjNamLen; - } - - return rc; -} - -/** - Interface to QMY_DESCRIBE_RANGE API. - - See QMY_DESCRIBE_RANGE documentation for more information about - parameters and return codes. -*/ -int32 db2i_ileBridge::recordsInRange(FILE_HANDLE defnHandle, - ILEMemHandle inSpc, - uint32 inKeyCnt, - uint32 inLiteralCnt, - uint32 inBoundsOff, - uint32 inLitDefOff, - uint32 inLiteralsOff, - uint32 inCutoff, - uint32 inSpcLen, - uint16 inEndByte, - uint64* outRecCnt, - uint16* outRtnCode) -{ - DBUG_ASSERT(cachedStateIsCoherent()); - - IleParms* parmBlock = parms(); - Qmy_MDRG0100 *input = (Qmy_MDRG0100*)&(parmBlock->inParms); - memset(input, 0, sizeof(*input)); - - input->Format = QMY_DESCRIBE_RANGE; - input->ShrHnd = defnHandle; - input->SpcHnd = (uint64)inSpc; - input->KeyCnt = inKeyCnt; - input->LiteralCnt = inLiteralCnt; - input->BoundsOff = inBoundsOff; - input->LitDefOff = inLitDefOff; - input->LiteralsOff = inLiteralsOff; - input->Cutoff = inCutoff; - input->SpcLen = inSpcLen; - input->EndByte = inEndByte; - input->CnnHnd = cachedConnectionID; - - int rc = doItWithLog(); - - if (likely(rc == 0)) - { - Qmy_MDRG0100_output* output = (Qmy_MDRG0100_output*)parmBlock->outParms; - DBUG_ASSERT(outRecCnt && outRtnCode); - *outRecCnt = output->RecCnt; - *outRtnCode = output->RtnCode; - } - - return rc; -} - - -/** - Interface to QMY_RELEASE_ROW API. - - See QMY_RELEASE_ROW documentation for more information about - parameters and return codes. -*/ -int32 db2i_ileBridge::rrlslck(FILE_HANDLE rfileHandle, char accessIntent) -{ - DBUG_ASSERT(cachedStateIsCoherent()); - - IleParms* parmBlock = parms(); - Qmy_MRRX0100 *input = (Qmy_MRRX0100*)&(parmBlock->inParms); - memset(input, 0, sizeof(*input)); - - input->Format = QMY_RELEASE_ROW; - - input->ObjHnd = rfileHandle; - input->CnnHnd = cachedConnectionID; - input->Intent[0] = accessIntent; - - int32 rc = doItWithLog(); - - return rc; -} - -/** - Interface to QMY_LOCK_OBJECT API. - - See QMY_LOCK_OBJECT documentation for more information about - parameters and return codes. -*/ -int32 db2i_ileBridge::lockObj(FILE_HANDLE defnHandle, - uint64 lockVal, - char lockAction, - char lockType, - char lockTimeout) -{ - DBUG_ASSERT(cachedStateIsCoherent()); - IleParms* parmBlock = parms(); - Qmy_MOLX0100 *input = (Qmy_MOLX0100*)&(parmBlock->inParms); - memset(input, 0, sizeof(*input)); - - input->Format = QMY_LOCK_OBJECT; - input->ShrHnd = defnHandle; - input->LckTimeoutVal = lockVal; - input->Action[0] = lockAction; - input->LckTyp[0] = lockType; - input->LckTimeout[0] = lockTimeout; - input->CnnHnd = cachedConnectionID; - - int32 rc = doItWithLog(); - - return rc; -} - -/** - Interface to QMY_DESCRIBE_CONSTRAINTS API. - - See QMY_DESCRIBE_CONSTRAINTS documentation for more information about - parameters and return codes. -*/ -int32 db2i_ileBridge::constraints(FILE_HANDLE defnHandle, - ILEMemHandle inSpc, - uint32 inSpcLen, - uint32* outLen, - uint32* outCnt) -{ - DBUG_ASSERT(cachedStateIsCoherent()); - IleParms* parmBlock = parms(); - Qmy_MDCT0100 *input = (Qmy_MDCT0100*)&(parmBlock->inParms); - memset(input, 0, sizeof(*input)); - - input->Format = QMY_DESCRIBE_CONSTRAINTS; - input->ShrHnd = defnHandle; - input->CstSpcHnd = (uint64)inSpc; - input->CstSpcLen = inSpcLen; - input->CnnHnd = cachedConnectionID; - - int32 rc = doItWithLog(); - - if (likely(rc == 0)) - { - Qmy_MDCT0100_output* output = (Qmy_MDCT0100_output*)parmBlock->outParms; - DBUG_ASSERT(outLen && outCnt); - *outLen = output->NeededLen; - *outCnt = output->CstCnt; - } - - return rc; -} - - -/** - Interface to QMY_REORGANIZE_TABLE API. - - See QMY_REORGANIZE_TABLE documentation for more information about - parameters and return codes. -*/ -int32 db2i_ileBridge::optimizeTable(FILE_HANDLE defnHandle) -{ - DBUG_ASSERT(cachedStateIsCoherent()); - IleParms* parmBlock = parms(); - Qmy_MRGX0100 *input = (Qmy_MRGX0100*)&(parmBlock->inParms); - memset(input, 0, sizeof(*input)); - - input->Format = QMY_REORGANIZE_TABLE; - input->ShrHnd = defnHandle; - input->CnnHnd = cachedConnectionID; - - int32 rc = doItWithLog(); - - return rc; -} - - -/** - Interface to QMY_PROCESS_COMMITMENT_CONTROL API. - - See QMY_PROCESS_COMMITMENT_CONTROL documentation for more information about - parameters and return codes. -*/ -int32 db2i_ileBridge::commitmentControl(uint8 function) -{ - DBUG_ASSERT(cachedStateIsCoherent()); - IleParms* parmBlock = parms(); - Qmy_MCCX0100 *input = (Qmy_MCCX0100*)&(parmBlock->inParms); - memset(input, 0, sizeof(*input)); - - input->Format = QMY_PROCESS_COMMITMENT_CONTROL; - input->Function[0] = function; - input->CnnHnd = cachedConnectionID; - - int32 rc = doItWithLog(); - - return rc; -} - - -/** - Interface to QMY_PROCESS_SAVEPOINT API. - - See QMY_PROCESS_SAVEPOINT documentation for more information about parameters and - return codes. -*/ -int32 db2i_ileBridge::savepoint(uint8 function, - const char* savepointName) -{ - DBUG_ASSERT(cachedStateIsCoherent()); - DBUG_PRINT("db2i_ileBridge::savepoint",("%d %s", (uint32)function, savepointName)); - - IleParms* parmBlock = parms(); - Qmy_MSPX0100 *input = (Qmy_MSPX0100*)&(parmBlock->inParms); - memset(input, 0, sizeof(*input)); - - char* savPtNam = (char*)(input+1); - - input->Format = QMY_PROCESS_SAVEPOINT; - - if (strlen(savepointName) > MAX_DB2_SAVEPOINTNAME_LENGTH) - { - DBUG_ASSERT(0); - return HA_ERR_GENERIC; - } - strcpy(savPtNam, savepointName); - - input->Function[0] = function; - input->SavPtNamOff = savPtNam - (char*)(input); - input->SavPtNamLen = strlen(savepointName); - input->CnnHnd = cachedConnectionID; - - int32 rc = doItWithLog(); - - return rc; -} - -static ILEMemHandle traceSpcHandle; -/** - Do initialization for the QMY_* APIs. - - @parm aspName The name of the relational database to use for all - connections. - - @return 0 if successful; error otherwise -*/ -int32 db2i_ileBridge::initILE(const char* aspName, - uint16* traceCtlPtr) -{ - // We forego the typical thread-based parms space because MySQL doesn't - // allow us to clean it up before checking for memory leaks. As a result - // we get a complaint about leaked memory on server shutdown. - int32 rc; - char inParms[db2i_ileBridge_MAX_INPARM_SIZE]; - char outParms[db2i_ileBridge_MAX_OUTPARM_SIZE]; - if (rc = registerParmSpace(inParms, outParms)) - { - reportSystemAPIError(rc, NULL); - return rc; - } - - registerPtr(traceCtlPtr, &traceSpcHandle); - - struct ParmBlock - { - Qmy_MINI0100 parms; - } *parmBlock = (ParmBlock*)inParms; - - memset(inParms, 0, sizeof(ParmBlock)); - - parmBlock->parms.Format = QMY_INITIALIZATION; - - char paddedName[18]; - if (strlen(aspName) > sizeof(paddedName)) - { - getErrTxt(DB2I_ERR_BAD_RDB_NAME); - return DB2I_ERR_BAD_RDB_NAME; - } - - memset(paddedName, ' ', sizeof(paddedName)); - memcpy(paddedName, aspName, strlen(aspName)); - convToEbcdic(paddedName, parmBlock->parms.RDBName, strlen(paddedName)); - - parmBlock->parms.RDBNamLen = strlen(paddedName); - parmBlock->parms.TrcSpcHnd = traceSpcHandle; - - rc = doIt(); - - if (rc) - { - reportSystemAPIError(rc, (Qmy_Error_output_t*)outParms); - } - - return rc; -} - -/** - Signal to the QMY_ APIs to perform any cleanup they need to do. -*/ -int32 db2i_ileBridge::exitILE() -{ - IleParms* parmBlock = parms(); - Qmy_MCLN0100 *input = (Qmy_MCLN0100*)&(parmBlock->inParms); - memset(input, 0, sizeof(*input)); - - input->Format = QMY_CLEANUP; - - int32 rc = doIt(); - - if (rc) - { - reportSystemAPIError(rc, (Qmy_Error_output_t*)parmBlock->outParms); - } - - unregisterPtr(traceSpcHandle); - - DBUG_PRINT("db2i_ileBridge::exitILE", ("Registered ptrs remaining: %d", registeredPtrs)); -#ifndef DBUG_OFF - if (registeredPtrs != 0) - printf("Oh no! IBMDB2I left some pointers registered. Count was %d.\n", registeredPtrs); -#endif - - // This is needed to prevent SAFE_MALLOC from complaining at process termination. - my_pthread_setspecific_ptr(THR_ILEPARMS, NULL); - free_aligned(parmBlock); - - return rc; - -} - - -/** - Designate the specified addresses as parameter passing buffers. - - @parm in Input to the API will go here; format is defined by the individual API - @parm out Output from the API will be; format is defined by the individual API - - @return 0 if success; error otherwise -*/ -int db2i_ileBridge::registerParmSpace(char* in, char* out) -{ - static const arg_type_t ileSignature[] = { ARG_MEMPTR, ARG_MEMPTR, ARG_END }; - - struct ArgList - { - ILEarglist_base base; - ILEpointer input; - ILEpointer output; - } *arguments; - - char argBuf[sizeof(ArgList)+15]; - arguments = (ArgList*)roundToQuadWordBdy(argBuf); - - arguments->input.s.addr = (address64_t)(in); - arguments->output.s.addr = (address64_t)(out); - - _ILECALL(&functionSymbols[funcRegisterParameterSpaces], - &arguments->base, - ileSignature, - RESULT_INT32); - - return arguments->base.result.s_int32.r_int32; -} - - -/** - Interface to QMY_OBJECT_OVERRIDE API. - - See QMY_OBJECT_OVERRIDE documentation for more information about parameters and - return codes. -*/ -int32 db2i_ileBridge::objectOverride(FILE_HANDLE rfileHandle, - ILEMemHandle buf, - uint32 recordWidth) -{ - DBUG_ASSERT(cachedStateIsCoherent()); - IleParms* parmBlock = parms(); - Qmy_MOOX0100 *input = (Qmy_MOOX0100*)&(parmBlock->inParms); - memset(input, 0, sizeof(*input)); - - input->Format = QMY_OBJECT_OVERRIDE; - input->ObjHnd = rfileHandle; - input->OutSpcHnd = (uint64)buf; - input->NxtRowOff = recordWidth; - input->CnnHnd = cachedConnectionID; - - int32 rc = doItWithLog(); - - return rc; -} - -/** - Interface to QMY_DESCRIBE_OBJECT API for obtaining table stats. - - See QMY_DESCRIBE_OBJECT documentation for more information about parameters and - return codes. -*/ -int32 db2i_ileBridge::retrieveTableInfo(FILE_HANDLE defnHandle, - uint16 dataRequested, - ha_statistics& stats, - ILEMemHandle inSpc) -{ - DBUG_ASSERT(cachedStateIsCoherent()); - IleParms* parmBlock = parms(); - Qmy_MDSO0100 *input = (Qmy_MDSO0100*)&(parmBlock->inParms); - memset(input, 0, sizeof(*input)); - - input->Format = QMY_DESCRIBE_OBJECT; - input->ShrHnd = defnHandle; - input->CnnHnd = cachedConnectionID; - - if (dataRequested & objLength) - input->RtnObjLen[0] = QMY_YES; - if (dataRequested & rowCount) - input->RtnRowCnt[0] = QMY_YES; - if (dataRequested & deletedRowCount) - input->RtnDltRowCnt[0] = QMY_YES; - if (dataRequested & rowsPerKey) - { - input->RowKeyHnd = (uint64)inSpc; - input->RtnRowKey[0] = QMY_YES; - } - if (dataRequested & meanRowLen) - input->RtnMeanRowLen[0] = QMY_YES; - if (dataRequested & lastModTime) - input->RtnModTim[0] = QMY_YES; - if (dataRequested & createTime) - input->RtnCrtTim[0] = QMY_YES; - if (dataRequested & ioCount) - input->RtnEstIoCnt[0] = QMY_YES; - - int32 rc = doItWithLog(); - - if (likely(rc == 0)) - { - Qmy_MDSO0100_output* output = (Qmy_MDSO0100_output*)parmBlock->outParms; - if (dataRequested & objLength) - stats.data_file_length = output->ObjLen; - if (dataRequested & rowCount) - stats.records= output->RowCnt; - if (dataRequested & deletedRowCount) - stats.deleted = output->DltRowCnt; - if (dataRequested & meanRowLen) - stats.mean_rec_length = output->MeanRowLen; - if (dataRequested & lastModTime) - stats.update_time = convertILEtime(output->ModTim); - if (dataRequested & createTime) - stats.create_time = convertILEtime(output->CrtTim); - if (dataRequested & ioCount) - stats.data_file_length = output->EstIoCnt; - } - - return rc; -} - -/** - Interface to QMY_DESCRIBE_OBJECT API for finding index size. - - See QMY_DESCRIBE_OBJECT documentation for more information about parameters and - return codes. -*/ -int32 db2i_ileBridge::retrieveIndexInfo(FILE_HANDLE defnHandle, - uint64* outPageCnt) -{ - DBUG_ASSERT(cachedStateIsCoherent()); - IleParms* parmBlock = parms(); - Qmy_MDSO0100 *input = (Qmy_MDSO0100*)&(parmBlock->inParms); - memset(input, 0, sizeof(*input)); - - input->Format = QMY_DESCRIBE_OBJECT; - input->ShrHnd = defnHandle; - input->CnnHnd = cachedConnectionID; - input->RtnPageCnt[0] = QMY_YES; - - int32 rc = doItWithLog(); - - if (likely(rc == 0)) - { - Qmy_MDSO0100_output* output = (Qmy_MDSO0100_output*)parmBlock->outParms; - *outPageCnt = output->PageCnt; - } - - return rc; -} - - -/** - Interface to QMY_CLOSE_CONNECTION API - - See QMY_CLOSE_CONNECTION documentation for more information about parameters and - return codes. -*/ -int32 db2i_ileBridge::closeConnection(CONNECTION_HANDLE conn) -{ - IleParms* parmBlock = parms(); - Qmy_MCCN0100 *input = (Qmy_MCCN0100*)&(parmBlock->inParms); - memset(input, 0, sizeof(*input)); - - input->Format = QMY_CLOSE_CONNECTION; - input->CnnHnd = conn; - - int32 rc = doItWithLog(); - - return rc; -} - - -/** - Interface to QMY_INTERRUPT API - - See QMY_INTERRUPT documentation for more information about parameters and - return codes. -*/ -int32 db2i_ileBridge::readInterrupt(FILE_HANDLE fileHandle) -{ - DBUG_ASSERT(cachedStateIsCoherent()); - IleParms* parmBlock = parms(); - Qmy_MINT0100 *input = (Qmy_MINT0100*)&(parmBlock->inParms); - memset(input, 0, sizeof(*input)); - - input->Format = QMY_INTERRUPT; - input->CnnHnd = cachedConnectionID; - input->ObjHnd = fileHandle; - - int32 rc = doItWithLog(); - - if (rc == QMY_ERR_END_OF_BLOCK) - { - rc = 0; - DBUG_PRINT("db2i_ileBridge::readInterrupt", ("End of block signalled")); - } - - return rc; -} - -/** - Interface to QMY_READ_ROWS API - - See QMY_READ_ROWS documentation for more information about parameters and - return codes. -*/ -int32 db2i_ileBridge::read(FILE_HANDLE rfileHandle, - ILEMemHandle buf, - char accessIntent, - char commitLevel, - char orientation, - bool asyncRead, - ILEMemHandle rrn, - ILEMemHandle key, - uint32 keylen, - uint16 keyParts, - int pipeFD) -{ - DBUG_ASSERT(cachedStateIsCoherent()); - IleParms* parmBlock = parms(); - Qmy_MRDX0100 *input = (Qmy_MRDX0100*)&(parmBlock->inParms); - memset(input, 0, sizeof(*input)); - - input->Format = QMY_READ_ROWS; - input->CmtLvl[0] = commitLevel; - - input->ObjHnd = rfileHandle; - input->Intent[0] = accessIntent; - input->OutSpcHnd = (uint64)buf; - input->OutRRNSpcHnd = (uint64)rrn; - input->RtnData[0] = QMY_RETURN_DATA; - - if (key) - { - input->KeySpcHnd = (uint64)key; - input->KeyColsLen = keylen; - input->KeyColsNbr = keyParts; - } - - input->Async[0] = (asyncRead ? QMY_YES : QMY_NO); - input->PipeDesc = pipeFD; - input->Orientation[0] = orientation; - input->CnnHnd = cachedConnectionID; - - int32 rc = doItWithLog(); - - // QMY_ERR_END_OF_BLOCK is informational only, so we ignore it. - if (rc == QMY_ERR_END_OF_BLOCK) - { - rc = 0; - DBUG_PRINT("db2i_ileBridge::read", ("End of block signalled")); - } - - return rc; -} - - -/** - Interface to QMY_QUIESCE_OBJECT API - - See QMY_QUIESCE_OBJECT documentation for more information about parameters and - return codes. -*/ -int32 db2i_ileBridge::quiesceFileInstance(FILE_HANDLE rfileHandle) -{ - IleParms* parmBlock = parms(); - Qmy_MQSC0100 *input = (Qmy_MQSC0100*)&(parmBlock->inParms); - memset(input, 0, sizeof(*input)); - - input->Format = QMY_QUIESCE_OBJECT; - input->ObjHnd = rfileHandle; - - int32 rc = doItWithLog(); - -#ifndef DBUG_OFF - if (unlikely(rc)) - { - DBUG_ASSERT(0); - } -#endif - - return rc; -} - -void db2i_ileBridge::PreservedHandleList::add(const char* newname, FILE_HANDLE newhandle, IBMDB2I_SHARE* share) -{ - NameHandlePair *newPair = (NameHandlePair*)my_malloc(sizeof(NameHandlePair), MYF(MY_WME)); - - newPair->next = head; - head = newPair; - - strcpy(newPair->name, newname); - newPair->handle = newhandle; - newPair->share = share; - DBUG_PRINT("db2i_ileBridge", ("Added handle %d for %s", uint32(newhandle), newname)); -} - - -FILE_HANDLE db2i_ileBridge::PreservedHandleList::findAndRemove(const char* fileName, IBMDB2I_SHARE** share) -{ - NameHandlePair* current = head; - NameHandlePair* prev = NULL; - - while (current) - { - NameHandlePair* next = current->next; - if (strcmp(fileName, current->name) == 0) - { - FILE_HANDLE tmp = current->handle; - *share = current->share; - if (prev) - prev->next = next; - if (current == head) - head = next; - my_free(current, MYF(0)); - DBUG_PRINT("db2i_ileBridge", ("Found handle %d for %s", uint32(tmp), fileName)); - return tmp; - } - prev = current; - current = next; - } - - return 0; -} - - -IleParms* db2i_ileBridge::initParmsForThread() -{ - - IleParms* p = (IleParms*)malloc_aligned(sizeof(IleParms)); - DBUG_ASSERT((uint64)(&(p->outParms))% 16 == 0); // Guarantee that outParms are aligned correctly - - if (likely(p)) - { - int32 rc = registerParmSpace((p->inParms), (p->outParms)); - if (likely(rc == 0)) - { - my_pthread_setspecific_ptr(THR_ILEPARMS, p); - DBUG_PRINT("db2i_ileBridge", ("Inited space for parms")); - return p; - } - else - reportSystemAPIError(rc, NULL); - } - - return NULL; -} - diff --git a/storage/ibmdb2i/db2i_ileBridge.h b/storage/ibmdb2i/db2i_ileBridge.h deleted file mode 100644 index 10b9820d983..00000000000 --- a/storage/ibmdb2i/db2i_ileBridge.h +++ /dev/null @@ -1,499 +0,0 @@ -/* -Licensed Materials - Property of IBM -DB2 Storage Engine Enablement -Copyright IBM Corporation 2007,2008 -All rights reserved - -Redistribution and use in source and binary forms, with or without modification, -are permitted provided that the following conditions are met: - (a) Redistributions of source code must retain this list of conditions, the - copyright notice in section {d} below, and the disclaimer following this - list of conditions. - (b) Redistributions in binary form must reproduce this list of conditions, the - copyright notice in section (d) below, and the disclaimer following this - list of conditions, in the documentation and/or other materials provided - with the distribution. - (c) The name of IBM may not be used to endorse or promote products derived from - this software without specific prior written permission. - (d) The text of the required copyright notice is: - Licensed Materials - Property of IBM - DB2 Storage Engine Enablement - Copyright IBM Corporation 2007,2008 - All rights reserved - -THIS SOFTWARE IS PROVIDED BY IBM CORPORATION "AS IS" AND ANY EXPRESS OR IMPLIED -WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF -MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT -SHALL IBM CORPORATION BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, -EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT -OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS -INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN -CONTRACT, STRICT LIABILITY, OR TORT INCLUDING NEGLIGENCE OR OTHERWISE) ARISING -IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY -OF SUCH DAMAGE. -*/ - - -#ifndef DB2I_ILEBRIDGE_H -#define DB2I_ILEBRIDGE_H - -#include "db2i_global.h" -#include "mysql_priv.h" -#include "as400_types.h" -#include "as400_protos.h" -#include "qmyse.h" -#include "db2i_errors.h" - -typedef uint64_t FILE_HANDLE; -typedef my_thread_id CONNECTION_HANDLE; -const char SAVEPOINT_NAME[] = {0xD4,0xE2,0xD7,0xC9,0xD5,0xE3,0xC5,0xD9,0xD5,0x0}; -const uint32 TACIT_ERRORS_SIZE=2; - -enum db2i_InfoRequestSpec -{ - objLength = 1, - rowCount = 2, - deletedRowCount = 4, - rowsPerKey = 8, - meanRowLen = 16, - lastModTime = 32, - createTime = 64, - ioCount = 128 -}; - -extern handlerton *ibmdb2i_hton; -struct IBMDB2I_SHARE; - -const uint32 db2i_ileBridge_MAX_INPARM_SIZE = 512; -const uint32 db2i_ileBridge_MAX_OUTPARM_SIZE = 512; - -extern pthread_key(IleParms*, THR_ILEPARMS); -struct IleParms -{ - char inParms[db2i_ileBridge_MAX_INPARM_SIZE]; - char outParms[db2i_ileBridge_MAX_OUTPARM_SIZE]; -}; - -/** - @class db2i_ileBridge - - Implements a connection-based interface to the QMY_* APIs - - @details Each client connection that touches an IBMDB2I table has a "bridge" - associated with it. This bridge is constructed on first use and provides a - more C-like interface to the APIs. As well, it is reponsible for tracking - connection scoped information such as statement transaction state and error - message text. The bridge is destroyed when the connection ends. -*/ -class db2i_ileBridge -{ - enum ileFuncs - { - funcRegisterParameterSpaces, - funcRegisterSpace, - funcUnregisterSpace, - funcProcessRequest, - funcListEnd - }; - - static db2i_ileBridge* globalBridge; -public: - - - static int setup(); - static void takedown(); - - /** - Obtain a pointer to the bridge for the current connection. - - If a MySQL client connection is on the stack, we get the associated brideg. - Otherwise, we use the globalBridge. - */ - static db2i_ileBridge* getBridgeForThread() - { - THD* thd = current_thd; - if (likely(thd)) - return getBridgeForThread(thd); - - return globalBridge; - } - - /** - Obtain a pointer to the bridge for the specified connection. - - If a bridge exists already, we return it immediately. Otherwise, prepare - a new bridge for the connection. - */ - static db2i_ileBridge* getBridgeForThread(const THD* thd) - { - void* thdData = *thd_ha_data(thd, ibmdb2i_hton); - if (likely(thdData != NULL)) - return (db2i_ileBridge*)(thdData); - - db2i_ileBridge* newBridge = createNewBridge(thd->thread_id); - *thd_ha_data(thd, ibmdb2i_hton) = (void*)newBridge; - return newBridge; - } - - static void destroyBridgeForThread(const THD* thd); - static void registerPtr(const void* ptr, ILEMemHandle* receiver); - static void unregisterPtr(ILEMemHandle handle); - int32 allocateFileDefn(ILEMemHandle definitionSpace, - ILEMemHandle handleSpace, - uint16 fileCount, - const char* schemaName, - uint16 schemaNameLength, - ILEMemHandle formatSpace, - uint32 formatSpaceLen); - int32 allocateFileInstance(FILE_HANDLE defnHandle, - ILEMemHandle inuseSpace, - FILE_HANDLE* instance); - int32 deallocateFile(FILE_HANDLE fileHandle, - bool postDropTable=FALSE); - int32 read(FILE_HANDLE rfileHandle, - ILEMemHandle buf, - char accessIntent, - char commitLevel, - char orientation, - bool asyncRead = FALSE, - ILEMemHandle rrn = 0, - ILEMemHandle key = 0, - uint32 keylen = 0, - uint16 keyParts = 0, - int pipeFD = -1); - int32 readByRRN(FILE_HANDLE rfileHandle, - ILEMemHandle buf, - uint32 inRRN, - char accessIntent, - char commitLevel); - int32 writeRows(FILE_HANDLE rfileHandle, - ILEMemHandle buf, - char commitLevel, - int64* outIdVal, - bool* outIdGen, - uint32* dupKeyRRN, - char** dupKeyName, - uint32* dupKeyNameLen, - uint32* outIdIncrement); - uint32 execSQL(const char* statement, - uint32 statementCount, - uint8 commitLevel, - bool autoCreateSchema = FALSE, - bool dropSchema = FALSE, - bool noCommit = FALSE, - FILE_HANDLE fileHandle = 0); - int32 prepOpen(const char* statement, - FILE_HANDLE* rfileHandle, - uint32* recLength); - int32 deleteRow(FILE_HANDLE rfileHandle, - uint32 rrn); - int32 updateRow(FILE_HANDLE rfileHandle, - uint32 rrn, - ILEMemHandle buf, - uint32* dupKeyRRN, - char** dupKeyName, - uint32* dupKeyNameLen); - int32 commitmentControl(uint8 function); - int32 savepoint(uint8 function, - const char* savepointName); - int32 recordsInRange(FILE_HANDLE rfileHandle, - ILEMemHandle inSpc, - uint32 inKeyCnt, - uint32 inLiteralCnt, - uint32 inBoundsOff, - uint32 inLitDefOff, - uint32 inLiteralsOff, - uint32 inCutoff, - uint32 inSpcLen, - uint16 inEndByte, - uint64* outRecCnt, - uint16* outRtnCode); - int32 rrlslck(FILE_HANDLE rfileHandle, - char accessIntent); - int32 lockObj(FILE_HANDLE rfileHandle, - uint64 inTimeoutVal, - char inAction, - char inLockType, - char inTimeout); - int32 constraints(FILE_HANDLE rfileHandle, - ILEMemHandle inSpc, - uint32 inSpcLen, - uint32* outLen, - uint32* outCnt); - int32 optimizeTable(FILE_HANDLE rfileHandle); - static int32 initILE(const char* aspName, - uint16* traceCtlPtr); - int32 initFileForIO(FILE_HANDLE rfileHandle, - char accessIntent, - char commitLevel, - uint16* inRecSize, - uint16* inRecNullOffset, - uint16* outRecSize, - uint16* outRecNullOffset); - int32 readInterrupt(FILE_HANDLE fileHandle); - static int32 exitILE(); - - int32 objectOverride(FILE_HANDLE rfileHandle, - ILEMemHandle buf, - uint32 recordWidth = 0); - - int32 retrieveTableInfo(FILE_HANDLE rfileHandle, - uint16 dataRequested, - ha_statistics& stats, - ILEMemHandle inSpc = NULL); - - int32 retrieveIndexInfo(FILE_HANDLE rfileHandle, - uint64* outPageCnt); - - int32 closeConnection(CONNECTION_HANDLE conn); - int32 quiesceFileInstance(FILE_HANDLE rfileHandle); - - /** - Mark the beginning of a "statement transaction" - - @detail MySQL "statement transactions" (see sql/handler.cc) are implemented - as DB2 savepoints having a predefined name. - - @return 0 if successful; error otherwise - */ - uint32 beginStmtTx() - { - DBUG_ENTER("db2i_ileBridge::beginStmtTx"); - if (stmtTxActive) - DBUG_RETURN(0); - - stmtTxActive = true; - - DBUG_RETURN(savepoint(QMY_SET_SAVEPOINT, SAVEPOINT_NAME)); - } - - /** - Commit a "statement transaction" - - @return 0 if successful; error otherwise - */ - uint32 commitStmtTx() - { - DBUG_ENTER("db2i_ileBridge::commitStmtTx"); - DBUG_ASSERT(stmtTxActive); - stmtTxActive = false; - DBUG_RETURN(savepoint(QMY_RELEASE_SAVEPOINT, SAVEPOINT_NAME)); - } - - /** - Roll back a "statement transaction" - - @return 0 if successful; error otherwise - */ - uint32 rollbackStmtTx() - { - DBUG_ENTER("db2i_ileBridge::rollbackStmtTx"); - DBUG_ASSERT(stmtTxActive); - stmtTxActive = false; - DBUG_RETURN(savepoint(QMY_ROLLBACK_SAVEPOINT, SAVEPOINT_NAME)); - } - - - /** - Provide storage for generating error messages. - - This storage must persist until the error message is retrieved from the - handler instance. It is for this reason that we associate it with the bridge. - - @return Pointer to heap storage of MYSQL_ERRMSG_SIZE bytes - */ - char* getErrorStorage() - { - if (!connErrText) - { - connErrText = (char*)my_malloc(MYSQL_ERRMSG_SIZE, MYF(MY_WME)); - if (connErrText) connErrText[0] = 0; - } - - return connErrText; - } - - /** - Free storage for generating error messages. - */ - void freeErrorStorage() - { - if (likely(connErrText)) - { - my_free(connErrText, MYF(0)); - connErrText = NULL; - } - } - - - /** - Store a file handle for later retrieval. - - If deallocateFile encounters a lock when trying to perform its operation, - the file remains allocated but must be deallocated later. This function - provides a way for the connection to "remember" that this deallocation is - still needed. - - @param newname The name of the file to be added - @param newhandle The handle associated with newname - - */ - void preserveHandle(const char* newname, FILE_HANDLE newhandle, IBMDB2I_SHARE* share) - { - pendingLockedHandles.add(newname, newhandle, share); - } - - /** - Retrieve a file handle stored by preserveHandle(). - - @param name The name of the file to be retrieved. - - @return The handle associated with name - */ - FILE_HANDLE findAndRemovePreservedHandle(const char* name, IBMDB2I_SHARE** share) - { - FILE_HANDLE hdl = pendingLockedHandles.findAndRemove(name, share); - return hdl; - } - - /** - Indicate which error messages should be suppressed on the next API call - - These functions are useful for ensuring that the provided error numbers - are returned if a failure occurs but do not cause a spurious error message - to be returned. - - @return A pointer to this instance - */ - db2i_ileBridge* expectErrors(int32 er1) - { - tacitErrors[0]=er1; - return this; - } - - db2i_ileBridge* expectErrors(int32 er1, int32 er2) - { - tacitErrors[0]=er1; - tacitErrors[1]=er2; - return this; - } - - /** - Obtain the IBM i system message that accompanied the last API failure. - - @return A pointer to the 7 character message ID. - */ - static const char* getErrorMsgID() - { - return ((Qmy_Error_output_t*)parms()->outParms)->MsgId; - } - - /** - Convert an API error code into the equivalent MySQL error code (if any) - - @param rc The QMYSE API error code - - @return If an equivalent exists, the MySQL error code; else rc - */ - static int32 translateErrorCode(int32 rc) - { - if (likely(rc == 0)) - return 0; - - switch (rc) - { - case QMY_ERR_KEY_NOT_FOUND: - return HA_ERR_KEY_NOT_FOUND; - case QMY_ERR_DUP_KEY: - return HA_ERR_FOUND_DUPP_KEY; - case QMY_ERR_END_OF_FILE: - return HA_ERR_END_OF_FILE; - case QMY_ERR_LOCK_TIMEOUT: - return HA_ERR_LOCK_WAIT_TIMEOUT; - case QMY_ERR_CST_VIOLATION: - return HA_ERR_NO_REFERENCED_ROW; - case QMY_ERR_TABLE_NOT_FOUND: - return HA_ERR_NO_SUCH_TABLE; - case QMY_ERR_NON_UNIQUE_KEY: - return ER_DUP_ENTRY; - case QMY_ERR_MSGID: - { - if (memcmp(getErrorMsgID(), DB2I_CPF503A, 7) == 0) - return HA_ERR_ROW_IS_REFERENCED; - if (memcmp(getErrorMsgID(), DB2I_SQL0538, 7) == 0) - return HA_ERR_CANNOT_ADD_FOREIGN; - } - } - return rc; - } - -private: - - static db2i_ileBridge* createNewBridge(CONNECTION_HANDLE connID); - static void destroyBridge(db2i_ileBridge* bridge); - static int registerParmSpace(char* in, char* out); - static int32 doIt(); - int32 doItWithLog(); - - static _ILEpointer *functionSymbols; ///< Array of ILE function pointers - CONNECTION_HANDLE cachedConnectionID; ///< The associated connection - bool stmtTxActive; ///< Inside statement transaction - char *connErrText; ///< Storage for error message - int32 tacitErrors[TACIT_ERRORS_SIZE]; ///< List of errors to be suppressed - - static IleParms* initParmsForThread(); - - /** - Get space for passing parameters to the QMY_* APIs - - @details A fixed-length parameter passing space is associated with each - pthread. This space is allocated and registered by initParmsForThread() - the first time a pthread works with a bridge. The space is cached away - and remains available until the pthread ends. It became necessary to - disassociate the parameter space from the bridge in order to support - future enhancements to MySQL that sever the one-to-one relationship between - pthreads and user connections. The QMY_* APIs scope a registered parameter - space to the thread that executes the register operation. - */ - static IleParms* parms() - { - IleParms* p = my_pthread_getspecific_ptr(IleParms*, THR_ILEPARMS); - if (likely(p)) - return p; - - return initParmsForThread(); - } - - class PreservedHandleList - { - friend db2i_ileBridge* db2i_ileBridge::createNewBridge(CONNECTION_HANDLE); - public: - void add(const char* newname, FILE_HANDLE newhandle, IBMDB2I_SHARE* share); - FILE_HANDLE findAndRemove(const char* fileName, IBMDB2I_SHARE** share); - - private: - struct NameHandlePair - { - char name[FN_REFLEN]; - FILE_HANDLE handle; - IBMDB2I_SHARE* share; - NameHandlePair* next; - }* head; - } pendingLockedHandles; - - -#ifndef DBUG_OFF - bool cachedStateIsCoherent() - { - return (current_thd->thread_id == cachedConnectionID); - } - - friend void db2i_ileBridge::unregisterPtr(ILEMemHandle); - friend void db2i_ileBridge::registerPtr(const void*, ILEMemHandle*); - static uint32 registeredPtrs; -#endif -}; - - - -#endif diff --git a/storage/ibmdb2i/db2i_ioBuffers.cc b/storage/ibmdb2i/db2i_ioBuffers.cc deleted file mode 100644 index 9525a6e34b5..00000000000 --- a/storage/ibmdb2i/db2i_ioBuffers.cc +++ /dev/null @@ -1,332 +0,0 @@ -/* -Licensed Materials - Property of IBM -DB2 Storage Engine Enablement -Copyright IBM Corporation 2007,2008 -All rights reserved - -Redistribution and use in source and binary forms, with or without modification, -are permitted provided that the following conditions are met: - (a) Redistributions of source code must retain this list of conditions, the - copyright notice in section {d} below, and the disclaimer following this - list of conditions. - (b) Redistributions in binary form must reproduce this list of conditions, the - copyright notice in section (d) below, and the disclaimer following this - list of conditions, in the documentation and/or other materials provided - with the distribution. - (c) The name of IBM may not be used to endorse or promote products derived from - this software without specific prior written permission. - (d) The text of the required copyright notice is: - Licensed Materials - Property of IBM - DB2 Storage Engine Enablement - Copyright IBM Corporation 2007,2008 - All rights reserved - -THIS SOFTWARE IS PROVIDED BY IBM CORPORATION "AS IS" AND ANY EXPRESS OR IMPLIED -WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF -MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT -SHALL IBM CORPORATION BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, -EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT -OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS -INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN -CONTRACT, STRICT LIABILITY, OR TORT INCLUDING NEGLIGENCE OR OTHERWISE) ARISING -IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY -OF SUCH DAMAGE. -*/ - - -#include "db2i_ioBuffers.h" - -/** - Request another block of rows - - Request the next set of rows from DB2. This must only be called after - newReadRequest(). - - @param orientation The direction to use when reading through the table. -*/ -void IOAsyncReadBuffer::loadNewRows(char orientation) -{ - rewind(); - maxRows() = rowsToBlock; - - DBUG_PRINT("db2i_ioBuffers::loadNewRows", ("Requesting %d rows, async = %d", rowsToBlock, readIsAsync)); - - rc = getBridge()->expectErrors(QMY_ERR_END_OF_BLOCK, QMY_ERR_LOB_SPACE_TOO_SMALL) - ->read(file, - ptr(), - accessIntent, - commitLevel, - orientation, - readIsAsync, - rrnList, - 0, - 0, - 0); - - DBUG_PRINT("db2i_ioBuffers::loadNewRows", ("recordsRead: %d, rc: %d", (uint32)rowCount(), rc)); - - - *releaseRowNeeded = true; - - if (rc == QMY_ERR_END_OF_BLOCK) - { - // This is really just an informational error, so we ignore it. - rc = 0; - DBUG_PRINT("db2i_ioBuffers::loadNewRows", ("End of block signalled")); - } - else if (rc == QMY_ERR_END_OF_FILE) - { - // If we reach EOF or end-of-key, DB2 guarantees that no rows will be locked. - rc = HA_ERR_END_OF_FILE; - *releaseRowNeeded = false; - } - else if (rc == QMY_ERR_KEY_NOT_FOUND) - { - rc = HA_ERR_KEY_NOT_FOUND; - *releaseRowNeeded = false; - } - - if (rc) closePipe(); -} - - -/** - Empty the message pipe to prepare for another read. -*/ -void IOAsyncReadBuffer::drainPipe() -{ - DBUG_ASSERT(pipeState == PendingFullBufferMsg); - PipeRpy_t msg[32]; - int bytes; - PipeRpy_t* lastMsg; - while ((bytes = read(msgPipe, msg, sizeof(msg))) > 0) - { - DBUG_PRINT("db2i_ioBuffers::drainPipe",("Pipe returned %d bytes", bytes)); - lastMsg = &msg[bytes / (sizeof(msg[0]))-1]; - if (lastMsg->CumRowCnt == maxRows() || - lastMsg->RtnCod != 0) - { - pipeState = ConsumedFullBufferMsg; - break; - } - - } - DBUG_PRINT("db2i_ioBuffers::drainPipe",("rc = %d, rows = %d, max = %d", lastMsg->RtnCod, lastMsg->CumRowCnt, (uint32)maxRows())); -} - - -/** - Poll the message pipe for async read messages - - Only valid in async - - @param orientation The direction to use when reading through the table. -*/ -void IOAsyncReadBuffer::pollNextRow(char orientation) -{ - DBUG_ASSERT(readIsAsync); - - // Handle the case in which the buffer is full. - if (rowCount() == maxRows()) - { - // If we haven't read to the end, exit here. - if (readCursor < rowCount()) - return; - - if (pipeState == PendingFullBufferMsg) - drainPipe(); - if (pipeState == ConsumedFullBufferMsg) - loadNewRows(orientation); - } - - if (!rc) - { - PipeRpy_t* lastMsg = NULL; - while (true) - { - PipeRpy_t msg[32]; - int bytes = read(msgPipe, msg, sizeof(msg)); - DBUG_PRINT("db2i_ioBuffers::pollNextRow",("Pipe returned %d bytes", bytes)); - - if (unlikely(bytes < 0)) - { - DBUG_PRINT("db2i_ioBuffers::pollNextRow", ("Error")); - rc = errno; - break; - } - else if (bytes == 0) - break; - - DBUG_ASSERT(bytes % sizeof(msg[0]) == 0); - lastMsg = &msg[bytes / (sizeof(msg[0]))-1]; - - if (lastMsg->RtnCod || (lastMsg->CumRowCnt == usedRows())) - { - rc = lastMsg->RtnCod; - break; - } - } - - *releaseRowNeeded = true; - - if (rc == QMY_ERR_END_OF_BLOCK) - rc = 0; - else if (rc == QMY_ERR_END_OF_FILE) - { - // If we reach EOF or end-of-key, DB2 guarantees that no rows will be locked. - rc = HA_ERR_END_OF_FILE; - *releaseRowNeeded = false; - } - else if (rc == QMY_ERR_KEY_NOT_FOUND) - { - rc = HA_ERR_KEY_NOT_FOUND; - *releaseRowNeeded = false; - } - - if (lastMsg) - DBUG_PRINT("db2i_ioBuffers::pollNextRow", ("Good data: rc=%d; rows=%d; usedRows=%d", lastMsg->RtnCod, lastMsg->CumRowCnt, (uint32)usedRows())); - if (lastMsg && likely(!rc)) - { - if (lastMsg->CumRowCnt < maxRows()) - pipeState = PendingFullBufferMsg; - else - pipeState = ConsumedFullBufferMsg; - - DBUG_ASSERT(lastMsg->CumRowCnt <= usedRows()); - - } - DBUG_ASSERT(rowCount() <= getRowCapacity()); - } - DBUG_PRINT("db2i_ioBuffers::pollNextRow", ("filledRows: %d, rc: %d", rowCount(), rc)); - if (rc) closePipe(); -} - - -/** - Prepare for the destruction of the row buffer storage. -*/ -void IOAsyncReadBuffer::prepForFree() -{ - interruptRead(); - rewind(); - IORowBuffer::prepForFree(); -} - - -/** - Initialize the newly allocated storage. - - @param sizeChanged Indicates whether the storage capacity is being changed. -*/ -void IOAsyncReadBuffer::initAfterAllocate(bool sizeChanged) -{ - rewind(); - - if (sizeChanged || ((void*)rrnList == NULL)) - rrnList.realloc(getRowCapacity() * sizeof(uint32)); -} - - -/** - Send an initial read request - - @param infile The file (table/index) being read from - @param orientation The orientation to use for this read request - @param rowsToBuffer The number of rows to request each time - @param useAsync Whether reads should be performed asynchronously. - @param key The key to use (if any) - @param keyLength The length of key (if any) - @param keyParts The number of columns in the key (if any) - -*/ -void IOAsyncReadBuffer::newReadRequest(FILE_HANDLE infile, - char orientation, - uint32 rowsToBuffer, - bool useAsync, - ILEMemHandle key, - int keyLength, - int keyParts) -{ - DBUG_ENTER("db2i_ioBuffers::newReadRequest"); - DBUG_ASSERT(rowsToBuffer <= getRowCapacity()); -#ifndef DBUG_OFF - if (readCursor < rowCount()) - DBUG_PRINT("PERF:",("Wasting %d buffered rows!\n", rowCount() - readCursor)); -#endif - - int fildes[2]; - int ileDescriptor = QMY_REUSE; - - interruptRead(); - - if (likely(useAsync)) - { - if (rowsToBuffer == 1) - { - // Async provides little or no benefit for single row reads, so we turn it off - DBUG_PRINT("db2i_ioBuffers::newReadRequest", ("Disabling async")); - useAsync = false; - } - else - { - rc = pipe(fildes); - if (rc) DBUG_VOID_RETURN; - - // Translate the pipe write descriptor into the equivalent ILE descriptor - rc = fstatx(fildes[1], (struct stat*)&ileDescriptor, sizeof(ileDescriptor), STX_XPFFD_PASE); - if (rc) - { - close(fildes[0]); - close(fildes[1]); - DBUG_VOID_RETURN; - } - pipeState = Untouched; - msgPipe = fildes[0]; - - DBUG_PRINT("db2i_ioBuffers::newReadRequest", ("Opened pipe %d", fildes[0])); - } - } - - file = infile; - readIsAsync = useAsync; - rowsToBlock = rowsToBuffer; - - rewind(); - maxRows() = 1; - rc = getBridge()->expectErrors(QMY_ERR_END_OF_BLOCK, QMY_ERR_LOB_SPACE_TOO_SMALL) - ->read(file, - ptr(), - accessIntent, - commitLevel, - orientation, - useAsync, - rrnList, - key, - keyLength, - keyParts, - ileDescriptor); - - // Having shared the pipe with ILE, we relinquish our claim on the write end - // of the pipe. - if (useAsync) - close(fildes[1]); - - // If we reach EOF or end-of-key, DB2 guarantees that no rows will be locked. - if (rc == QMY_ERR_END_OF_FILE) - { - rc = HA_ERR_END_OF_FILE; - *releaseRowNeeded = false; - } - else if (rc == QMY_ERR_KEY_NOT_FOUND) - { - if (rowCount()) - rc = HA_ERR_END_OF_FILE; - else - rc = HA_ERR_KEY_NOT_FOUND; - *releaseRowNeeded = false; - } - else - *releaseRowNeeded = true; - - DBUG_VOID_RETURN; -} diff --git a/storage/ibmdb2i/db2i_ioBuffers.h b/storage/ibmdb2i/db2i_ioBuffers.h deleted file mode 100644 index 350d854f055..00000000000 --- a/storage/ibmdb2i/db2i_ioBuffers.h +++ /dev/null @@ -1,416 +0,0 @@ -/* -Licensed Materials - Property of IBM -DB2 Storage Engine Enablement -Copyright IBM Corporation 2007,2008 -All rights reserved - -Redistribution and use in source and binary forms, with or without modification, -are permitted provided that the following conditions are met: - (a) Redistributions of source code must retain this list of conditions, the - copyright notice in section {d} below, and the disclaimer following this - list of conditions. - (b) Redistributions in binary form must reproduce this list of conditions, the - copyright notice in section (d) below, and the disclaimer following this - list of conditions, in the documentation and/or other materials provided - with the distribution. - (c) The name of IBM may not be used to endorse or promote products derived from - this software without specific prior written permission. - (d) The text of the required copyright notice is: - Licensed Materials - Property of IBM - DB2 Storage Engine Enablement - Copyright IBM Corporation 2007,2008 - All rights reserved - -THIS SOFTWARE IS PROVIDED BY IBM CORPORATION "AS IS" AND ANY EXPRESS OR IMPLIED -WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF -MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT -SHALL IBM CORPORATION BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, -EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT -OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS -INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN -CONTRACT, STRICT LIABILITY, OR TORT INCLUDING NEGLIGENCE OR OTHERWISE) ARISING -IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY -OF SUCH DAMAGE. -*/ - - -/** - @file db2i_ioBuffers.h - - @brief Buffer classes used for interacting with QMYSE read/write buffers. - -*/ - - -#include "db2i_validatedPointer.h" -#include "mysql_priv.h" -#include -#include -#include - -// Needed for compilers which do not include fstatx in standard headers. -extern "C" int fstatx(int, struct stat *, int, int); - -/** - Basic row buffer - - Provides the basic structure and methods needed for communicating - with QMYSE I/O APIs. - - @details All QMYSE I/O apis use a buffer that is structured as two integer - row counts (max and used) and storage for some number of rows. The row counts - are both input and output for the API, and their usage depends on the - particular API invoked. This class encapsulates that buffer definition. -*/ -class IORowBuffer -{ - public: - IORowBuffer() : allocSize(0), rowLength(0) {;} - ~IORowBuffer() { freeBuf(); } - ValidatedPointer& ptr() { return data; } - - /** - Sets up the buffer to hold the size indicated. - - @param rowLen length of the rows that will be stored in this buffer - @param nullMapOffset position of null map within each row - @param size buffer size requested - */ - void allocBuf(uint32 rowLen, uint16 nullMapOffset, uint32 size) - { - nullOffset = nullMapOffset; - uint32 newSize = size + sizeof(BufferHdr_t); - // If the internal structure of the row is changing, we need to - // remember this and notify the subclasses via initAfterAllocate(); - bool formatChanged = ((size/rowLen) != rowCapacity); - - if (newSize > allocSize) - { - this->freeBuf(); - data.alloc(newSize); - if (likely((void*)data)) - allocSize = newSize; - } - - if (likely((void*)data)) - { - DBUG_ASSERT((uint64)(void*)data % 16 == 0); - rowLength = rowLen; - rowCapacity = size / rowLength; - initAfterAllocate(formatChanged); - } - else - { - allocSize = 0; - rowCapacity = 0; - } - - DBUG_PRINT("db2i_ioBuffers::allocBuf",("rowCapacity = %d", rowCapacity)); - } - - void zeroBuf() - { - memset(data, 0, allocSize); - } - - void freeBuf() - { - if (likely(allocSize)) - { - prepForFree(); - DBUG_PRINT("IORowBuffer::freeBuf",("Freeing 0x%p", (char*)data)); - data.dealloc(); - } - } - - char* getRowN(uint32 n) - { - if (unlikely(n >= getRowCapacity())) - return NULL; - return (char*)data + sizeof(BufferHdr_t) + (rowLength * n); - }; - - uint32 getRowCapacity() const {return rowCapacity;} - uint32 getRowNullOffset() const {return nullOffset;} - uint32 getRowLength() const {return rowLength;} - - protected: - /** - Called prior to freeing buffer storage so that subclasses can do - any required cleanup - */ - virtual void prepForFree() - { - allocSize = 0; - rowCapacity = 0; - } - - /** - Called after buffer storage so that subclasses can do any required setup. - */ - virtual void initAfterAllocate(bool sizeChanged) { return;} - - ValidatedPointer data; - uint32 allocSize; - uint32 rowCapacity; - uint32 rowLength; - uint16 nullOffset; - uint32& usedRows() const { return ((BufferHdr_t*)(char*)data)->UsedRowCnt; } - uint32& maxRows() const {return ((BufferHdr_t*)(char*)data)->MaxRowCnt; } -}; - - -/** - Write buffer - - Implements methods for inserting data into a row buffer for use with the - QMY_WRITE and QMY_UPDATE APIs. - - @details The max row count defines how many rows are in the buffer. The used - row count is updated by QMYSE to indicate how many rows have been - successfully written. -*/ -class IOWriteBuffer : public IORowBuffer -{ - public: - bool endOfBuffer() const {return (maxRows() == getRowCapacity());} - - char* addRow() - { - return getRowN(maxRows()++); - } - - void resetAfterWrite() - { - maxRows() = 0; - } - - void deleteRow() - { - --maxRows(); - } - - uint32 rowCount() const {return maxRows();} - - uint32 rowsWritten() const {return usedRows()-1;} - - private: - void initAfterAllocate(bool sizeChanged) {maxRows() = 0; usedRows() = 0;} -}; - - -/** - Read buffer - - Implements methods for reading data from and managing a row buffer for use - with the QMY_READ APIs. This is primarily for use with metainformation queries. -*/ -class IOReadBuffer : public IORowBuffer -{ - public: - - IOReadBuffer() {;} - IOReadBuffer(uint32 rows, uint32 rowLength) - { - allocBuf(rows, 0, rows * rowLength); - maxRows() = rows; - } - - uint32 rowCount() {return usedRows();} - void setRowsToProcess(uint32 rows) { maxRows() = rows; } -}; - - -/** - Read buffer - - Implements methods for reading data from and managing a row buffer for use - with the QMY_READ APIs. - - @details This class supports both sync and async read modes. The max row - count defines the number of rows that are requested to be read. The used row - count defines how many rows have been read. Sync mode is reasonably - straightforward, but async mode has a complex system of communicating with - QMYSE that is optimized for low latency. In async mode, the used row count is - updated continuously by QMYSE as rows are read. At the same time, messages are - sent to the associated pipe indicating that a row has been read. As long as - the internal read cursor lags behind the used row count, the pipe is never - consulted. But if the internal read cursor "catches up to" the used row count, - then we block on the pipe until we find a message indicating that a new row - has been read or that an error has occurred. -*/ -class IOAsyncReadBuffer : public IOReadBuffer -{ - public: - IOAsyncReadBuffer() : - file(0), readIsAsync(false), msgPipe(QMY_REUSE), bridge(NULL) - { - } - - ~IOAsyncReadBuffer() - { - interruptRead(); - rrnList.dealloc(); - } - - - /** - Signal read operation complete - - Indicates that the storage engine requires no more data from the table. - Must be called between calls to newReadRequest(). - */ - void endRead() - { -#ifndef DBUG_OFF - if (readCursor < rowCount()) - DBUG_PRINT("PERF:",("Wasting %d buffered rows!\n", rowCount() - readCursor)); -#endif - interruptRead(); - - file = 0; - bridge = NULL; - } - - /** - Update data that may change on each read operation - */ - void update(char newAccessIntent, - bool* newReleaseRowNeeded, - char commitLvl) - { - accessIntent = newAccessIntent; - releaseRowNeeded = newReleaseRowNeeded; - commitLevel = commitLvl; - } - - /** - Read the next row in the table. - - Return a pointer to the next row in the table, where "next" is defined - by the orientation. - - @param orientaton - @param[out] rrn The relative record number of the row returned. Not reliable - if NULL is returned by this function. - - @return Pointer to the row. Null if no more rows are available or an error - occurred. - */ - char* readNextRow(char orientation, uint32& rrn) - { - DBUG_PRINT("db2i_ioBuffers::readNextRow", ("readCursor: %d, filledRows: %d, rc: %d", readCursor, rowCount(), rc)); - - while (readCursor >= rowCount() && !rc) - { - if (!readIsAsync) - loadNewRows(orientation); - else - pollNextRow(orientation); - } - - if (readCursor >= rowCount()) - return NULL; - - rrn = rrnList[readCursor]; - return getRowN(readCursor++); - } - - /** - Retrieve the return code generated by the last operation. - - @return The return code, translated to the appropriate HA_ERR_* - value if possible. - */ - int32 lastrc() - { - return db2i_ileBridge::translateErrorCode(rc); - } - - void rewind() - { - readCursor = 0; - rc = 0; - usedRows() = 0; - } - - bool reachedEOD() { return EOD; } - - void newReadRequest(FILE_HANDLE infile, - char orientation, - uint32 rowsToBuffer, - bool useAsync, - ILEMemHandle key, - int keyLength, - int keyParts); - - private: - - /** - End any running async read operation. - */ - void interruptRead() - { - closePipe(); - if (file && readIsAsync && (rc == 0) && (rowCount() < getRowCapacity())) - { - DBUG_PRINT("IOReadBuffer::interruptRead", ("PERF: Interrupting %d", (uint32)file)); - getBridge()->readInterrupt(file); - } - } - - void closePipe() - { - if (msgPipe != QMY_REUSE) - { - DBUG_PRINT("db2i_ioBuffers::closePipe", ("Closing pipe %d", msgPipe)); - close(msgPipe); - msgPipe = QMY_REUSE; - } - } - - /** - Get a pointer to the active ILE bridge. - - Getting the bridge pointer is (relatively) expensive, so we cache - it off for each operation. - */ - db2i_ileBridge* getBridge() - { - if (unlikely(bridge == NULL)) - { - bridge = db2i_ileBridge::getBridgeForThread(); - } - return bridge; - } - - void drainPipe(); - void pollNextRow(char orientation); - void prepForFree(); - void initAfterAllocate(bool sizeChanged); - void loadNewRows(char orientation); - - - uint32 readCursor; // Read position within buffer - int32 rc; // Last return code received - ValidatedPointer rrnList; // Receiver for list of rrns - char accessIntent; // The access intent for this read - char commitLevel; // What isolation level should be used - char EOD; // Whether end-of-data was hit - char readIsAsync; // Are reads to be done asynchronously? - bool* releaseRowNeeded; - /* Does the caller need to release the current row when finished reading */ - FILE_HANDLE file; // The file to be read - int msgPipe; - /* The read descriptor of the pipe used to pass messages during async reads */ - db2i_ileBridge* bridge; // Cached pointer to bridge - uint32 rowsToBlock; // Number of rows to request - enum - { - ConsumedFullBufferMsg, - PendingFullBufferMsg, - Untouched - } pipeState; - /* The state of the async read message pipe */ -}; - diff --git a/storage/ibmdb2i/db2i_misc.h b/storage/ibmdb2i/db2i_misc.h deleted file mode 100644 index f0b527aaad0..00000000000 --- a/storage/ibmdb2i/db2i_misc.h +++ /dev/null @@ -1,129 +0,0 @@ -/* -Licensed Materials - Property of IBM -DB2 Storage Engine Enablement -Copyright IBM Corporation 2007,2008 -All rights reserved - -Redistribution and use in source and binary forms, with or without modification, -are permitted provided that the following conditions are met: - (a) Redistributions of source code must retain this list of conditions, the - copyright notice in section {d} below, and the disclaimer following this - list of conditions. - (b) Redistributions in binary form must reproduce this list of conditions, the - copyright notice in section (d) below, and the disclaimer following this - list of conditions, in the documentation and/or other materials provided - with the distribution. - (c) The name of IBM may not be used to endorse or promote products derived from - this software without specific prior written permission. - (d) The text of the required copyright notice is: - Licensed Materials - Property of IBM - DB2 Storage Engine Enablement - Copyright IBM Corporation 2007,2008 - All rights reserved - -THIS SOFTWARE IS PROVIDED BY IBM CORPORATION "AS IS" AND ANY EXPRESS OR IMPLIED -WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF -MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT -SHALL IBM CORPORATION BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, -EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT -OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS -INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN -CONTRACT, STRICT LIABILITY, OR TORT INCLUDING NEGLIGENCE OR OTHERWISE) ARISING -IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY -OF SUCH DAMAGE. -*/ - -#ifndef DB2I_MISC_H -#define DB2I_MISC_H - -/** - Undelimit quote-delimited DB2 names in-place -*/ -void stripExtraQuotes(char* name, uint maxLen) -{ - char* oldName = (char*)sql_strdup(name); - uint i = 0; - uint j = 0; - do - { - name[j] = oldName[i]; - if (oldName[i] == '"' && oldName[i+1] == '"') - ++i; - } while (++j < maxLen && oldName[++i]); - - if (j == maxLen) - --j; - name[j] = 0; -} - -/** - Convert a MySQL identifier name into a DB2 compatible format - - @parm input The MySQL name - @parm output The DB2 name - @parm outlen The amount of space allocated for output - @parm delimit Should delimiting quotes be placed around the converted name? - @parm delimitQuotes Should quotes in the MySQL be delimited with additional quotes? - - @return FALSE if output was too small and name was truncated; TRUE otherwise -*/ -bool convertMySQLNameToDB2Name(const char* input, - char* output, - size_t outlen, - bool delimit = true, - bool delimitQuotes = true) -{ - uint o = 0; - if (delimit) - output[o++] = '"'; - - uint i = 0; - do - { - output[o] = input[i]; - if (delimitQuotes && input[i] == '"') - output[++o] = '"'; - } while (++o < outlen-2 && input[++i]); - - if (delimit) - output[o++] = '"'; - output[min(o, outlen-1)] = 0; // This isn't the most user-friendly way to handle overflows, - // but at least its safe. - return (o <= outlen-1); -} - -bool isOrdinaryIdentifier(const char* s) -{ - while (*s) - { - if (my_isupper(system_charset_info, *s) || - my_isdigit(system_charset_info, *s) || - (*s == '_') || - (*s == '@') || - (*s == '$') || - (*s == '#') || - (*s == '"')) - ++s; - else - return false; - } - return true; -} - -/** - Fill memory with a 16-bit word. - - @param p Pointer to space to fill. - @param v Value to fill - @param l Length of space (in 16-bit words) -*/ -void memset16(void* p, uint16 v, size_t l) -{ - uint16* p2=(uint16*)p; - while (l--) - { - *(p2++) = v; - } -} - -#endif diff --git a/storage/ibmdb2i/db2i_myconv.cc b/storage/ibmdb2i/db2i_myconv.cc deleted file mode 100644 index 7be6e1236cd..00000000000 --- a/storage/ibmdb2i/db2i_myconv.cc +++ /dev/null @@ -1,1498 +0,0 @@ -/* -Licensed Materials - Property of IBM -DB2 Storage Engine Enablement -Copyright IBM Corporation 2007,2008 -All rights reserved - -Redistribution and use in source and binary forms, with or without modification, -are permitted provided that the following conditions are met: - (a) Redistributions of source code must retain this list of conditions, the - copyright notice in section {d} below, and the disclaimer following this - list of conditions. - (b) Redistributions in binary form must reproduce this list of conditions, the - copyright notice in section (d) below, and the disclaimer following this - list of conditions, in the documentation and/or other materials provided - with the distribution. - (c) The name of IBM may not be used to endorse or promote products derived from - this software without specific prior written permission. - (d) The text of the required copyright notice is: - Licensed Materials - Property of IBM - DB2 Storage Engine Enablement - Copyright IBM Corporation 2007,2008 - All rights reserved - -THIS SOFTWARE IS PROVIDED BY IBM CORPORATION "AS IS" AND ANY EXPRESS OR IMPLIED -WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF -MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT -SHALL IBM CORPORATION BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, -EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT -OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS -INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN -CONTRACT, STRICT LIABILITY, OR TORT INCLUDING NEGLIGENCE OR OTHERWISE) ARISING -IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY -OF SUCH DAMAGE. -*/ - -/** - @file - - @brief A direct map optimization of iconv and related functions - This was show to significantly reduce character conversion cost - for short strings when compared to calling iconv system code. -*/ - -#include -#include -#include -#include -#include -#include -#include -#include -#include - -#include "db2i_myconv.h" -#include "db2i_global.h" - -int32_t myconvDebug=0; - -static char szGetTimeString[20]; -static char * GetTimeString(time_t now) -{ - struct tm * tm; - - now = time(&now); - tm = (struct tm *) localtime(&now); - sprintf(szGetTimeString, "%04d/%02d/%02d %02d:%02d:%02d", - tm->tm_year + 1900, tm->tm_mon + 1, tm->tm_mday, - tm->tm_hour, tm->tm_min, tm->tm_sec); - - return szGetTimeString; -} - -static MEM_ROOT dmapMemRoot; - -void initMyconv() -{ - init_alloc_root(&dmapMemRoot, 0x200, 0); -} - -void cleanupMyconv() -{ - free_root(&dmapMemRoot,0); -} - - -#ifdef DEBUG -/* type: */ -#define STDOUT_WITH_TIME -1 /* to stdout with time */ -#define STDERR_WITH_TIME -2 /* to stderr with time */ -#define STDOUT_WO_TIME 1 /* : to stdout */ -#define STDERR_WO_TIME 2 /* : to stderr */ - - -static void MyPrintf(long type, - char * fmt, ...) -{ - char StdoutFN[256]; - va_list ap; - char * p; - time_t now; - FILE * fd=stderr; - - if (type < 0) - { - now = time(&now); - fprintf(fd, "%s ", GetTimeString(now)); - } - va_start(ap, fmt); - vfprintf(fd, fmt, ap); - va_end(ap); -} -#endif - - - - -#define MAX_CONVERTER 128 - -mycstoccsid(const char* pname) -{ - if (strcmp(pname, "UTF-16")==0) - return 1200; - else if (strcmp(pname, "big5")==0) - return 950; - else - return cstoccsid(pname); -} -#define cstoccsid mycstoccsid - -static struct __myconv_rec myconv_rec [MAX_CONVERTER]; -static struct __dmap_rec dmap_rec [MAX_CONVERTER]; - -static int dmap_open(const char * to, - const char * from, - const int32_t idx) -{ - if (myconvIsSBCS(from) && myconvIsSBCS(to)) { - dmap_rec[idx].codingSchema = DMAP_S2S; - if ((dmap_rec[idx].dmapS2S = (uchar *) alloc_root(&dmapMemRoot, 0x100)) == NULL) { -#ifdef DEBUG - MyPrintf(STDERR_WITH_TIME, - "dmap_open(%s,%s,%d), CS=%d failed with malloc(), errno = %d in %s at %d\n", - to, from, idx, DMAP_S2S, errno, __FILE__,__LINE__); -#endif - return -1; - } - memset(dmap_rec[idx].dmapS2S, 0x00, 0x100); - myconv_rec[idx].allocatedSize=0x100; - - { - char dmapSrc[0x100]; - iconv_t cd; - int32_t i; - size_t inBytesLeft=0x100; - size_t outBytesLeft=0x100; - size_t len; - char * inBuf=dmapSrc; - char * outBuf=(char *) dmap_rec[idx].dmapS2S; - - if ((cd = iconv_open(to, from)) == (iconv_t) -1) { -#ifdef DEBUG - MyPrintf(STDERR_WITH_TIME, - "dmap_open(%s,%s,%d) failed with iconv_open(), errno = %d in %s at %d\n", - to, from, idx, errno, __FILE__,__LINE__); -#endif - return -1; - } - - inBytesLeft = 0x100; - for (i = 0; i < inBytesLeft; ++i) - dmapSrc[i]=i; - - do { - if ((len = iconv(cd, &inBuf, &inBytesLeft, &outBuf, &outBytesLeft)) != (size_t) 0) { -#ifdef DEBUG - if (myconvDebug) { - MyPrintf(STDERR_WITH_TIME, - "dmap_open(%s,%s,%d), CS=%d: iconv() returns %d, errno = %d in %s at %d\n", - to, from, idx, DMAP_S2S, len, errno, __FILE__,__LINE__); - MyPrintf(STDERR_WITH_TIME, - "inBytesLeft = %d, inBuf - dmapSrc = %d\n", inBytesLeft, inBuf-dmapSrc); - MyPrintf(STDERR_WITH_TIME, - "outBytesLeft = %d, outBuf - dmapS2S = %d\n", outBytesLeft, outBuf-(char *) dmap_rec[idx].dmapS2S); - } - if ((inBytesLeft == 86 || inBytesLeft == 64 || inBytesLeft == 1) && - memcmp(from, "IBM-1256", 9) == 0 && - memcmp(to, "IBM-420", 8) == 0) { - /* Known problem for IBM-1256_IBM-420 */ - --inBytesLeft; - ++inBuf; - *outBuf=0x00; - ++outBuf; - --outBytesLeft; - continue; - } else if ((inBytesLeft == 173 || inBytesLeft == 172 || - inBytesLeft == 74 || inBytesLeft == 73 || - inBytesLeft == 52 || inBytesLeft == 50 || - inBytesLeft == 31 || inBytesLeft == 20 || - inBytesLeft == 6) && - memcmp(to, "IBM-1256", 9) == 0 && - memcmp(from, "IBM-420", 8) == 0) { - /* Known problem for IBM-420_IBM-1256 */ - --inBytesLeft; - ++inBuf; - *outBuf=0x00; - ++outBuf; - --outBytesLeft; - continue; - } else if ((128 >= inBytesLeft) && - memcmp(to, "IBM-037", 8) == 0 && - memcmp(from, "IBM-367", 8) == 0) { - /* Known problem for IBM-367_IBM-037 */ - --inBytesLeft; - ++inBuf; - *outBuf=0x00; - ++outBuf; - --outBytesLeft; - continue; - } else if (((1 <= inBytesLeft && inBytesLeft <= 4) || (97 <= inBytesLeft && inBytesLeft <= 128)) && - memcmp(to, "IBM-838", 8) == 0 && - memcmp(from, "TIS-620", 8) == 0) { - /* Known problem for TIS-620_IBM-838 */ - --inBytesLeft; - ++inBuf; - *outBuf=0x00; - ++outBuf; - --outBytesLeft; - continue; - } - iconv_close(cd); - return -1; -#else - /* Tolerant to undefined conversions for any converter */ - --inBytesLeft; - ++inBuf; - *outBuf=0x00; - ++outBuf; - --outBytesLeft; - continue; -#endif - } - } while (inBytesLeft > 0); - - if (myconvIsISO(to)) - myconv_rec[idx].subS=0x1A; - else if (myconvIsASCII(to)) - myconv_rec[idx].subS=0x7F; - else if (myconvIsEBCDIC(to)) - myconv_rec[idx].subS=0x3F; - - if (myconvIsISO(from)) - myconv_rec[idx].srcSubS=0x1A; - else if (myconvIsASCII(from)) - myconv_rec[idx].srcSubS=0x7F; - else if (myconvIsEBCDIC(from)) - myconv_rec[idx].srcSubS=0x3F; - - iconv_close(cd); - } - } else if (((myconvIsSBCS(from) && myconvIsUnicode2(to)) && (dmap_rec[idx].codingSchema = DMAP_S2U)) || - ((myconvIsSBCS(from) && myconvIsUTF8(to)) && (dmap_rec[idx].codingSchema = DMAP_S28))) { - int i; - - /* single byte mapping */ - if ((dmap_rec[idx].dmapD12U = (UniChar *) alloc_root(&dmapMemRoot, 0x100 * 2)) == NULL) { -#ifdef DEBUG - MyPrintf(STDERR_WITH_TIME, - "dmap_open(%s,%s,%d), CS=%d failed with malloc(), errno = %d in %s at %d\n", - to, from, idx, DMAP_S2U, errno, __FILE__,__LINE__); -#endif - return -1; - } - memset(dmap_rec[idx].dmapD12U, 0x00, 0x100 * 2); - myconv_rec[idx].allocatedSize=0x100 * 2; - - - { - char dmapSrc[2]; - iconv_t cd; - int32_t i; - size_t inBytesLeft; - size_t outBytesLeft; - size_t len; - char * inBuf; - char * outBuf; - char SS=0x1A; -#ifdef support_surrogate - if ((cd = iconv_open("UTF-16", from)) == (iconv_t) -1) { -#else - if ((cd = iconv_open("UCS-2", from)) == (iconv_t) -1) { -#endif -#ifdef DEBUG - MyPrintf(STDERR_WITH_TIME, - "dmap_open(%s,%s,%d) failed with iconv_open(), errno = %d in %s at %d\n", - to, from, idx, errno, __FILE__,__LINE__); -#endif - return -1; - } - - for (i = 0; i < 0x100; ++i) { - dmapSrc[0]=i; - inBuf=dmapSrc; - inBytesLeft=1; - outBuf=(char *) &(dmap_rec[idx].dmapD12U[i]); - outBytesLeft=2; - if ((len = iconv(cd, &inBuf, &inBytesLeft, &outBuf, &outBytesLeft)) != (size_t) 0) { - if ((errno == EILSEQ || errno == EINVAL) && - inBytesLeft == 1 && - outBytesLeft == 2) { - continue; - } else { -#ifdef DEBUG - if (myconvDebug) { - MyPrintf(STDERR_WITH_TIME, - "dmap_open(%s,%s,%d) failed to initialize with iconv(cd,%02x,%d,%02x%02x,%d), errno = %d in %s at %d\n", - to, from, idx, dmapSrc[0], 1, - (&dmap_rec[idx].dmapD12U[i])[0],(&dmap_rec[idx].dmapD12U[i])[1], 2, - errno, __FILE__,__LINE__); - MyPrintf(STDERR_WITH_TIME, - "inBytesLeft=%d, outBytesLeft=%d, %02x%02x\n", - inBytesLeft, outBytesLeft, - (&dmap_rec[idx].dmapD12U[i])[0],(&dmap_rec[idx].dmapD12U[i])[1]); - } -#endif - iconv_close(cd); - return -1; - } - dmap_rec[idx].dmapD12U[i]=0x0000; - } - if (dmap_rec[idx].dmapE02U[i] == 0x001A && /* pick the first one */ - myconv_rec[idx].srcSubS == 0x00) { - myconv_rec[idx].srcSubS=i; - } - } - iconv_close(cd); - } - myconv_rec[idx].subS=0x1A; - myconv_rec[idx].subD=0xFFFD; - - - } else if (((myconvIsUCS2(from) && myconvIsSBCS(to)) && (dmap_rec[idx].codingSchema = DMAP_U2S)) || - ((myconvIsUTF16(from) && myconvIsSBCS(to)) && (dmap_rec[idx].codingSchema = DMAP_T2S)) || - ((myconvIsUTF8(from) && myconvIsSBCS(to)) && (dmap_rec[idx].codingSchema = DMAP_82S))) { - /* UTF-16 -> SBCS, the direct map a bit of waste of space, - * binary search may be reasonable alternative - */ - if ((dmap_rec[idx].dmapU2S = (uchar *) alloc_root(&dmapMemRoot, 0x10000 * 2)) == NULL) { -#ifdef DEBUG - MyPrintf(STDERR_WITH_TIME, - "dmap_open(%s,%s,%d), CS=%d failed with malloc(), errno = %d in %s at %d\n", - to, from, idx, DMAP_U2S, errno, __FILE__,__LINE__); -#endif - return -1; - } - memset(dmap_rec[idx].dmapU2S, 0x00, 0x10000); - myconv_rec[idx].allocatedSize=(0x10000 * 2); - - { - iconv_t cd; - int32_t i; - -#ifdef support_surrogate - if ((cd = iconv_open(to, "UTF-16")) == (iconv_t) -1) { -#else - if ((cd = iconv_open(to, "UCS-2")) == (iconv_t) -1) { -#endif -#ifdef DEBUG - MyPrintf(STDERR_WITH_TIME, - "dmap_open(%s,%s,%d) failed with iconv_open(), errno = %d in %s at %d\n", - to, from, idx, errno, __FILE__,__LINE__); -#endif - return -1; - } - - for (i = 0; i < 0x100; ++i) { - UniChar dmapSrc[0x100]; - int32_t j; - for (j = 0; j < 0x100; ++j) { - dmapSrc[j]=i * 0x100 + j; - } - char * inBuf=(char *) dmapSrc; - char * outBuf=(char *) &(dmap_rec[idx].dmapU2S[i*0x100]); - size_t inBytesLeft=sizeof(dmapSrc); - size_t outBytesLeft=0x100; - size_t len; - - if ((len = iconv(cd, &inBuf, &inBytesLeft, &outBuf, &outBytesLeft)) != (size_t) 0) { - if (inBytesLeft == 0 && outBytesLeft == 0) { /* a number of substitution returns */ - continue; - } -#ifdef DEBUG - if (myconvDebug) { - MyPrintf(STDERR_WITH_TIME, - "dmap_open(%s,%s,%d) failed to initialize with iconv(), errno = %d in %s at %d\n", - from, to, idx, errno, __FILE__,__LINE__); - MyPrintf(STDERR_WITH_TIME, - "iconv() retuns %d, errno=%d, InBytesLeft=%d, OutBytesLeft=%d\n", - len, errno, inBytesLeft, outBytesLeft, __FILE__,__LINE__); - } -#endif - iconv_close(cd); - return -1; - } - } - iconv_close(cd); - - myconv_rec[idx].subS = dmap_rec[idx].dmapU2S[0x1A]; - myconv_rec[idx].subD = dmap_rec[idx].dmapU2S[0xFFFD]; - myconv_rec[idx].srcSubS = 0x1A; - myconv_rec[idx].srcSubD = 0xFFFD; - } - - - - } else if (((myconvIsDBCS(from) && myconvIsUnicode2(to)) && (dmap_rec[idx].codingSchema = DMAP_D2U)) || - ((myconvIsDBCS(from) && myconvIsUTF8(to)) && (dmap_rec[idx].codingSchema = DMAP_D28))) { - int i; - /* single byte mapping */ - if ((dmap_rec[idx].dmapD12U = (UniChar *) alloc_root(&dmapMemRoot, 0x100 * 2)) == NULL) { -#ifdef DEBUG - MyPrintf(STDERR_WITH_TIME, - "dmap_open(%s,%s,%d), CS=%d failed with malloc(), errno = %d in %s at %d\n", - to, from, idx, DMAP_D2U, errno, __FILE__,__LINE__); -#endif - return -1; - } - memset(dmap_rec[idx].dmapD12U, 0x00, 0x100 * 2); - - /* double byte mapping, assume 7 bit ASCII is not use as the first byte of DBCS. */ - if ((dmap_rec[idx].dmapD22U = (UniChar *) alloc_root(&dmapMemRoot, 0x8000 * 2)) == NULL) { -#ifdef DEBUG - MyPrintf(STDERR_WITH_TIME, - "dmap_open(%s,%s,%d), CS=%d failed with malloc(), errno = %d in %s at %d\n", - to, from, idx, DMAP_D2U, errno, __FILE__,__LINE__); -#endif - return -1; - } - memset(dmap_rec[idx].dmapD22U, 0x00, 0x8000 * 2); - - myconv_rec[idx].allocatedSize=(0x100 + 0x8000) * 2; - - - { - char dmapSrc[2]; - iconv_t cd; - int32_t i; - size_t inBytesLeft; - size_t outBytesLeft; - size_t len; - char * inBuf; - char * outBuf; - char SS=0x1A; - -#ifdef support_surrogate - if ((cd = iconv_open("UTF-16", from)) == (iconv_t) -1) { -#else - if ((cd = iconv_open("UCS-2", from)) == (iconv_t) -1) { -#endif -#ifdef DEBUG - MyPrintf(STDERR_WITH_TIME, - "dmap_open(%s,%s,%d) failed with iconv_open(), errno = %d in %s at %d\n", - to, from, idx, errno, __FILE__,__LINE__); -#endif - return -1; - } - - for (i = 0; i < 0x100; ++i) { - dmapSrc[0]=i; - inBuf=dmapSrc; - inBytesLeft=1; - outBuf=(char *) (&dmap_rec[idx].dmapD12U[i]); - outBytesLeft=2; - if ((len = iconv(cd, &inBuf, &inBytesLeft, &outBuf, &outBytesLeft)) != (size_t) 0) { - if ((errno == EILSEQ || errno == EINVAL) && - inBytesLeft == 1 && - outBytesLeft == 2) { - continue; - } else { -#ifdef DEBUG - if (myconvDebug) { - MyPrintf(STDERR_WITH_TIME, - "dmap_open(%s,%s,%d) failed to initialize with iconv(cd,%02x,%d,%02x%02x,%d), errno = %d in %s at %d\n", - to, from, idx, dmapSrc[0], 1, - (&dmap_rec[idx].dmapD12U[i])[0],(&dmap_rec[idx].dmapD12U[i])[1], 2, - errno, __FILE__,__LINE__); - MyPrintf(STDERR_WITH_TIME, - "inBytesLeft=%d, outBytesLeft=%d, %02x%02x\n", - inBytesLeft, outBytesLeft, - (&dmap_rec[idx].dmapD12U[i])[0],(&dmap_rec[idx].dmapD12U[i])[1]); - } -#endif - iconv_close(cd); - return -1; - } - dmap_rec[idx].dmapD12U[i]=0x0000; - } - if (dmap_rec[idx].dmapD12U[i] == 0x001A && /* pick the first one */ - myconv_rec[idx].srcSubS == 0x00) { - myconv_rec[idx].srcSubS=i; - } - } - - - for (i = 0x80; i < 0x100; ++i) { - int j; - if (dmap_rec[idx].dmapD12U[i] != 0x0000) - continue; - for (j = 0x01; j < 0x100; ++j) { - dmapSrc[0]=i; - dmapSrc[1]=j; - int offset = i-0x80; - offset<<=8; - offset+=j; - - inBuf=dmapSrc; - inBytesLeft=2; - outBuf=(char *) &(dmap_rec[idx].dmapD22U[offset]); - outBytesLeft=2; - if ((len = iconv(cd, &inBuf, &inBytesLeft, &outBuf, &outBytesLeft)) != (size_t) 0) { - if (inBytesLeft == 2 && outBytesLeft == 2 && (errno == EILSEQ || errno == EINVAL)) { - ; /* invalid DBCS character, dmapDD2U[offset] remains 0x0000 */ - } else { -#ifdef DEBUG - if (myconvDebug) { - MyPrintf(STDERR_WITH_TIME, - "dmap_open(%s,%s,%d) failed to initialize with iconv(cd,%p,2,%p,2), errno = %d in %s at %d\n", - to, from, idx, - dmapSrc, &(dmap_rec[idx].dmapD22U[offset]), - errno, __FILE__,__LINE__); - MyPrintf(STDERR_WO_TIME, - "iconv(cd,0x%02x%02x,2,0x%04x,2) returns %d, inBytesLeft=%d, outBytesLeft=%d\n", - dmapSrc[0], dmapSrc[1], - dmap_rec[idx].dmapD22U[offset], - len, inBytesLeft, outBytesLeft); - } -#endif - iconv_close(cd); - return -1; - } - } else { -#ifdef TRACE_DMAP - if (myconvDebug) { - MyPrintf(STDERR_WITH_TIME, - "dmap_open(%s,%s,%d) failed to initialize with iconv(), rc=%d, errno=%d in %s at %d\n", - to, from, idx, len, errno, __FILE__,__LINE__); - MyPrintf(STDERR_WITH_TIME, - "%04X: src=%04X%04X, inBuf=0x%02X%02X, inBytesLeft=%d, outBuf=%02X%02X%02X, outBytesLeft=%d\n", - i, dmapSrc[0], dmapSrc[1], inBuf[0], inBuf[1], - inBytesLeft, outBuf[-2], outBuf[-1], outBuf[0], outBytesLeft); - MyPrintf(STDERR_WITH_TIME, - "&dmapSrc=%p, inBuf=%p, %p, outBuf=%p\n", - dmapSrc, inBuf, dmap_rec[idx].dmapU2M3 + (i - 0x80) * 2, outBuf); - } -#endif - } - } - if (dmap_rec[idx].dmapD12U[i] == 0xFFFD) { /* pick the last one */ - myconv_rec[idx].srcSubD=i* 0x100 + j; - } - } - iconv_close(cd); - } - - myconv_rec[idx].subS=0x1A; - myconv_rec[idx].subD=0xFFFD; - myconv_rec[idx].srcSubD=0xFCFC; - - - } else if (((myconvIsUCS2(from) && myconvIsDBCS(to)) && (dmap_rec[idx].codingSchema = DMAP_U2D)) || - ((myconvIsUTF16(from) && myconvIsDBCS(to)) && (dmap_rec[idx].codingSchema = DMAP_T2D)) || - ((myconvIsUTF8(from) && myconvIsDBCS(to)) && (dmap_rec[idx].codingSchema = DMAP_82D))) { - /* UTF-16 -> DBCS single/double byte */ - /* A single table will cover all characters, assuming no second byte is 0x00. */ - if ((dmap_rec[idx].dmapU2D = (uchar *) alloc_root(&dmapMemRoot, 0x10000 * 2)) == NULL) { -#ifdef DEBUG - MyPrintf(STDERR_WITH_TIME, - "dmap_open(%s,%s,%d), CS=%d failed with malloc(), errno = %d in %s at %d\n", - to, from, idx, DMAP_U2D, errno, __FILE__,__LINE__); -#endif - return -1; - } - - memset(dmap_rec[idx].dmapU2D, 0x00, 0x10000 * 2); - myconv_rec[idx].allocatedSize=(0x10000 * 2); - - { - UniChar dmapSrc[1]; - iconv_t cd; - int32_t i; - size_t inBytesLeft; - size_t outBytesLeft; - size_t len; - char * inBuf; - char * outBuf; - -#ifdef support_surrogate - if ((cd = iconv_open(to, "UTF-16")) == (iconv_t) -1) { -#else - if ((cd = iconv_open(to, "UCS-2")) == (iconv_t) -1) { -#endif -#ifdef DEBUG - MyPrintf(STDERR_WITH_TIME, - "dmap_open(%s,%s,%d) failed with iconv_open(), errno = %d in %s at %d\n", - to, from, idx, errno, __FILE__,__LINE__); -#endif - return -1; - } - - /* easy implementation, convert 1 Unicode character at one time. */ - /* If the open performance is an issue, convert a chunk such as 128 chracters. */ - /* if the converted length is not the same as the original, convert one by one. */ - (dmap_rec[idx].dmapU2D)[0x0000]=0x00; - for (i = 1; i < 0x10000; ++i) { - dmapSrc[0]=i; - inBuf=(char *) dmapSrc; - inBytesLeft=2; - outBuf=(char *) &((dmap_rec[idx].dmapU2D)[2*i]); - outBytesLeft=2; - do { - if ((len = iconv(cd, &inBuf, &inBytesLeft, &outBuf, &outBytesLeft)) != (size_t) 0) { - if (len == 1 && inBytesLeft == 0 && outBytesLeft == 1 && (dmap_rec[idx].dmapU2D)[2*i] == 0x1A) { - /* UCS-2_TIS-620:0x0080 => 0x1A, converted to SBCS replacement character */ - (dmap_rec[idx].dmapU2D)[2*i+1]=0x00; - break; - } else if (len == 1 && inBytesLeft == 0 && outBytesLeft == 0) { - break; - } - if (errno == EILSEQ || errno == EINVAL) { -#ifdef DEBUG - if (myconvDebug) { - MyPrintf(STDERR_WITH_TIME, - "dmap_open(%s,%s,%d) failed to initialize with iconv(), errno = %d in %s at %d\n", - to, from, idx, errno, __FILE__,__LINE__); - MyPrintf(STDERR_WO_TIME, - "iconv(cd,%04x,2,%02x%02x,2) returns inBytesLeft=%d, outBytesLeft=%d\n", - dmapSrc[0], - (dmap_rec[idx].dmapU2D)[2*i], (dmap_rec[idx].dmapU2D)[2*i+1], - inBytesLeft, outBytesLeft); - if (outBuf - (char *) dmap_rec[idx].dmapU2M2 > 1) - MyPrintf(STDERR_WO_TIME, "outBuf[-2..2]=%02X%02X%02X%02X%02X\n", outBuf[-2],outBuf[-1],outBuf[0],outBuf[1],outBuf[2]); - else - MyPrintf(STDERR_WO_TIME, "outBuf[0..2]=%02X%02X%02X\n", outBuf[0],outBuf[1],outBuf[2]); - } -#endif - inBuf+=2; - inBytesLeft-=2; - memcpy(outBuf, (char *) &(myconv_rec[idx].subD), 2); - outBuf+=2; - outBytesLeft-=2; - } else { -#ifdef DEBUG - MyPrintf(STDERR_WITH_TIME, - "[%d] dmap_open(%s,%s,%d) failed to initialize with iconv(), errno = %d in %s at %d\n", - i, to, from, idx, errno, __FILE__,__LINE__); - MyPrintf(STDERR_WO_TIME, - "iconv(cd,%04x,2,%02x%02x,2) returns %d inBytesLeft=%d, outBytesLeft=%d\n", - dmapSrc[0], - (dmap_rec[idx].dmapU2D)[2*i], - (dmap_rec[idx].dmapU2D)[2*i+1], - len, inBytesLeft,outBytesLeft); - if (i == 1) { - MyPrintf(STDERR_WO_TIME, - " inBuf [-1..2]=%02x%02x%02x%02x\n", - inBuf[-1],inBuf[0],inBuf[1],inBuf[2]); - MyPrintf(STDERR_WO_TIME, - " outBuf [-1..2]=%02x%02x%02x%02x\n", - outBuf[-1],outBuf[0],outBuf[1],outBuf[2]); - } else { - MyPrintf(STDERR_WO_TIME, - " inBuf [-2..2]=%02x%02x%02x%02x%02x\n", - inBuf[-2],inBuf[-1],inBuf[0],inBuf[1],inBuf[2]); - MyPrintf(STDERR_WO_TIME, - " outBuf [-2..2]=%02x%02x%02x%02x%02x\n", - outBuf[-2],outBuf[-1],outBuf[0],outBuf[1],outBuf[2]); - } -#endif - iconv_close(cd); - return -1; - } - if (len == 0 && inBytesLeft == 0 && outBytesLeft == 1) { /* converted to SBCS */ - (dmap_rec[idx].dmapU2D)[2*i+1]=0x00; - break; - } - } - } while (inBytesLeft > 0); - } - iconv_close(cd); - myconv_rec[idx].subS = dmap_rec[idx].dmapU2D[2*0x1A]; - myconv_rec[idx].subD = dmap_rec[idx].dmapU2D[2*0xFFFD] * 0x100 - + dmap_rec[idx].dmapU2D[2*0xFFFD+1]; - myconv_rec[idx].srcSubS = 0x1A; - myconv_rec[idx].srcSubD = 0xFFFD; - } - - - } else if (((myconvIsEUC(from) && myconvIsUnicode2(to)) && (dmap_rec[idx].codingSchema = DMAP_E2U)) || - ((myconvIsEUC(from) && myconvIsUTF8(to)) && (dmap_rec[idx].codingSchema = DMAP_E28))) { - int i; - /* S0: 0x00 - 0x7F */ - if ((dmap_rec[idx].dmapE02U = (UniChar *) alloc_root(&dmapMemRoot, 0x100 * 2)) == NULL) { -#ifdef DEBUG - MyPrintf(STDERR_WITH_TIME, - "dmap_open(%s,%s,%d), CS=%d failed with malloc(), errno = %d in %s at %d\n", - to, from, idx, DMAP_E2U, errno, __FILE__,__LINE__); -#endif - return -1; - } - memset(dmap_rec[idx].dmapE02U, 0x00, 0x100 * 2); - - /* S1: 0xA0 - 0xFF, 0xA0 - 0xFF */ - if ((dmap_rec[idx].dmapE12U = (UniChar *) alloc_root(&dmapMemRoot, 0x60 * 0x60 * 2)) == NULL) { -#ifdef DEBUG - MyPrintf(STDERR_WITH_TIME, - "dmap_open(%s,%s,%d), CS=%d failed with malloc(), errno = %d in %s at %d\n", - to, from, idx, DMAP_E2U, errno, __FILE__,__LINE__); -#endif - return -1; - } - memset(dmap_rec[idx].dmapE12U, 0x00, 0x60 * 0x60 * 2); - - /* SS2: 0x8E + 0xA0 - 0xFF, 0xA0 - 0xFF */ - if ((dmap_rec[idx].dmapE22U = (UniChar *) alloc_root(&dmapMemRoot, 0x60 * 0x61 * 2)) == NULL) { -#ifdef DEBUG - MyPrintf(STDERR_WITH_TIME, - "dmap_open(%s,%s,%d), CS=%d failed with malloc(), errno = %d in %s at %d\n", - to, from, idx, DMAP_E2U, errno, __FILE__,__LINE__); -#endif - return -1; - } - memset(dmap_rec[idx].dmapE22U, 0x00, 0x60 * 0x61 * 2); - - /* SS3: 0x8F + 0xA0 - 0xFF, 0xA0 - 0xFF */ - if ((dmap_rec[idx].dmapE32U = (UniChar *) alloc_root(&dmapMemRoot, 0x60 * 0x61 * 2)) == NULL) { -#ifdef DEBUG - MyPrintf(STDERR_WITH_TIME, - "dmap_open(%s,%s,%d), CS=%d failed with malloc(), errno = %d in %s at %d\n", - to, from, idx, DMAP_E2U, errno, __FILE__,__LINE__); -#endif - return -1; - } - memset(dmap_rec[idx].dmapE32U, 0x00, 0x60 * 0x61 * 2); - - myconv_rec[idx].allocatedSize=(0x100 + 0x60 * 0x60 + 0x60 * 0x61* 2) * 2; - - - { - char dmapSrc[0x60 * 0x60 * 3]; - iconv_t cd; - int32_t i; - size_t inBytesLeft; - size_t outBytesLeft; - size_t len; - char * inBuf; - char * outBuf; - char SS=0x8E; - -#ifdef support_surrogate - if ((cd = iconv_open("UTF-16", from)) == (iconv_t) -1) { -#else - if ((cd = iconv_open("UCS-2", from)) == (iconv_t) -1) { -#endif -#ifdef DEBUG - MyPrintf(STDERR_WITH_TIME, - "dmap_open(%s,%s,%d) failed with iconv_open(), errno = %d in %s at %d\n", - to, from, idx, errno, __FILE__,__LINE__); -#endif - return -1; - } - - for (i = 0; i < 0x100; ++i) { - dmapSrc[0]=i; - inBuf=dmapSrc; - inBytesLeft=1; - outBuf=(char *) (&dmap_rec[idx].dmapE02U[i]); - outBytesLeft=2; - if ((len = iconv(cd, &inBuf, &inBytesLeft, &outBuf, &outBytesLeft)) != (size_t) 0) { -#ifdef DEBUG - if (myconvDebug) { - MyPrintf(STDERR_WITH_TIME, - "dmap_open(%s,%s,%d) failed to initialize with iconv(), errno = %d in %s at %d\n", - to, from, idx, errno, __FILE__,__LINE__); - } -#endif - dmap_rec[idx].dmapE02U[i]=0x0000; - } - if (dmap_rec[idx].dmapE02U[i] == 0x001A && /* pick the first one */ - myconv_rec[idx].srcSubS == 0x00) { - myconv_rec[idx].srcSubS=i; - } - } - - - inBuf=dmapSrc; - for (i = 0; i < 0x60; ++i) { - int j; - for (j = 0; j < 0x60; ++j) { - *inBuf=i+0xA0; - ++inBuf; - *inBuf=j+0xA0; - ++inBuf; - } - } - inBuf=dmapSrc; - inBytesLeft=0x60 * 0x60 * 2; - outBuf=(char *) dmap_rec[idx].dmapE12U; - outBytesLeft=0x60 * 0x60 * 2; - do { - if ((len = iconv(cd, &inBuf, &inBytesLeft, &outBuf, &outBytesLeft)) != (size_t) 0) { - if (errno == EILSEQ) { -#ifdef DEBUG - if (myconvDebug) { - MyPrintf(STDERR_WITH_TIME, - "dmap_open(%s,%s,%d) failed to initialize with iconv(), errno = %d in %s at %d\n", - to, from, idx, errno, __FILE__,__LINE__); - MyPrintf(STDERR_WO_TIME, "inBytesLeft=%d, outBytesLeft=%d\n", inBytesLeft, outBytesLeft); - if (inBuf - dmapSrc > 1 && inBuf - dmapSrc <= sizeof(dmapSrc) - 2) - MyPrintf(STDERR_WO_TIME, "inBuf[-2..2]=%02X%02X%02X%02X%02X\n", inBuf[-2],inBuf[-1],inBuf[0],inBuf[1],inBuf[2]); - else - MyPrintf(STDERR_WO_TIME, "inBuf[0..2]=%02X%02X%02X\n", inBuf[0],inBuf[1],inBuf[2]); - if (outBuf - (char *) dmap_rec[idx].dmapE12U > 1) - MyPrintf(STDERR_WO_TIME, "outBuf[-2..2]=%02X%02X%02X%02X%02X\n", outBuf[-2],outBuf[-1],outBuf[0],outBuf[1],outBuf[2]); - else - MyPrintf(STDERR_WO_TIME, "outBuf[0..2]=%02X%02X%02X\n", outBuf[0],outBuf[1],outBuf[2]); - } -#endif - inBuf+=2; - inBytesLeft-=2; - outBuf[0]=0x00; - outBuf[1]=0x00; - outBuf+=2; - outBytesLeft-=2; - } else { -#ifdef DEBUG - MyPrintf(STDERR_WITH_TIME, - "dmap_open(%s,%s,%d) failed to initialize with iconv(), errno = %d in %s at %d\n", - to, from, idx, errno, __FILE__,__LINE__); -#endif - iconv_close(cd); - return -1; - } - } - } while (inBytesLeft > 0); - - /* SS2: 0x8E + 1 or 2 bytes */ - /* SS3: 0x8E + 1 or 2 bytes */ - while (SS != 0x00) { - int32_t numSuccess=0; - for (i = 0; i < 0x60; ++i) { - inBuf=dmapSrc; - inBuf[0]=SS; - inBuf[1]=i+0xA0; - inBytesLeft=2; - if (SS == 0x8E) - outBuf=(char *) &(dmap_rec[idx].dmapE22U[i]); - else - outBuf=(char *) &(dmap_rec[idx].dmapE32U[i]); - outBytesLeft=2; - if ((len = iconv(cd, &inBuf, &inBytesLeft, &outBuf, &outBytesLeft)) != (size_t) 0) { - if (SS == 0x8E) - dmap_rec[idx].dmapE22U[i]=0x0000; - else - dmap_rec[idx].dmapE32U[i]=0x0000; - } else { - ++numSuccess; - } - } - if (numSuccess == 0) { /* SS2 is 2 bytes */ - inBuf=dmapSrc; - for (i = 0; i < 0x60; ++i) { - int j; - for (j = 0; j < 0x60; ++j) { - *inBuf=SS; - ++inBuf; - *inBuf=i+0xA0; - ++inBuf; - *inBuf=j+0xA0; - ++inBuf; - } - } - inBuf=dmapSrc; - inBytesLeft=0x60 * 0x60 * 3; - if (SS == 0x8E) - outBuf=(char *) &(dmap_rec[idx].dmapE22U[0x60]); - else - outBuf=(char *) &(dmap_rec[idx].dmapE32U[0x60]); - outBytesLeft=0x60 * 0x60 * 2; - do { - if ((len = iconv(cd, &inBuf, &inBytesLeft, &outBuf, &outBytesLeft)) != (size_t) 0) { -#ifdef DEBUG - if (myconvDebug) { - MyPrintf(STDERR_WITH_TIME, - "%02X:dmap_open(%s,%s,%d) failed to initialize with iconv(), errno = %d in %s at %d\n", - SS, to, from, idx, errno, __FILE__,__LINE__); - MyPrintf(STDERR_WO_TIME, "inBytesLeft=%d, outBytesLeft=%d\n", inBytesLeft, outBytesLeft); - if (inBuf - dmapSrc > 1 && inBuf - dmapSrc <= sizeof(dmapSrc) - 2) - MyPrintf(STDERR_WO_TIME, "inBuf[-2..2]=%02X%02X%02X%02X%02X\n", inBuf[-2],inBuf[-1],inBuf[0],inBuf[1],inBuf[2]); - else - MyPrintf(STDERR_WO_TIME, "inBuf[0..2]=%02X%02X%02X\n", inBuf[0],inBuf[1],inBuf[2]); - } -#endif - if (errno == EILSEQ || errno == EINVAL) { - inBuf+=3; - inBytesLeft-=3; - outBuf[0]=0x00; - outBuf[1]=0x00; - outBuf+=2; - outBytesLeft-=2; - } else { -#ifdef DEBUG - MyPrintf(STDERR_WITH_TIME, - "%02X:dmap_open(%s,%s,%d) failed to initialize with iconv(), errno = %d in %s at %d\n", - SS, to, from, idx, errno, __FILE__,__LINE__); -#endif - iconv_close(cd); - return -1; - } - } - } while (inBytesLeft > 0); - } - if (SS == 0x8E) - SS=0x8F; - else - SS = 0x00; - } - iconv_close(cd); - - myconv_rec[idx].subS=0x1A; - myconv_rec[idx].subD=0xFFFD; - for (i = 0; i < 0x80; ++i) { - if (dmap_rec[idx].dmapE02U[i] == 0x001A) { - myconv_rec[idx].srcSubS=i; /* pick the first one */ - break; - } - } - - for (i = 0; i < 0x60 * 0x60; ++i) { - if (dmap_rec[idx].dmapE12U[i] == 0xFFFD) { - uchar byte1=i / 0x60; - uchar byte2=i % 0x60; - myconv_rec[idx].srcSubD=(byte1 + 0xA0) * 0x100 + (byte2 + 0xA0); /* pick the last one */ - } - } - - } - - } else if (((myconvIsUCS2(from) && myconvIsEUC(to)) && (dmap_rec[idx].codingSchema = DMAP_U2E)) || - ((myconvIsUTF16(from) && myconvIsEUC(to)) && (dmap_rec[idx].codingSchema = DMAP_T2E)) || - ((myconvIsUTF8(from) && myconvIsEUC(to)) && (dmap_rec[idx].codingSchema = DMAP_82E))) { - /* S0: 0x00 - 0xFF */ - if ((dmap_rec[idx].dmapU2S = (uchar *) alloc_root(&dmapMemRoot, 0x100)) == NULL) { -#ifdef DEBUG - MyPrintf(STDERR_WITH_TIME, - "dmap_open(%s,%s,%d), CS=%d failed with malloc(), errno = %d in %s at %d\n", - to, from, idx, DMAP_U2E, errno, __FILE__,__LINE__); -#endif - return -1; - } - memset(dmap_rec[idx].dmapU2S, 0x00, 0x100); - - /* U0080 - UFFFF -> S1: 0xA0 - 0xFF, 0xA0 - 0xFF */ - if ((dmap_rec[idx].dmapU2M2 = (uchar *) alloc_root(&dmapMemRoot, 0xFF80 * 2)) == NULL) { -#ifdef DEBUG - MyPrintf(STDERR_WITH_TIME, - "dmap_open(%s,%s,%d), CS=%d failed with malloc(), errno = %d in %s at %d\n", - to, from, idx, DMAP_U2E, errno, __FILE__,__LINE__); -#endif - return -1; - } - memset(dmap_rec[idx].dmapU2M2, 0x00, 0xFF80 * 2); - - /* U0080 - UFFFF -> SS2: 0x8E + 0xA0 - 0xFF, 0xA0 - 0xFF - * SS3: 0x8F + 0xA0 - 0xFF, 0xA0 - 0xFF */ - if ((dmap_rec[idx].dmapU2M3 = (uchar *) alloc_root(&dmapMemRoot, 0xFF80 * 3)) == NULL) { -#ifdef DEBUG - MyPrintf(STDERR_WITH_TIME, - "dmap_open(%s,%s,%d), CS=%d failed with malloc(), errno = %d in %s at %d\n", - to, from, idx, DMAP_U2E, errno, __FILE__,__LINE__); -#endif - return -1; - } - memset(dmap_rec[idx].dmapU2M3, 0x00, 0xFF80 * 3); - myconv_rec[idx].allocatedSize=(0x100 + 0xFF80 * 2 + 0xFF80 * 3); - - { - UniChar dmapSrc[0x80]; - iconv_t cd; - int32_t i; - size_t inBytesLeft; - size_t outBytesLeft; - size_t len; - char * inBuf; - char * outBuf; - -#ifdef support_surrogate - if ((cd = iconv_open(to, "UTF-16")) == (iconv_t) -1) { -#else - if ((cd = iconv_open(to, "UCS-2")) == (iconv_t) -1) { -#endif -#ifdef DEBUG - MyPrintf(STDERR_WITH_TIME, - "dmap_open(%s,%s,%d) failed with iconv_open(), errno = %d in %s at %d\n", - to, from, idx, errno, __FILE__,__LINE__); -#endif - return -1; - } - - for (i = 0; i < 0x80; ++i) - dmapSrc[i]=i; - inBuf=(char *) dmapSrc; - inBytesLeft=0x80 * 2; - outBuf=(char *) dmap_rec[idx].dmapU2S; - outBytesLeft=0x80; - do { - if ((len = iconv(cd, &inBuf, &inBytesLeft, &outBuf, &outBytesLeft)) != (size_t) 0) { -#ifdef DEBUG - MyPrintf(STDERR_WITH_TIME, - "dmap_open(%s,%s,%d) failed to initialize with iconv(), errno = %d in %s at %d\n", - to, from, idx, errno, __FILE__,__LINE__); -#endif - iconv_close(cd); - return -1; - } - } while (inBytesLeft > 0); - - myconv_rec[idx].srcSubS = 0x1A; - myconv_rec[idx].srcSubD = 0xFFFD; - myconv_rec[idx].subS = dmap_rec[idx].dmapU2S[0x1A]; - - outBuf=(char *) &(myconv_rec[idx].subD); - dmapSrc[0]=0xFFFD; - inBuf=(char *) dmapSrc; - inBytesLeft=2; - outBytesLeft=2; - if ((len = iconv(cd, &inBuf, &inBytesLeft, &outBuf, &outBytesLeft)) != (size_t) 0) { -#ifdef DEBUG - if (myconvDebug) { - MyPrintf(STDERR_WITH_TIME, - "dmap_open(%s,%s,%d) failed to initialize with iconv(), rc=%d, errno=%d in %s at %d\n", - to, from, idx, len, errno, __FILE__,__LINE__); - MyPrintf(STDERR_WO_TIME, "iconv(0x1A,1,%p,1) returns outBuf=%p, outBytesLeft=%d\n", - dmapSrc, outBuf, outBytesLeft); - } -#endif - if (outBytesLeft == 0) { - /* UCS-2_IBM-eucKR returns error. - myconv(iconv) rc=1, error=0, InBytesLeft=0, OutBytesLeft=18 - myconv(iconvRev) rc=-1, error=116, InBytesLeft=2, OutBytesLeft=20 - iconv: 0xFFFD => 0xAFFE => 0x rc=1,-1 sub=0,0 - */ - ; - } else { - iconv_close(cd); - return -1; - } - } - - for (i = 0x80; i < 0xFFFF; ++i) { - uchar eucBuf[3]; - dmapSrc[0]=i; - inBuf=(char *) dmapSrc; - inBytesLeft=2; - outBuf=(char *) eucBuf; - outBytesLeft=sizeof(eucBuf); - errno=0; - if ((len = iconv(cd, &inBuf, &inBytesLeft, &outBuf, &outBytesLeft)) != (size_t) 0) { - if (len == 1 && errno == 0 && inBytesLeft == 0 && outBytesLeft == 1) { /* substitution occurred. */ continue; - } - - if (errno == EILSEQ) { -#ifdef DEBUG - if (myconvDebug) { - MyPrintf(STDERR_WITH_TIME, - "dmap_open(%s,%s,%d) failed to initialize with iconv(), errno = %d in %s at %d\n", - to, from, idx, errno, __FILE__,__LINE__); - MyPrintf(STDERR_WO_TIME, "inBytesLeft=%d, outBytesLeft=%d\n", inBytesLeft, outBytesLeft); - if (inBuf - (char *) dmapSrc > 1 && inBuf - (char *) dmapSrc <= sizeof(dmapSrc) - 2) - MyPrintf(STDERR_WO_TIME, "inBuf[-2..2]=%02X%02X%02X%02X%02X\n", inBuf[-2],inBuf[-1],inBuf[0],inBuf[1],inBuf[2]); - else - MyPrintf(STDERR_WO_TIME, "inBuf[0..2]=%02X%02X%02X\n", inBuf[0],inBuf[1],inBuf[2]); - if (outBuf - (char *) dmap_rec[idx].dmapU2M2 > 1) - MyPrintf(STDERR_WO_TIME, "outBuf[-2..2]=%02X%02X%02X%02X%02X\n", outBuf[-2],outBuf[-1],outBuf[0],outBuf[1],outBuf[2]); - else - MyPrintf(STDERR_WO_TIME, "outBuf[0..2]=%02X%02X%02X\n", outBuf[0],outBuf[1],outBuf[2]); - } -#endif - inBuf+=2; - inBytesLeft-=2; - memcpy(outBuf, (char *) &(myconv_rec[idx].subD), 2); - outBuf+=2; - outBytesLeft-=2; - } else { -#ifdef DEBUG - if (myconvDebug) { - MyPrintf(STDERR_WITH_TIME, - "dmap_open(%s,%s,%d) failed to initialize with iconv(), rc = %d, errno = %d in %s at %d\n", - to, from, idx, len, errno, __FILE__,__LINE__); - MyPrintf(STDERR_WITH_TIME, - "%04X: src=%04X%04X, inBuf=0x%02X%02X, inBytesLeft=%d, outBuf[-2..0]=%02X%02X%02X, outBytesLeft=%d\n", - i, dmapSrc[0], dmapSrc[1], inBuf[0], inBuf[1], - inBytesLeft, outBuf[-2], outBuf[-1], outBuf[0], outBytesLeft); - MyPrintf(STDERR_WITH_TIME, - "&dmapSrc=%p, inBuf=%p, dmapU2M2 + %d = %p, outBuf=%p\n", - dmapSrc, inBuf, (i - 0x80) * 2, dmap_rec[idx].dmapU2M2 + (i - 0x80) * 2, outBuf); - } -#endif - iconv_close(cd); - return -1; - } - } - if (sizeof(eucBuf) - outBytesLeft == 1) { - if (i < 0x100) { - (dmap_rec[idx].dmapU2S)[i]=eucBuf[0]; - } else { - dmap_rec[idx].dmapU2M2[(i - 0x80) * 2] = eucBuf[0]; - dmap_rec[idx].dmapU2M2[(i - 0x80) * 2 + 1] = 0x00; - } - } else if (sizeof(eucBuf) - outBytesLeft == 2) { /* 2 bytes */ - dmap_rec[idx].dmapU2M2[(i - 0x80) * 2] = eucBuf[0]; - dmap_rec[idx].dmapU2M2[(i - 0x80) * 2 + 1] = eucBuf[1]; - } else if (sizeof(eucBuf) - outBytesLeft == 3) { /* 3 byte SS2/SS3 */ - dmap_rec[idx].dmapU2M3[(i - 0x80) * 3] = eucBuf[0]; - dmap_rec[idx].dmapU2M3[(i - 0x80) * 3 + 1] = eucBuf[1]; - dmap_rec[idx].dmapU2M3[(i - 0x80) * 3 + 2] = eucBuf[2]; - } else { -#ifdef DEBUG - if (myconvDebug) { - MyPrintf(STDERR_WITH_TIME, - "dmap_open(%s,%s,%d) failed to initialize with iconv(), rc=%d, errno=%d in %s at %d\n", - to, from, idx, len, errno, __FILE__,__LINE__); - MyPrintf(STDERR_WITH_TIME, - "%04X: src=%04X%04X, inBuf=0x%02X%02X, inBytesLeft=%d, outBuf=%02X%02X%02X, outBytesLeft=%d\n", - i, dmapSrc[0], dmapSrc[1], inBuf[0], inBuf[1], - inBytesLeft, outBuf[-2], outBuf[-1], outBuf[0], outBytesLeft); - MyPrintf(STDERR_WITH_TIME, - "&dmapSrc=%p, inBuf=%p, %p, outBuf=%p\n", - dmapSrc, inBuf, dmap_rec[idx].dmapU2M3 + (i - 0x80) * 2, outBuf); - } -#endif - return -1; - } - - } - iconv_close(cd); - } - - } else if (myconvIsUTF16(from) && myconvIsUTF8(to)) { - dmap_rec[idx].codingSchema = DMAP_T28; - - } else if (myconvIsUCS2(from) && myconvIsUTF8(to)) { - dmap_rec[idx].codingSchema = DMAP_U28; - - } else if (myconvIsUTF8(from) && myconvIsUnicode2(to)) { - dmap_rec[idx].codingSchema = DMAP_82U; - - } else if (myconvIsUnicode2(from) && myconvIsUnicode2(to)) { - dmap_rec[idx].codingSchema = DMAP_U2U; - - } else { - - return -1; - } - myconv_rec[idx].cnv_dmap=&(dmap_rec[idx]); - return 0; -} - - - -static int bins_open(const char * to, - const char * from, - const int32_t idx) -{ - return -1; -} - - - -static int32_t dmap_close(const int32_t idx) -{ - if (dmap_rec[idx].codingSchema == DMAP_S2S) { - if (dmap_rec[idx].dmapS2S != NULL) { - dmap_rec[idx].dmapS2S=NULL; - } - } else if (dmap_rec[idx].codingSchema = DMAP_E2U) { - if (dmap_rec[idx].dmapE02U != NULL) { - dmap_rec[idx].dmapE02U=NULL; - } - if (dmap_rec[idx].dmapE12U != NULL) { - dmap_rec[idx].dmapE12U=NULL; - } - if (dmap_rec[idx].dmapE22U != NULL) { - dmap_rec[idx].dmapE22U=NULL; - } - if (dmap_rec[idx].dmapE32U != NULL) { - dmap_rec[idx].dmapE32U=NULL; - } - } - - return 0; -} - - -static int32_t bins_close(const int32_t idx) -{ - return 0; -} - - -myconv_t myconv_open(const char * toCode, - const char * fromCode, - int32_t converter) -{ - int32 i; - for (i = 0; i < MAX_CONVERTER; ++i) { - if (myconv_rec[i].converterType == 0) - break; - } - if (i >= MAX_CONVERTER) - return ((myconv_t) -1); - - myconv_rec[i].converterType = converter; - myconv_rec[i].index=i; - myconv_rec[i].fromCcsid=cstoccsid(fromCode); - if (myconv_rec[i].fromCcsid == 0 && memcmp(fromCode, "big5",5) == 0) - myconv_rec[i].fromCcsid=950; - myconv_rec[i].toCcsid=cstoccsid(toCode); - if (myconv_rec[i].toCcsid == 0 && memcmp(toCode, "big5",5) == 0) - myconv_rec[i].toCcsid=950; - strncpy(myconv_rec[i].from, fromCode, sizeof(myconv_rec[i].from)-1); - strncpy(myconv_rec[i].to, toCode, sizeof(myconv_rec[i].to)-1); - - if (converter == CONVERTER_ICONV) { - if ((myconv_rec[i].cnv_iconv=iconv_open(toCode, fromCode)) == (iconv_t) -1) { - return ((myconv_t) -1); - } - myconv_rec[i].allocatedSize = -1; - myconv_rec[i].srcSubS=myconvGetSubS(fromCode); - myconv_rec[i].srcSubD=myconvGetSubD(fromCode); - myconv_rec[i].subS=myconvGetSubS(toCode); - myconv_rec[i].subD=myconvGetSubD(toCode); - return &(myconv_rec[i]); - } else if (converter == CONVERTER_DMAP && - dmap_open(toCode, fromCode, i) != -1) { - return &(myconv_rec[i]); - } - return ((myconv_t) -1); -} - - - -int32_t myconv_close(myconv_t cd) -{ - int32_t ret=0; - - if (cd->converterType == CONVERTER_ICONV) { - ret=iconv_close(cd->cnv_iconv); - } else if (cd->converterType == CONVERTER_DMAP) { - ret=dmap_close(cd->index); - } - memset(&(myconv_rec[cd->index]), 0x00, sizeof(myconv_rec[cd->index])); - return ret; -} - - - - -/* reference: http://www-306.ibm.com/software/globalization/other/es.jsp */ -/* systemCL would be expensive, and myconvIsXXXXX is called frequently. - need to cache entries */ -#define MAX_CCSID 256 -static int ccsidList [MAX_CCSID]; -static int esList [MAX_CCSID]; -int32 getEncodingScheme(const uint16 inCcsid, int32& outEncodingScheme); -EXTERN int myconvGetES(CCSID ccsid) -{ - /* call QtqValidateCCSID in ILE to get encoding schema */ - /* return QtqValidateCCSID(ccsid); */ - int i; - for (i = 0; i < MAX_CCSID; ++i) { - if (ccsidList[i] == ccsid) - return esList[i]; - if (ccsidList[i] == 0x00) - break; - } - - if (i >= MAX_CCSID) { - i=MAX_CCSID-1; - } - - { - ccsidList[i]=ccsid; - getEncodingScheme(ccsid, esList[i]); -#ifdef DEBUG_PASE - if (myconvDebug) { - fprintf(stderr, "CCSID=%d, ES=0x%04X\n", ccsid, esList[i]); - } -#endif - return esList[i]; - } - return 0; -} - - -EXTERN int myconvIsEBCDIC(const char * pName) -{ - int es = myconvGetES(cstoccsid(pName)); - if (es == 0x1100 || - es == 0x1200 || - es == 0x6100 || - es == 0x6200 || - es == 0x1301 ) { - return TRUE; - } - return FALSE; -} - - -EXTERN int myconvIsISO(const char * pName) -{ - int es = myconvGetES(cstoccsid(pName)); - if (es == 0x4100 || - es == 0x4105 || - es == 0x4155 || - es == 0x5100 || - es == 0x5150 || - es == 0x5200 || - es == 0x5404 || - es == 0x5409 || - es == 0x540A || - es == 0x5700) { - return TRUE; - } - return FALSE; -} - - -EXTERN int myconvIsASCII(const char * pName) -{ - int es = myconvGetES(cstoccsid(pName)); - if (es == 0x2100 || - es == 0x3100 || - es == 0x8100 || - es == 0x2200 || - es == 0x3200 || - es == 0x9200 || - es == 0x2300 || - es == 0x2305 || - es == 0x3300 || - es == 0x2900 || - es == 0x2A00) { - return TRUE; - } else if (memcmp(pName, "big5", 5) == 0) { - return TRUE; - } - return FALSE; -} - - - -EXTERN int myconvIsUCS2(const char * pName) -{ - if (cstoccsid(pName) == 13488) { - return TRUE; - } - return FALSE; -} - - -EXTERN int myconvIsUTF16(const char * pName) -{ - if (cstoccsid(pName) == 1200) { - return TRUE; - } - return FALSE; -} - - -EXTERN int myconvIsUnicode2(const char * pName) -{ - int es = myconvGetES(cstoccsid(pName)); - if (es == 0x7200 || - es == 0x720B || - es == 0x720F) { - return TRUE; - } - return FALSE; -} - - -EXTERN int myconvIsUTF8(const char * pName) -{ - int es = myconvGetES(cstoccsid(pName)); - if (es == 0x7807) { - return TRUE; - } - return FALSE; -} - - -EXTERN int myconvIsUnicode(const char * pName) -{ - int es = myconvGetES(cstoccsid(pName)); - if (es == 0x7200 || - es == 0x720B || - es == 0x720F || - es == 0x7807) { - return TRUE; - } - return FALSE; -} - - -EXTERN int myconvIsEUC(const char * pName) -{ - int es = myconvGetES(cstoccsid(pName)); - if (es == 0x4403) { - return TRUE; - } - return FALSE; -} - - -EXTERN int myconvIsDBCS(const char * pName) -{ - int es = myconvGetES(cstoccsid(pName)); - if (es == 0x1200 || - es == 0x2200 || - es == 0x2300 || - es == 0x2305 || - es == 0x2A00 || - es == 0x3200 || - es == 0x3300 || - es == 0x5200 || - es == 0x6200 || - es == 0x9200) { - return TRUE; - } else if (memcmp(pName, "big5", 5) == 0) { - return TRUE; - } - return FALSE; -} - - -EXTERN int myconvIsSBCS(const char * pName) -{ - int es = myconvGetES(cstoccsid(pName)); - if (es == 0x1100 || - es == 0x2100 || - es == 0x3100 || - es == 0x4100 || - es == 0x4105 || - es == 0x5100 || - es == 0x5150 || - es == 0x6100 || - es == 0x8100) { - return TRUE; - } - return FALSE; -} - - - -EXTERN char myconvGetSubS(const char * code) -{ - if (myconvIsEBCDIC(code)) { - return 0x3F; - } else if (myconvIsASCII(code)) { - return 0x1A; - } else if (myconvIsISO(code)) { - return 0x1A; - } else if (myconvIsEUC(code)) { - return 0x1A; - } else if (myconvIsUCS2(code)) { - return 0x00; - } else if (myconvIsUTF8(code)) { - return 0x1A; - } - return 0x00; -} - - -EXTERN UniChar myconvGetSubD(const char * code) -{ - if (myconvIsEBCDIC(code)) { - return 0xFDFD; - } else if (myconvIsASCII(code)) { - return 0xFCFC; - } else if (myconvIsISO(code)) { - return 0x00; - } else if (myconvIsEUC(code)) { - return 0x00; - } else if (myconvIsUCS2(code)) { - return 0xFFFD; - } else if (myconvIsUTF8(code)) { - return 0x00; - } - return 0x00; -} - diff --git a/storage/ibmdb2i/db2i_myconv.h b/storage/ibmdb2i/db2i_myconv.h deleted file mode 100644 index 98032748148..00000000000 --- a/storage/ibmdb2i/db2i_myconv.h +++ /dev/null @@ -1,3201 +0,0 @@ -/* -Licensed Materials - Property of IBM -DB2 Storage Engine Enablement -Copyright IBM Corporation 2007,2008 -All rights reserved - -Redistribution and use in source and binary forms, with or without modification, -are permitted provided that the following conditions are met: - (a) Redistributions of source code must retain this list of conditions, the - copyright notice in section {d} below, and the disclaimer following this - list of conditions. - (b) Redistributions in binary form must reproduce this list of conditions, the - copyright notice in section (d) below, and the disclaimer following this - list of conditions, in the documentation and/or other materials provided - with the distribution. - (c) The name of IBM may not be used to endorse or promote products derived from - this software without specific prior written permission. - (d) The text of the required copyright notice is: - Licensed Materials - Property of IBM - DB2 Storage Engine Enablement - Copyright IBM Corporation 2007,2008 - All rights reserved - -THIS SOFTWARE IS PROVIDED BY IBM CORPORATION "AS IS" AND ANY EXPRESS OR IMPLIED -WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF -MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT -SHALL IBM CORPORATION BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, -EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT -OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS -INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN -CONTRACT, STRICT LIABILITY, OR TORT INCLUDING NEGLIGENCE OR OTHERWISE) ARISING -IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY -OF SUCH DAMAGE. -*/ - -/** - @file - - @brief A direct map optimization of iconv and related functions - This was show to significantly reduce character conversion cost - for short strings when compared to calling iconv system code. -*/ - -#ifndef DB2I_MYCONV_H -#define DB2I_MYCONV_H - - -#include -#include -#include -#include -#include -#include -#include -#include -#include -#include - -#ifndef TRUE -#define TRUE 1 -#endif - -#ifndef FALSE -#define FALSE 0 -#endif - -#ifdef __cplusplus -#define INTERN inline -#define EXTERN extern "C" -#else -#define INTERN static -#define EXTERN extern -#endif - - -/* ANSI integer data types */ -#if defined(__OS400_TGTVRM__) -/* for DTAMDL(*P128), datamodel(P128): int/long/pointer=4/4/16 */ -/* LLP64:4/4/8 is used for teraspace ?? */ -typedef short int16_t; -typedef unsigned short uint16_t; -typedef int int32_t; -typedef unsigned int uint32_t; -typedef long long int64_t; -typedef unsigned long long uint64_t; -#elif defined(PASE) -/* PASE uses IPL32: int/long/pointer=4/4/4 + long long */ -#elif defined(__64BIT__) -/* AIX 64 bit uses LP64: int/long/pointer=4/8/8 */ -#endif - -#define CONVERTER_ICONV 1 -#define CONVERTER_DMAP 2 - -#define DMAP_S2S 10 -#define DMAP_S2U 20 -#define DMAP_D2U 30 -#define DMAP_E2U 40 -#define DMAP_U2S 120 -#define DMAP_T2S 125 -#define DMAP_U2D 130 -#define DMAP_T2D 135 -#define DMAP_U2E 140 -#define DMAP_T2E 145 -#define DMAP_S28 220 -#define DMAP_D28 230 -#define DMAP_E28 240 -#define DMAP_82S 310 -#define DMAP_82D 320 -#define DMAP_82E 330 -#define DMAP_U28 410 -#define DMAP_82U 420 -#define DMAP_T28 425 -#define DMAP_U2U 510 - - -typedef struct __dmap_rec *dmap_t; - -struct __dmap_rec -{ - uint32_t codingSchema; - unsigned char * dmapS2S; /* SBCS -> SBCS */ - /* The following conversion needs be followed by conversion from UCS-2/UTF-16 to UTF-8 */ - UniChar * dmapD12U; /* DBCS(non-EUC) -> UCS-2/UTF-16 */ - UniChar * dmapD22U; /* DBCS(non-EUC) -> UCS-2/UTF-16 */ - UniChar * dmapE02U; /* EUC/SS0 -> UCS-2/UTF-16 */ - UniChar * dmapE12U; /* EUC/SS1 -> UCS-2/UTF-16 */ - UniChar * dmapE22U; /* EUC/0x8E + SS2 -> UCS-2/UTF-16 */ - UniChar * dmapE32U; /* EUC/0x8F + SS3 -> UCS-2/UTF-16 */ - uchar * dmapU2D; /* UCS-2 -> DBCS */ - uchar * dmapU2S; /* UCS-2 -> EUC SS0 */ - uchar * dmapU2M2; /* UCS-2 -> EUC SS1 */ - uchar * dmapU2M3; /* UCS-2 -> EUC SS2/SS3 */ - /* All of these pointers/tables are not used at the same time. - * You may be able save some space if you consolidate them. - */ - uchar * dmapS28; /* SBCS -> UTF-8 */ - uchar * dmapD28; /* DBCS -> UTF-8 */ -}; - -typedef struct __myconv_rec *myconv_t; -struct __myconv_rec -{ - uint32_t converterType; - uint32_t index; /* for close */ - union { - iconv_t cnv_iconv; - dmap_t cnv_dmap; - }; - int32_t allocatedSize; - int32_t fromCcsid; - int32_t toCcsid; - UniChar subD; /* DBCS substitution char */ - char subS; /* SBCS substitution char */ - UniChar srcSubD; /* DBCS substitution char of src codepage */ - char srcSubS; /* SBCS substitution char of src codepage */ - char from [41+1]; /* codepage name is up to 41 bytes */ - char to [41+1]; /* codepage name is up to 41 bytes */ -#ifdef __64BIT__ - char reserved[10]; /* align 128 */ -#else - char reserved[14]; /* align 128 */ -#endif -}; - - -EXTERN int32_t myconvDebug; - - - -EXTERN int myconvGetES(CCSID); -EXTERN int myconvIsEBCDIC(const char *); -EXTERN int myconvIsASCII(const char *); -EXTERN int myconvIsUnicode(const char *); /* UTF-8, UTF-16, or UCS-2 */ -EXTERN int myconvIsUnicode2(const char *); /* 2 byte Unicode */ -EXTERN int myconvIsUCS2(const char *); -EXTERN int myconvIsUTF16(const char *); -EXTERN int myconvIsUTF8(const char *); -EXTERN int myconvIsEUC(const char *); -EXTERN int myconvIsISO(const char *); -EXTERN int myconvIsSBCS(const char *); -EXTERN int myconvIsDBCS(const char *); -EXTERN char myconvGetSubS(const char *); -EXTERN UniChar myconvGetSubD(const char *); - - -EXTERN myconv_t myconv_open(const char*, const char*, int32_t); -EXTERN int myconv_close(myconv_t); - -INTERN size_t myconv_iconv(myconv_t cd , - char** inBuf, - size_t* inBytesLeft, - char** outBuf, - size_t* outBytesLeft, - size_t* numSub) -{ - return iconv(cd->cnv_iconv, inBuf, inBytesLeft, outBuf, outBytesLeft); -} - -INTERN size_t myconv_dmap(myconv_t cd, - char** inBuf, - size_t* inBytesLeft, - char** outBuf, - size_t* outBytesLeft, - size_t* numSub) -{ - if (cd->cnv_dmap->codingSchema == DMAP_S2S) { - register unsigned char * dmapS2S=cd->cnv_dmap->dmapS2S; - register int inLen=*inBytesLeft; - register char * pOut=*outBuf; - register char * pIn=*inBuf; - register char * pLastOutBuf = *outBuf + *outBytesLeft - 1; - register char subS=cd->subS; - register size_t numS=0; - while (0 < inLen) { - if (pLastOutBuf < pOut) - break; - if (*pIn == 0x00) { - *pOut=0x00; - } else { - *pOut=dmapS2S[*pIn]; - if (*pOut == 0x00) { - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(*inBytesLeft-inLen); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - *numSub+=numS; - return -1; - } - if (*pOut == subS) { - if ((*pOut=dmapS2S[*pIn]) == subS) { - if (*pIn != cd->srcSubS) - ++numS; - } - } - } - ++pIn; - --inLen; - ++pOut; - } - *outBytesLeft-=(*inBytesLeft-inLen); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - *numSub+=numS; - return 0; - - } else if (cd->cnv_dmap->codingSchema == DMAP_E2U) { - /* use uchar * instead of UniChar to avoid memcpy */ - register uchar * dmapE02U=(uchar *) (cd->cnv_dmap->dmapE02U); - register uchar * dmapE12U=(uchar *) (cd->cnv_dmap->dmapE12U); - register uchar * dmapE22U=(uchar *) (cd->cnv_dmap->dmapE22U); - register uchar * dmapE32U=(uchar *) (cd->cnv_dmap->dmapE32U); - register int inLen=*inBytesLeft; - register char * pOut=*outBuf; - register char * pIn=*inBuf; - register int offset; - register char * pLastOutBuf = *outBuf + *outBytesLeft - 1; - register size_t numS=0; - while (0 < inLen) { - if (pLastOutBuf < pOut) - break; - if (*pIn == 0x00) { - *pOut=0x00; - ++pOut; - *pOut=0x00; - ++pOut; - ++pIn; - --inLen; - } else { - if (*pIn == 0x8E) { /* SS2 */ - if (inLen < 2) { - if (cd->fromCcsid == 33722 || /* IBM-eucJP */ - cd->fromCcsid == 964) /* IBM-eucTW */ - errno=EINVAL; /* 22 */ - else - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - return -1; - } - ++pIn; - if (*pIn < 0xA0) { - if (cd->fromCcsid == 964) /* IBM-eucTW */ - errno=EINVAL; /* 22 */ - else - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn-1; - return -1; - } - offset=(*pIn - 0xA0); - offset<<=1; - if (dmapE22U[offset] == 0x00 && - dmapE22U[offset+1] == 0x00) { /* 2 bytes */ - if (inLen < 3) { - if (cd->fromCcsid == 964) /* IBM-eucTW */ - errno=EINVAL; /* 22 */ - else - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn-1; - return -1; - } - offset=(*pIn - 0xA0) * 0x60 + 0x60; - ++pIn; - if (*pIn < 0xA0) { - if (cd->fromCcsid == 964) /* IBM-eucTW */ - errno=EINVAL; /* 22 */ - else - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn-2; - return -1; - } - offset+=(*pIn - 0xA0); - offset<<=1; - if (dmapE22U[offset] == 0x00 && - dmapE22U[offset+1] == 0x00) { - if (cd->fromCcsid == 964) /* IBM-eucTW */ - errno=EINVAL; /* 22 */ - else - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn-2; - return -1; - } - *pOut=dmapE22U[offset]; - ++pOut; - *pOut=dmapE22U[offset+1]; - ++pOut; - if (dmapE22U[offset] == 0xFF && - dmapE22U[offset+1] == 0xFD) { - if (pIn[-2] * 0x100 + pIn[-1] != cd->srcSubD) - ++numS; - } - ++pIn; - inLen-=3; - } else { /* 1 bytes */ - *pOut=dmapE22U[offset]; - ++pOut; - *pOut=dmapE22U[offset+1]; - ++pOut; - ++pIn; - inLen-=2; - } - } else if (*pIn == 0x8F) { /* SS3 */ - if (inLen < 2) { - if (cd->fromCcsid == 33722) /* IBM-eucJP */ - errno=EINVAL; /* 22 */ - else - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - return -1; - } - ++pIn; - if (*pIn < 0xA0) { - if (cd->fromCcsid == 970 || /* IBM-eucKR */ - cd->fromCcsid == 964 || /* IBM-eucTW */ - cd->fromCcsid == 1383 || /* IBM-eucCN */ - (cd->fromCcsid == 33722 && 3 <= inLen)) /* IBM-eucJP */ - errno=EILSEQ; /* 116 */ - else - errno=EINVAL; /* 22 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn-1; - return -1; - } - offset=(*pIn - 0xA0); - offset<<=1; - if (dmapE32U[offset] == 0x00 && - dmapE32U[offset+1] == 0x00) { /* 0x8F + 2 bytes */ - if (inLen < 3) { - if (cd->fromCcsid == 33722) - errno=EINVAL; /* 22 */ - else - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn-1; - return -1; - } - offset=(*pIn - 0xA0) * 0x60 + 0x60; - ++pIn; - if (*pIn < 0xA0) { - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn-2; - return -1; - } - offset+=(*pIn - 0xA0); - offset<<=1; - if (dmapE32U[offset] == 0x00 && - dmapE32U[offset+1] == 0x00) { - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn-2; - return -1; - } - *pOut=dmapE32U[offset]; - ++pOut; - *pOut=dmapE32U[offset+1]; - ++pOut; - if (dmapE32U[offset] == 0xFF && - dmapE32U[offset+1] == 0xFD) { - if (pIn[-2] * 0x100 + pIn[-1] != cd->srcSubD) - ++numS; - } - ++pIn; - inLen-=3; - } else { /* 0x8F + 1 bytes */ - *pOut=dmapE32U[offset]; - ++pOut; - *pOut=dmapE32U[offset+1]; - ++pOut; - ++pIn; - inLen-=2; - } - - } else { - offset=*pIn; - offset<<=1; - if (dmapE02U[offset] == 0x00 && - dmapE02U[offset+1] == 0x00) { /* SS1 */ - if (inLen < 2) { - if ((cd->fromCcsid == 33722 && (*pIn == 0xA0 || (0xA9 <= *pIn && *pIn <= 0xAF) || *pIn == 0xFF)) || - (cd->fromCcsid == 970 && (*pIn == 0xA0 || *pIn == 0xAD || *pIn == 0xAE || *pIn == 0xAF || *pIn == 0xFF)) || - (cd->fromCcsid == 964 && (*pIn == 0xA0 || (0xAA <= *pIn && *pIn <= 0xC1) || *pIn == 0xC3 || *pIn == 0xFE || *pIn == 0xFF)) || - (cd->fromCcsid == 1383 && (*pIn == 0xA0 || *pIn == 0xFF))) - errno=EILSEQ; /* 116 */ - else - errno=EINVAL; /* 22 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - return -1; - } - if (*pIn < 0xA0) { - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - return -1; - } - offset=(*pIn - 0xA0) * 0x60; - ++pIn; - if (*pIn < 0xA0) { - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn-1; - return -1; - } - offset+=(*pIn - 0xA0); - offset<<=1; - if (dmapE12U[offset] == 0x00 && - dmapE12U[offset+1] == 0x00) { /* undefined mapping */ - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn-1; - return -1; - } - *pOut=dmapE12U[offset]; - ++pOut; - *pOut=dmapE12U[offset+1]; - ++pOut; - if (dmapE12U[offset] == 0xFF && - dmapE12U[offset+1] == 0xFD) { - if (pIn[-1] * 0x100 + pIn[0] != cd->srcSubD) - ++numS; - } - ++pIn; - inLen-=2; - } else { - *pOut=dmapE02U[offset]; - ++pOut; - *pOut=dmapE02U[offset+1]; - ++pOut; - if (dmapE02U[offset] == 0x00 && - dmapE02U[offset+1] == 0x1A) { - if (*pIn != cd->srcSubS) - ++numS; - } - ++pIn; - --inLen; - } - } - } - } - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - *numSub+=numS; - return 0; - - - } else if (cd->cnv_dmap->codingSchema == DMAP_E28) { - /* use uchar * instead of UniChar to avoid memcpy */ - register uchar * dmapE02U=(uchar *) (cd->cnv_dmap->dmapE02U); - register uchar * dmapE12U=(uchar *) (cd->cnv_dmap->dmapE12U); - register uchar * dmapE22U=(uchar *) (cd->cnv_dmap->dmapE22U); - register uchar * dmapE32U=(uchar *) (cd->cnv_dmap->dmapE32U); - register int inLen=*inBytesLeft; - register char * pOut=*outBuf; - register char * pIn=*inBuf; - register int offset; - register char * pLastOutBuf = *outBuf + *outBytesLeft - 1; - register size_t numS=0; - register UniChar in; /* copy part of U28 */ - register UniChar ucs2; - while (0 < inLen) { - if (pLastOutBuf < pOut) - break; - if (*pIn == 0x00) { - *pOut=0x00; - ++pOut; - ++pIn; - --inLen; - } else { - if (*pIn == 0x8E) { /* SS2 */ - if (inLen < 2) { - if (cd->fromCcsid == 33722 || /* IBM-eucJP */ - cd->fromCcsid == 964) /* IBM-eucTW */ - errno=EINVAL; /* 22 */ - else - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - return -1; - } - ++pIn; - if (*pIn < 0xA0) { - if (cd->fromCcsid == 964) /* IBM-eucTW */ - errno=EINVAL; /* 22 */ - else - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn-1; - return -1; - } - offset=(*pIn - 0xA0); - offset<<=1; - if (dmapE22U[offset] == 0x00 && - dmapE22U[offset+1] == 0x00) { /* 2 bytes */ - if (inLen < 3) { - if (cd->fromCcsid == 964) /* IBM-eucTW */ - errno=EINVAL; /* 22 */ - else - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn-1; - return -1; - } - offset=(*pIn - 0xA0) * 0x60 + 0x60; - ++pIn; - if (*pIn < 0xA0) { - if (cd->fromCcsid == 964) /* IBM-eucTW */ - errno=EINVAL; /* 22 */ - else - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn-2; - return -1; - } - offset+=(*pIn - 0xA0); - offset<<=1; - if (dmapE22U[offset] == 0x00 && - dmapE22U[offset+1] == 0x00) { - if (cd->fromCcsid == 964) /* IBM-eucTW */ - errno=EINVAL; /* 22 */ - else - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn-2; - return -1; - } - in=dmapE22U[offset]; - in<<=8; - in+=dmapE22U[offset+1]; - if (dmapE22U[offset] == 0xFF && - dmapE22U[offset+1] == 0xFD) { - if (pIn[-2] * 0x100 + pIn[-1] != cd->srcSubD) - ++numS; - } - ++pIn; - inLen-=3; - } else { /* 1 bytes */ - in=dmapE22U[offset]; - in<<=8; - in+=dmapE22U[offset+1]; - ++pIn; - inLen-=2; - } - } else if (*pIn == 0x8F) { /* SS3 */ - if (inLen < 2) { - if (cd->fromCcsid == 33722) /* IBM-eucJP */ - errno=EINVAL; /* 22 */ - else - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - return -1; - } - ++pIn; - if (*pIn < 0xA0) { - if (cd->fromCcsid == 970 || /* IBM-eucKR */ - cd->fromCcsid == 964 || /* IBM-eucTW */ - cd->fromCcsid == 1383 || /* IBM-eucCN */ - (cd->fromCcsid == 33722 && 3 <= inLen)) /* IBM-eucJP */ - errno=EILSEQ; /* 116 */ - else - errno=EINVAL; /* 22 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn-1; - return -1; - } - offset=(*pIn - 0xA0); - offset<<=1; - if (dmapE32U[offset] == 0x00 && - dmapE32U[offset+1] == 0x00) { /* 0x8F + 2 bytes */ - if (inLen < 3) { - if (cd->fromCcsid == 33722) - errno=EINVAL; /* 22 */ - else - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn-1; - return -1; - } - offset=(*pIn - 0xA0) * 0x60 + 0x60; - ++pIn; - if (*pIn < 0xA0) { - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn-2; - return -1; - } - offset+=(*pIn - 0xA0); - offset<<=1; - if (dmapE32U[offset] == 0x00 && - dmapE32U[offset+1] == 0x00) { - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn-2; - return -1; - } - in=dmapE32U[offset]; - in<<=8; - in+=dmapE32U[offset+1]; - if (dmapE32U[offset] == 0xFF && - dmapE32U[offset+1] == 0xFD) { - if (pIn[-2] * 0x100 + pIn[-1] != cd->srcSubD) - ++numS; - } - ++pIn; - inLen-=3; - } else { /* 0x8F + 1 bytes */ - in=dmapE32U[offset]; - in<<=8; - in+=dmapE32U[offset+1]; - ++pIn; - inLen-=2; - } - - } else { - offset=*pIn; - offset<<=1; - if (dmapE02U[offset] == 0x00 && - dmapE02U[offset+1] == 0x00) { /* SS1 */ - if (inLen < 2) { - if ((cd->fromCcsid == 33722 && (*pIn == 0xA0 || (0xA9 <= *pIn && *pIn <= 0xAF) || *pIn == 0xFF)) || - (cd->fromCcsid == 970 && (*pIn == 0xA0 || *pIn == 0xAD || *pIn == 0xAE || *pIn == 0xAF || *pIn == 0xFF)) || - (cd->fromCcsid == 964 && (*pIn == 0xA0 || (0xAA <= *pIn && *pIn <= 0xC1) || *pIn == 0xC3 || *pIn == 0xFE || *pIn == 0xFF)) || - (cd->fromCcsid == 1383 && (*pIn == 0xA0 || *pIn == 0xFF))) - errno=EILSEQ; /* 116 */ - else - errno=EINVAL; /* 22 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - return -1; - } - if (*pIn < 0xA0) { - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - return -1; - } - offset=(*pIn - 0xA0) * 0x60; - ++pIn; - if (*pIn < 0xA0) { - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn-1; - return -1; - } - offset+=(*pIn - 0xA0); - offset<<=1; - if (dmapE12U[offset] == 0x00 && - dmapE12U[offset+1] == 0x00) { /* undefined mapping */ - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn-1; - return -1; - } - in=dmapE12U[offset]; - in<<=8; - in+=dmapE12U[offset+1]; - if (dmapE12U[offset] == 0xFF && - dmapE12U[offset+1] == 0xFD) { - if (pIn[-1] * 0x100 + pIn[0] != cd->srcSubD) - ++numS; - } - ++pIn; - inLen-=2; - } else { - in=dmapE02U[offset]; - in<<=8; - in+=dmapE02U[offset+1]; - if (dmapE02U[offset] == 0x00 && - dmapE02U[offset+1] == 0x1A) { - if (*pIn != cd->srcSubS) - ++numS; - } - ++pIn; - --inLen; - } - } - ucs2=in; - if ((in & 0xFF80) == 0x0000) { /* U28: in & 0b1111111110000000 == 0x0000 */ - *pOut=in; - ++pOut; - } else if ((in & 0xF800) == 0x0000) { /* in & 0b1111100000000000 == 0x0000 */ - register uchar byte; - in>>=6; - in&=0x001F; /* 0b0000000000011111 */ - in|=0x00C0; /* 0b0000000011000000 */ - *pOut=in; - ++pOut; - byte=ucs2; /* dmapD12U[offset+1]; */ - byte&=0x3F; /* 0b00111111; */ - byte|=0x80; /* 0b10000000; */ - *pOut=byte; - ++pOut; - } else if ((in & 0xFC00) == 0xD800) { - *pOut=0xEF; - ++pOut; - *pOut=0xBF; - ++pOut; - *pOut=0xBD; - ++pOut; - } else { - register uchar byte; - register uchar work; - byte=(ucs2>>8); /* dmapD12U[offset]; */ - byte>>=4; - byte|=0xE0; /* 0b11100000; */ - *pOut=byte; - ++pOut; - - byte=(ucs2>>8); /* dmapD12U[offset]; */ - byte<<=2; - work=ucs2; /* dmapD12U[offset+1]; */ - work>>=6; - byte|=work; - byte&=0x3F; /* 0b00111111; */ - byte|=0x80; /* 0b10000000; */ - *pOut=byte; - ++pOut; - - byte=ucs2; /* dmapD12U[offset+1]; */ - byte&=0x3F; /* 0b00111111; */ - byte|=0x80; /* 0b10000000; */ - *pOut=byte; - ++pOut; - } - /* end of U28 */ - } - } - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - *numSub+=numS; - return 0; - - } else if (cd->cnv_dmap->codingSchema == DMAP_U2E) { - register uchar * dmapU2S=cd->cnv_dmap->dmapU2S; - register uchar * dmapU2M2=cd->cnv_dmap->dmapU2M2 - 0x80 * 2; - register uchar * dmapU2M3=cd->cnv_dmap->dmapU2M3 - 0x80 * 3; - register int inLen=*inBytesLeft; - register char * pOut=*outBuf; - register char * pIn=*inBuf; - register char * pLastOutBuf = *outBuf + *outBytesLeft - 1; - register char subS=cd->subS; - register char * pSubD=(char *) &(cd->subD); - register size_t numS=0; - register size_t rc=0; - while (0 < inLen) { - register uint32_t in; - if (inLen == 1) { - errno=EINVAL; /* 22 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - return -1; - } - if (pLastOutBuf < pOut) - break; - in=pIn[0]; - in<<=8; - in+=pIn[1]; - if (in == 0x0000) { - *pOut=0x00; - ++pOut; - } else if (in < 0x100 && dmapU2S[in] != 0x0000) { - if ((*pOut=dmapU2S[in]) == subS) { - if (in != cd->srcSubS) - ++numS; - } - ++pOut; - } else { - in<<=1; - if (dmapU2M2[in] == 0x00) { /* not found in dmapU2M2 */ - in*=1.5; - if (dmapU2M3[in] == 0x00) { /* not found in dmapU2M3*/ - *pOut=pSubD[0]; - ++pOut; - *pOut=pSubD[1]; - ++pOut; - ++numS; - ++rc; - } else { - *pOut=dmapU2M3[in]; - ++pOut; - *pOut=dmapU2M3[1+in]; - ++pOut; - *pOut=dmapU2M3[2+in]; - ++pOut; - } - } else { - *pOut=dmapU2M2[in]; - ++pOut; - if (dmapU2M2[1+in] == 0x00) { - if (*pOut == subS) { - in>>=1; - if (in != cd->srcSubS) - ++numS; - } - } else { - *pOut=dmapU2M2[1+in]; - ++pOut; - if (memcmp(pOut-2, pSubD, 2) == 0) { - in>>=1; - if (in != cd->srcSubD) { - ++numS; - ++rc; - } - } - } - } - } - pIn+=2; - inLen-=2; - } - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - *numSub+=numS; - return rc; /* compatibility to iconv() */ - - } else if (cd->cnv_dmap->codingSchema == DMAP_T2E) { - register uchar * dmapU2S=cd->cnv_dmap->dmapU2S; - register uchar * dmapU2M2=cd->cnv_dmap->dmapU2M2 - 0x80 * 2; - register uchar * dmapU2M3=cd->cnv_dmap->dmapU2M3 - 0x80 * 3; - register int inLen=*inBytesLeft; - register char * pOut=*outBuf; - register char * pIn=*inBuf; - register char * pLastOutBuf = *outBuf + *outBytesLeft - 1; - register char subS=cd->subS; - register char * pSubD=(char *) &(cd->subD); - register size_t numS=0; - register size_t rc=0; - while (0 < inLen) { - register uint32_t in; - if (inLen == 1) { - errno=EINVAL; /* 22 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen-1; - *outBuf=pOut; - *inBuf=pIn; - ++numS; - *numSub+=numS; - return 0; - } - if (pLastOutBuf < pOut) - break; - in=pIn[0]; - in<<=8; - in+=pIn[1]; - if (in == 0x0000) { - *pOut=0x00; - ++pOut; - } else if (0xD800 <= in && in <= 0xDBFF) { /* first byte of surrogate */ - errno=EINVAL; /* 22 */ - *inBytesLeft=inLen-2; - *outBytesLeft-=(pOut-*outBuf); - *outBuf=pOut; - *inBuf=pIn+2; - ++numS; - *numSub+=numS; - return -1; - - } else if (0xDC00 <= in && in <= 0xDFFF) { /* second byte of surrogate */ - errno=EINVAL; /* 22 */ - *inBytesLeft=inLen-1; - *outBytesLeft-=(pOut-*outBuf); - *outBuf=pOut; - *inBuf=pIn; - ++numS; - *numSub+=numS; - return -1; - - } else if (in < 0x100 && dmapU2S[in] != 0x0000) { - if ((*pOut=dmapU2S[in]) == subS) { - if (in != cd->srcSubS) - ++numS; - } - ++pOut; - } else { - in<<=1; - if (dmapU2M2[in] == 0x00) { /* not found in dmapU2M2 */ - in*=1.5; - if (dmapU2M3[in] == 0x00) { /* not found in dmapU2M3*/ - *pOut=pSubD[0]; - ++pOut; - *pOut=pSubD[1]; - ++pOut; - ++numS; - ++rc; - } else { - *pOut=dmapU2M3[in]; - ++pOut; - *pOut=dmapU2M3[1+in]; - ++pOut; - *pOut=dmapU2M3[2+in]; - ++pOut; - } - } else { - *pOut=dmapU2M2[in]; - ++pOut; - if (dmapU2M2[1+in] == 0x00) { - if (*pOut == subS) { - in>>=1; - if (in != cd->srcSubS) - ++numS; - } - } else { - *pOut=dmapU2M2[1+in]; - ++pOut; - if (memcmp(pOut-2, pSubD, 2) == 0) { - in>>=1; - if (in != cd->srcSubD) { - ++numS; - ++rc; - } - } - } - } - } - pIn+=2; - inLen-=2; - } - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - *numSub+=numS; - return 0; - - } else if (cd->cnv_dmap->codingSchema == DMAP_82E) { - register uchar * dmapU2S=cd->cnv_dmap->dmapU2S; - register uchar * dmapU2M2=cd->cnv_dmap->dmapU2M2 - 0x80 * 2; - register uchar * dmapU2M3=cd->cnv_dmap->dmapU2M3 - 0x80 * 3; - register int inLen=*inBytesLeft; - register char * pOut=*outBuf; - register char * pIn=*inBuf; - register char * pLastOutBuf = *outBuf + *outBytesLeft - 1; - register char subS=cd->subS; - register char * pSubD=(char *) &(cd->subD); - register size_t numS=0; - register size_t rc=0; - while (0 < inLen) { - register uint32_t in; - uint32_t in2; - if (pLastOutBuf < pOut) - break; - /* convert from UTF-8 to UCS-2 */ - if (*pIn == 0x00) { - in=0x0000; - ++pIn; - --inLen; - } else { /* 82U: */ - register uchar byte1=*pIn; - if ((byte1 & 0x80) == 0x00) { /* if (byte1 & 0b10000000 == 0b00000000) { */ - /* 1 bytes sequence: 0xxxxxxx => 00000000 0xxxxxxx*/ - in=byte1; - ++pIn; - --inLen; - } else if ((byte1 & 0xE0) == 0xC0) { /* (byte1 & 0b11100000 == 0b11000000) { */ - if (inLen < 2) { - errno=EINVAL; /* 22 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - *numSub+=numS; - return -1; - } - if (byte1 == 0xC0 || byte1 == 0xC1) { /* invalid sequence */ - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - *numSub+=numS; - return -1; - } - /* 2 bytes sequence: - 110yyyyy 10xxxxxx => 00000yyy yyxxxxxx */ - register uchar byte2; - ++pIn; - byte2=*pIn; - if ((byte2 & 0xC0) == 0x80) { /* byte2 & 0b11000000 == 0b10000000) { */ - register uchar work=byte1; - work<<=6; - byte2&=0x3F; /* 0b00111111; */ - byte2|=work; - - byte1&=0x1F; /* 0b00011111; */ - byte1>>=2; - in=byte1; - in<<=8; - in+=byte2; - inLen-=2; - ++pIn; - } else { /* invalid sequence */ - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn-1; - *numSub+=numS; - return -1; - } - } else if ((byte1 & 0xF0) == 0xE0) { /* byte1 & 0b11110000 == 0b11100000 */ - /* 3 bytes sequence: - 1110zzzz 10yyyyyy 10xxxxxx => zzzzyyyy yyxxxxxx */ - register uchar byte2; - register uchar byte3; - if (inLen < 3) { - if (inLen == 2 && (pIn[1] & 0xC0) != 0x80) - errno=EILSEQ; /* 116 */ - else - errno=EINVAL; /* 22 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - *numSub+=numS; - return -1; - } - ++pIn; - byte2=*pIn; - ++pIn; - byte3=*pIn; - if ((byte2 & 0xC0) != 0x80 || - (byte3 & 0xC0) != 0x80 || - (byte1 == 0xE0 && byte2 < 0xA0)) { /* invalid sequence, only 0xA0-0xBF allowed after 0xE0 */ - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn-2; - *numSub+=numS; - return -1; - } - { - register uchar work=byte2; - work<<=6; - byte3&=0x3F; /* 0b00111111; */ - byte3|=work; - - byte2&=0x3F; /* 0b00111111; */ - byte2>>=2; - - byte1<<=4; - in=byte1 | byte2;; - in<<=8; - in+=byte3; - inLen-=3; - ++pIn; - } - } else if ((0xF0 <= byte1 && byte1 <= 0xF4)) { /* (bytes1 & 11111000) == 0x1110000 */ - /* 4 bytes sequence - 11110uuu 10uuzzzz 10yyyyyy 10xxxxxx => 110110ww wwzzzzyy 110111yy yyxxxxxx - where uuuuu = wwww + 1 */ - register uchar byte2; - register uchar byte3; - register uchar byte4; - if (inLen < 4) { - if ((inLen >= 2 && (pIn[1] & 0xC0) != 0x80) || - (inLen >= 3 && (pIn[2] & 0xC0) != 0x80) || - (cd->toCcsid == 13488) ) - errno=EILSEQ; /* 116 */ - else - errno=EINVAL; /* 22 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - *numSub+=numS; - return -1; - } - ++pIn; - byte2=*pIn; - ++pIn; - byte3=*pIn; - ++pIn; - byte4=*pIn; - if ((byte2 & 0xC0) == 0x80 && /* byte2 & 0b11000000 == 0b10000000 */ - (byte3 & 0xC0) == 0x80 && /* byte3 & 0b11000000 == 0b10000000 */ - (byte4 & 0xC0) == 0x80) { /* byte4 & 0b11000000 == 0b10000000 */ - register uchar work=byte2; - if (byte1 == 0xF0 && byte2 < 0x90) { - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn-3; - *numSub+=numS; - return -1; - /* iconv() returns 0 for 0xF4908080 and convert to 0x00 - } else if (byte1 == 0xF4 && byte2 > 0x8F) { - errno=EINVAL; - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn-3; - *numSub+=numS; - return -1; - */ - } - - work&=0x30; /* 0b00110000; */ - work>>=4; - byte1&=0x07; /* 0b00000111; */ - byte1<<=2; - byte1+=work; /* uuuuu */ - --byte1; /* wwww */ - - work=byte1 & 0x0F; - work>>=2; - work+=0xD8; /* 0b11011011; */ - in=work; - in<<=8; - - byte1<<=6; - byte2<<=2; - byte2&=0x3C; /* 0b00111100; */ - work=byte3; - work>>=4; - work&=0x03; /* 0b00000011; */ - work|=byte1; - work|=byte2; - in+=work; - - work=byte3; - work>>=2; - work&=0x03; /* 0b00000011; */ - work|=0xDC; /* 0b110111xx; */ - in2=work; - in2<<=8; - - byte3<<=6; - byte4&=0x3F; /* 0b00111111; */ - byte4|=byte3; - in2+=byte4; - inLen-=4; - ++pIn; -#ifdef match_with_GBK - if ((0xD800 == in && in2 < 0xDC80) || - (0xD840 == in && in2 < 0xDC80) || - (0xD880 == in && in2 < 0xDC80) || - (0xD8C0 == in && in2 < 0xDC80) || - (0xD900 == in && in2 < 0xDC80) || - (0xD940 == in && in2 < 0xDC80) || - (0xD980 == in && in2 < 0xDC80) || - (0xD9C0 == in && in2 < 0xDC80) || - (0xDA00 == in && in2 < 0xDC80) || - (0xDA40 == in && in2 < 0xDC80) || - (0xDA80 == in && in2 < 0xDC80) || - (0xDAC0 == in && in2 < 0xDC80) || - (0xDB00 == in && in2 < 0xDC80) || - (0xDB40 == in && in2 < 0xDC80) || - (0xDB80 == in && in2 < 0xDC80) || - (0xDBC0 == in && in2 < 0xDC80)) { -#else - if ((0xD800 <= in && in <= 0xDBFF) && - (0xDC00 <= in2 && in2 <= 0xDFFF)) { -#endif - *pOut=subS; - ++pOut; - ++numS; - continue; - } - } else { /* invalid sequence */ - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn-3; - *numSub+=numS; - return -1; - } - } else if (0xF5 <= byte1 && byte1 <= 0xFF) { /* minic iconv() behavior */ - if (inLen < 4 || - (inLen >= 4 && byte1 == 0xF8 && pIn[1] < 0x90) || - pIn[1] < 0x80 || 0xBF < pIn[1] || - pIn[2] < 0x80 || 0xBF < pIn[2] || - pIn[3] < 0x80 || 0xBF < pIn[3] ) { - if (inLen == 1) - errno=EINVAL; /* 22 */ - else if (inLen == 2 && (pIn[1] & 0xC0) != 0x80) - errno=EILSEQ; /* 116 */ - else if (inLen == 3 && ((pIn[1] & 0xC0) != 0x80 || (pIn[2] & 0xC0) != 0x80)) - errno=EILSEQ; /* 116 */ - else if (inLen >= 4 && (byte1 == 0xF8 || (pIn[1] & 0xC0) != 0x80 || (pIn[2] & 0xC0) != 0x80 || (pIn[3] & 0xC0) != 0x80)) - errno=EILSEQ; /* 116 */ - else - errno=EINVAL; /* 22 */ - - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - *numSub+=numS; - return -1; - } else if ((pIn[1] == 0x80 || pIn[1] == 0x90 || pIn[1] == 0xA0 || pIn[1] == 0xB0) && - pIn[2] < 0x82) { - *pOut=subS; /* Though returns replacement character, which iconv() does not return. */ - ++pOut; - ++numS; - pIn+=4; - inLen-=4; - continue; - } else { - *pOut=pSubD[0]; /* Though returns replacement character, which iconv() does not return. */ - ++pOut; - *pOut=pSubD[1]; - ++pOut; - ++numS; - pIn+=4; - inLen-=4; - continue; - /* iconv() returns 0 with strange 1 byte converted values */ - } - - } else { /* invalid sequence */ - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - *numSub+=numS; - return -1; - } - } - /* end of UTF-8 to UCS-2 */ - if (in == 0x0000) { - *pOut=0x00; - ++pOut; - } else if (in < 0x100 && dmapU2S[in] != 0x0000) { - if ((*pOut=dmapU2S[in]) == subS) { - if (in != cd->srcSubS) - ++numS; - } - ++pOut; - } else { - in<<=1; - if (dmapU2M2[in] == 0x00) { /* not found in dmapU2M2 */ - in*=1.5; - if (dmapU2M3[in] == 0x00) { /* not found in dmapU2M3*/ - *pOut=pSubD[0]; - ++pOut; - *pOut=pSubD[1]; - ++pOut; - ++numS; - ++rc; - } else { - *pOut=dmapU2M3[in]; - ++pOut; - *pOut=dmapU2M3[1+in]; - ++pOut; - *pOut=dmapU2M3[2+in]; - ++pOut; - } - } else { - *pOut=dmapU2M2[in]; - ++pOut; - if (dmapU2M2[1+in] == 0x00) { - if (*pOut == subS) { - in>>=1; - if (in != cd->srcSubS) - ++numS; - } - } else { - *pOut=dmapU2M2[1+in]; - ++pOut; - if (memcmp(pOut-2, pSubD, 2) == 0) { - in>>=1; - if (in != cd->srcSubD) { - ++numS; - ++rc; - } - } - } - } - } - } - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - *numSub+=numS; - return 0; - - } else if (cd->cnv_dmap->codingSchema == DMAP_S2U) { - /* use uchar * instead of UniChar to avoid memcpy */ - register uchar * dmapD12U=(uchar *) (cd->cnv_dmap->dmapD12U); - register int inLen=*inBytesLeft; - register char * pOut=*outBuf; - register char * pIn=*inBuf; - register int offset; - register char * pLastOutBuf = *outBuf + *outBytesLeft - 1; - register size_t numS=0; - while (0 < inLen) { - if (pLastOutBuf < pOut) - break; - if (*pIn == 0x00) { - *pOut=0x00; - ++pOut; - *pOut=0x00; - ++pOut; - ++pIn; - --inLen; - } else { - offset=*pIn; - offset<<=1; - *pOut=dmapD12U[offset]; - ++pOut; - *pOut=dmapD12U[offset+1]; - ++pOut; - if (dmapD12U[offset] == 0x00) { - if (dmapD12U[offset+1] == 0x1A) { - if (*pIn != cd->srcSubS) - ++numS; - } else if (dmapD12U[offset+1] == 0x00) { - pOut-=2; - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - *numSub+=numS; - return -1; - } - } - ++pIn; - --inLen; - } - } - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - *numSub+=numS; - return 0; - - } else if (cd->cnv_dmap->codingSchema == DMAP_S28) { - /* use uchar * instead of UniChar to avoid memcpy */ - register uchar * dmapD12U=(uchar *) (cd->cnv_dmap->dmapD12U); - register int inLen=*inBytesLeft; - register char * pOut=*outBuf; - register char * pIn=*inBuf; - register int offset; - register char * pLastOutBuf = *outBuf + *outBytesLeft - 1; - register size_t numS=0; - register UniChar in; /* copy part of U28 */ - while (0 < inLen) { - if (pLastOutBuf < pOut) - break; - if (*pIn == 0x00) { - *pOut=0x00; - ++pOut; - ++pIn; - --inLen; - } else { - offset=*pIn; - offset<<=1; - in=dmapD12U[offset]; - in<<=8; - in+=dmapD12U[offset+1]; - if ((in & 0xFF80) == 0x0000) { /* U28: in & 0b1111111110000000 == 0x0000 */ - if (in == 0x000) { - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - *numSub+=numS; - return -1; - } - *pOut=in; - ++pOut; - } else if ((in & 0xF800) == 0x0000) { /* in & 0b1111100000000000 == 0x0000 */ - register uchar byte; - in>>=6; - in&=0x001F; /* 0b0000000000011111 */ - in|=0x00C0; /* 0b0000000011000000 */ - *pOut=in; - ++pOut; - byte=dmapD12U[offset+1]; - byte&=0x3F; /* 0b00111111; */ - byte|=0x80; /* 0b10000000; */ - *pOut=byte; - ++pOut; - } else if ((in & 0xFC00) == 0xD800) { /* There should not be no surrogate character in SBCS. */ - *pOut=0xEF; - ++pOut; - *pOut=0xBF; - ++pOut; - *pOut=0xBD; - ++pOut; - } else { - register uchar byte; - register uchar work; - byte=dmapD12U[offset]; - byte>>=4; - byte|=0xE0; /* 0b11100000; */ - *pOut=byte; - ++pOut; - - byte=dmapD12U[offset]; - byte<<=2; - work=dmapD12U[offset+1]; - work>>=6; - byte|=work; - byte&=0x3F; /* 0b00111111; */ - byte|=0x80; /* 0b10000000; */ - *pOut=byte; - ++pOut; - - byte=dmapD12U[offset+1]; - byte&=0x3F; /* 0b00111111; */ - byte|=0x80; /* 0b10000000; */ - *pOut=byte; - ++pOut; - } - /* end of U28 */ - if (dmapD12U[offset] == 0x00) { - if (dmapD12U[offset+1] == 0x1A) { - if (*pIn != cd->srcSubS) - ++numS; - } - } - ++pIn; - --inLen; - } - } - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - *numSub+=numS; - return 0; - - } else if (cd->cnv_dmap->codingSchema == DMAP_U2S) { - register uchar * dmapU2S=cd->cnv_dmap->dmapU2S; - register int inLen=*inBytesLeft; - register char * pOut=*outBuf; - register char * pIn=*inBuf; - register char * pLastOutBuf = *outBuf + *outBytesLeft - 1; - register char subS=cd->subS; - register size_t numS=0; - while (0 < inLen) { - register uint32_t in; - if (inLen == 1) { - errno=EINVAL; /* 22 */ - - *inBytesLeft=inLen; - *outBytesLeft-=(pOut-*outBuf); - *outBuf=pOut; - *inBuf=pIn; - return -1; - } - if (pLastOutBuf < pOut) - break; - in=pIn[0]; - in<<=8; - in+=pIn[1]; - if (in == 0x0000) { - *pOut=0x00; - } else { - if ((*pOut=dmapU2S[in]) == 0x00) { - *pOut=subS; - ++numS; - errno=EINVAL; /* 22 */ - } else if (*pOut == subS) { - if (in != cd->srcSubS) - ++numS; - } - } - ++pOut; - pIn+=2; - inLen-=2; - } - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - *numSub+=numS; - return numS; - - } else if (cd->cnv_dmap->codingSchema == DMAP_T2S) { - register uchar * dmapU2S=cd->cnv_dmap->dmapU2S; - register int inLen=*inBytesLeft; - register char * pOut=*outBuf; - register char * pIn=*inBuf; - register char * pLastOutBuf = *outBuf + *outBytesLeft - 1; - register char subS=cd->subS; - register size_t numS=0; - while (0 < inLen) { - register uint32_t in; - if (inLen == 1) { - errno=EINVAL; /* 22 */ - - *inBytesLeft=inLen-1; - *outBytesLeft-=(pOut-*outBuf); - *outBuf=pOut; - *inBuf=pIn; - ++numS; - *numSub+=numS; - return 0; - } - if (pLastOutBuf < pOut) - break; - in=pIn[0]; - in<<=8; - in+=pIn[1]; - if (in == 0x0000) { - *pOut=0x00; - - } else if (0xD800 <= in && in <= 0xDFFF) { /* 0xD800-0xDFFF, surrogate first and second values */ - if (0xDC00 <= in ) { - errno=EINVAL; /* 22 */ - *inBytesLeft=inLen-1; - *outBytesLeft-=(pOut-*outBuf); - *outBuf=pOut; - *inBuf=pIn; - return -1; - - } else if (inLen < 4) { - errno=EINVAL; /* 22 */ - *inBytesLeft=inLen-2; - *outBytesLeft-=(pOut-*outBuf); - *outBuf=pOut; - *inBuf=pIn+2; - return -1; - - } else { - register uint32_t in2; - in2=pIn[2]; - in2<<=8; - in2+=pIn[3]; - if (0xDC00 <= in2 && in2 <= 0xDFFF) { /* second surrogate character =0xDC00 - 0xDFFF*/ - *pOut=subS; - ++numS; - pIn+=4; - } else { - errno=EINVAL; /* 22 */ - *inBytesLeft=inLen-1; - *outBytesLeft-=(pOut-*outBuf); - *outBuf=pOut; - *inBuf=pIn; - return -1; - } - } - } else { - if ((*pOut=dmapU2S[in]) == 0x00) { - *pOut=subS; - ++numS; - errno=EINVAL; /* 22 */ - } else if (*pOut == subS) { - if (in != cd->srcSubS) - ++numS; - } - } - ++pOut; - pIn+=2; - inLen-=2; - } - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - *numSub+=numS; - return 0; - - } else if (cd->cnv_dmap->codingSchema == DMAP_82S) { - register uchar * dmapU2S=cd->cnv_dmap->dmapU2S; - register int inLen=*inBytesLeft; - register char * pOut=*outBuf; - register char * pIn=*inBuf; - register char * pLastOutBuf = *outBuf + *outBytesLeft - 1; - register char subS=cd->subS; - register size_t numS=0; - while (0 < inLen) { - register uint32_t in; - uint32_t in2; /* The second surrogate value */ - if (pLastOutBuf < pOut) - break; - /* convert from UTF-8 to UCS-2 */ - if (*pIn == 0x00) { - in=0x0000; - ++pIn; - --inLen; - } else { /* 82U: */ - register uchar byte1=*pIn; - if ((byte1 & 0x80) == 0x00) { /* if (byte1 & 0b10000000 == 0b00000000) { */ - /* 1 bytes sequence: 0xxxxxxx => 00000000 0xxxxxxx*/ - in=byte1; - ++pIn; - --inLen; - } else if ((byte1 & 0xE0) == 0xC0) { /* (byte1 & 0b11100000 == 0b11000000) { */ - if (inLen < 2) { - errno=EINVAL; /* 22 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - *numSub+=numS; - return -1; - } - if (byte1 == 0xC0 || byte1 == 0xC1) { /* invalid sequence */ - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - *numSub+=numS; - return -1; - } - /* 2 bytes sequence: - 110yyyyy 10xxxxxx => 00000yyy yyxxxxxx */ - register uchar byte2; - ++pIn; - byte2=*pIn; - if ((byte2 & 0xC0) == 0x80) { /* byte2 & 0b11000000 == 0b10000000) { */ - register uchar work=byte1; - work<<=6; - byte2&=0x3F; /* 0b00111111; */ - byte2|=work; - - byte1&=0x1F; /* 0b00011111; */ - byte1>>=2; - in=byte1; - in<<=8; - in+=byte2; - inLen-=2; - ++pIn; - } else { /* invalid sequence */ - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn-1; - *numSub+=numS; - return -1; - } - } else if ((byte1 & 0xF0) == 0xE0) { /* byte1 & 0b11110000 == 0b11100000 */ - /* 3 bytes sequence: - 1110zzzz 10yyyyyy 10xxxxxx => zzzzyyyy yyxxxxxx */ - register uchar byte2; - register uchar byte3; - if (inLen < 3) { - if (inLen == 2 && (pIn[1] & 0xC0) != 0x80) - errno=EILSEQ; /* 116 */ - else - errno=EINVAL; /* 22 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - *numSub+=numS; - return -1; - } - ++pIn; - byte2=*pIn; - ++pIn; - byte3=*pIn; - if ((byte2 & 0xC0) != 0x80 || - (byte3 & 0xC0) != 0x80 || - (byte1 == 0xE0 && byte2 < 0xA0)) { /* invalid sequence, only 0xA0-0xBF allowed after 0xE0 */ - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn-2; - *numSub+=numS; - return -1; - } - { - register uchar work=byte2; - work<<=6; - byte3&=0x3F; /* 0b00111111; */ - byte3|=work; - - byte2&=0x3F; /* 0b00111111; */ - byte2>>=2; - - byte1<<=4; - in=byte1 | byte2;; - in<<=8; - in+=byte3; - inLen-=3; - ++pIn; - } - } else if ((0xF0 <= byte1 && byte1 <= 0xF4) || /* (bytes1 & 11111000) == 0x1110000 */ - ((byte1&=0xF7) && 0xF0 <= byte1 && byte1 <= 0xF4)) { /* minic iconv() behavior */ - /* 4 bytes sequence - 11110uuu 10uuzzzz 10yyyyyy 10xxxxxx => 110110ww wwzzzzyy 110111yy yyxxxxxx - where uuuuu = wwww + 1 */ - register uchar byte2; - register uchar byte3; - register uchar byte4; - if (inLen < 4) { - if ((inLen >= 2 && (pIn[1] & 0xC0) != 0x80) || - (inLen >= 3 && (pIn[2] & 0xC0) != 0x80) || - (cd->toCcsid == 13488) ) - errno=EILSEQ; /* 116 */ - else - errno=EINVAL; /* 22 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - *numSub+=numS; - return -1; - } - ++pIn; - byte2=*pIn; - ++pIn; - byte3=*pIn; - ++pIn; - byte4=*pIn; - if ((byte2 & 0xC0) == 0x80 && /* byte2 & 0b11000000 == 0b10000000 */ - (byte3 & 0xC0) == 0x80 && /* byte3 & 0b11000000 == 0b10000000 */ - (byte4 & 0xC0) == 0x80) { /* byte4 & 0b11000000 == 0b10000000 */ - register uchar work=byte2; - if (byte1 == 0xF0 && byte2 < 0x90) { - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn-3; - *numSub+=numS; - return -1; - /* iconv() returns 0 for 0xF4908080 and convert to 0x00 - } else if (byte1 == 0xF4 && byte2 > 0x8F) { - errno=EINVAL; - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn-3; - *numSub+=numS; - return -1; - */ - } - - work&=0x30; /* 0b00110000; */ - work>>=4; - byte1&=0x07; /* 0b00000111; */ - byte1<<=2; - byte1+=work; /* uuuuu */ - --byte1; /* wwww */ - - work=byte1 & 0x0F; - work>>=2; - work+=0xD8; /* 0b11011011; */ - in=work; - in<<=8; - - byte1<<=6; - byte2<<=2; - byte2&=0x3C; /* 0b00111100; */ - work=byte3; - work>>=4; - work&=0x03; /* 0b00000011; */ - work|=byte1; - work|=byte2; - in+=work; - - work=byte3; - work>>=2; - work&=0x03; /* 0b00000011; */ - work|=0xDC; /* 0b110111xx; */ - in2=work; - in2<<=8; - - byte3<<=6; - byte4&=0x3F; /* 0b00111111; */ - byte4|=byte3; - in2+=byte4; - inLen-=4; - ++pIn; - } else { /* invalid sequence */ - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn-3; - *numSub+=numS; - return -1; - } - } else if ((byte1 & 0xF0) == 0xF0) { /* minic iconv() behavior */ - if (inLen < 4 || - pIn[1] < 0x80 || 0xBF < pIn[1] || - pIn[2] < 0x80 || 0xBF < pIn[2] || - pIn[3] < 0x80 || 0xBF < pIn[3] ) { - if (inLen == 1) - errno=EINVAL; /* 22 */ - else if (inLen == 2 && (pIn[1] & 0xC0) != 0x80) - errno=EILSEQ; /* 116 */ - else if (inLen == 3 && ((pIn[1] & 0xC0) != 0x80 || (pIn[2] & 0xC0) != 0x80)) - errno=EILSEQ; /* 116 */ - else if (inLen >= 4 && ((pIn[1] & 0xC0) != 0x80 || (pIn[2] & 0xC0) != 0x80 || (pIn[3] & 0xC0) != 0x80)) - errno=EILSEQ; /* 116 */ - else - errno=EINVAL; /* 22 */ - - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - *numSub+=numS; - return -1; - } else { - *pOut=subS; /* Though returns replacement character, which iconv() does not return. */ - ++pOut; - ++numS; - pIn+=4; - inLen-=4; - /* UTF-8_IBM-850 0xF0908080 : converted value does not match, iconv=0x00, dmap=0x7F - UTF-8_IBM-850 0xF0908081 : converted value does not match, iconv=0x01, dmap=0x7F - UTF-8_IBM-850 0xF0908082 : converted value does not match, iconv=0x02, dmap=0x7F - UTF-8_IBM-850 0xF0908083 : converted value does not match, iconv=0x03, dmap=0x7F - .... - UTF-8_IBM-850 0xF09081BE : converted value does not match, iconv=0x7E, dmap=0x7F - UTF-8_IBM-850 0xF09081BF : converted value does not match, iconv=0x1C, dmap=0x7F - UTF-8_IBM-850 0xF09082A0 : converted value does not match, iconv=0xFF, dmap=0x7F - UTF-8_IBM-850 0xF09082A1 : converted value does not match, iconv=0xAD, dmap=0x7F - .... - */ - continue; - /* iconv() returns 0 with strange 1 byte converted values */ - } - - } else { /* invalid sequence */ - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - *numSub+=numS; - return -1; - } - } - /* end of UTF-8 to UCS-2 */ - if (in == 0x0000) { - *pOut=0x00; - } else { - if ((*pOut=dmapU2S[in]) == 0x00) { - *pOut=subS; - ++numS; - errno=EINVAL; /* 22 */ - } else if (*pOut == subS) { - if (in != cd->srcSubS) { - ++numS; - } - } - } - ++pOut; - } - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - *numSub+=numS; - return 0; - - } else if (cd->cnv_dmap->codingSchema == DMAP_D2U) { - /* use uchar * instead of UniChar to avoid memcpy */ - register uchar * dmapD12U=(uchar *) (cd->cnv_dmap->dmapD12U); - register uchar * dmapD22U=(uchar *) (cd->cnv_dmap->dmapD22U); - register int inLen=*inBytesLeft; - register char * pOut=*outBuf; - register char * pIn=*inBuf; - register int offset; - register char * pLastOutBuf = *outBuf + *outBytesLeft - 1; - register size_t numS=0; - while (0 < inLen) { - if (pLastOutBuf < pOut) - break; - if (*pIn == 0x00) { - *pOut=0x00; - ++pOut; - *pOut=0x00; - ++pOut; - ++pIn; - --inLen; - } else { - offset=*pIn; - offset<<=1; - if (dmapD12U[offset] == 0x00 && - dmapD12U[offset+1] == 0x00) { /* DBCS */ - if (inLen < 2) { - if (*pIn == 0x80 || *pIn == 0xFF || - (cd->fromCcsid == 943 && (*pIn == 0x85 || *pIn == 0x86 || *pIn == 0xA0 || *pIn == 0xEB || *pIn == 0xEC || *pIn == 0xEF || *pIn == 0xFD || *pIn == 0xFE)) || - (cd->fromCcsid == 932 && (*pIn == 0x85 || *pIn == 0x86 || *pIn == 0x87 || *pIn == 0xEB || *pIn == 0xEC || *pIn == 0xED || *pIn == 0xEE || *pIn == 0xEF)) || - (cd->fromCcsid == 1381 && ((0x85 <= *pIn && *pIn <= 0x8B) || (0xAA <= *pIn && *pIn <= 0xAF) || (0xF8 <= *pIn && *pIn <= 0xFE)))) - errno=EILSEQ; /* 116 */ - else - errno=EINVAL; /* 22 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - return -1; - } - offset-=0x100; - ++pIn; - offset<<=8; - offset+=(*pIn * 2); - if (dmapD22U[offset] == 0x00 && - dmapD22U[offset+1] == 0x00) { - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn-1; - return -1; - } - *pOut=dmapD22U[offset]; - ++pOut; - *pOut=dmapD22U[offset+1]; - ++pOut; - if (dmapD22U[offset] == 0xFF && - dmapD22U[offset+1] == 0xFD) { - if (pIn[-1] * 0x100 + pIn[0] != cd->srcSubD) - ++numS; - } - ++pIn; - inLen-=2; - } else { /* SBCS */ - *pOut=dmapD12U[offset]; - ++pOut; - *pOut=dmapD12U[offset+1]; - ++pOut; - if (dmapD12U[offset] == 0x00 && - dmapD12U[offset+1] == 0x1A) { - if (*pIn != cd->srcSubS) - ++numS; - } - ++pIn; - --inLen; - } - } - } - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - *numSub+=numS; - return 0; - - } else if (cd->cnv_dmap->codingSchema == DMAP_D28) { - /* use uchar * instead of UniChar to avoid memcpy */ - register uchar * dmapD12U=(uchar *) (cd->cnv_dmap->dmapD12U); - register uchar * dmapD22U=(uchar *) (cd->cnv_dmap->dmapD22U); - register int inLen=*inBytesLeft; - register char * pOut=*outBuf; - register char * pIn=*inBuf; - register int offset; - register char * pLastOutBuf = *outBuf + *outBytesLeft - 1; - register size_t numS=0; - register UniChar in; /* copy part of U28 */ - register UniChar ucs2; - while (0 < inLen) { - if (pLastOutBuf < pOut) - break; - if (*pIn == 0x00) { - *pOut=0x00; - ++pOut; - ++pIn; - --inLen; - } else { - offset=*pIn; - offset<<=1; - if (dmapD12U[offset] == 0x00 && - dmapD12U[offset+1] == 0x00) { /* DBCS */ - if (inLen < 2) { - if (*pIn == 0x80 || *pIn == 0xFF || - (cd->fromCcsid == 943 && (*pIn == 0x85 || *pIn == 0x86 || *pIn == 0xA0 || *pIn == 0xEB || *pIn == 0xEC || *pIn == 0xEF || *pIn == 0xFD || *pIn == 0xFE)) || - (cd->fromCcsid == 932 && (*pIn == 0x85 || *pIn == 0x86 || *pIn == 0x87 || *pIn == 0xEB || *pIn == 0xEC || *pIn == 0xED || *pIn == 0xEE || *pIn == 0xEF)) || - (cd->fromCcsid == 1381 && ((0x85 <= *pIn && *pIn <= 0x8B) || (0xAA <= *pIn && *pIn <= 0xAF) || (0xF8 <= *pIn && *pIn <= 0xFE)))) - errno=EILSEQ; /* 116 */ - else - errno=EINVAL; /* 22 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - return -1; - } - offset-=0x100; - ++pIn; - offset<<=8; - offset+=(*pIn * 2); - if (dmapD22U[offset] == 0x00 && - dmapD22U[offset+1] == 0x00) { - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn-1; - return -1; - } - in=dmapD22U[offset]; - in<<=8; - in+=dmapD22U[offset+1]; - ucs2=in; - if (dmapD22U[offset] == 0xFF && - dmapD22U[offset+1] == 0xFD) { - if (in != cd->srcSubD) - ++numS; - } - ++pIn; - inLen-=2; - } else { /* SBCS */ - in=dmapD12U[offset]; - in<<=8; - in+=dmapD12U[offset+1]; - ucs2=in; - if (dmapD12U[offset] == 0x00 && - dmapD12U[offset+1] == 0x1A) { - if (in != cd->srcSubS) - ++numS; - } - ++pIn; - --inLen; - } - if ((in & 0xFF80) == 0x0000) { /* U28: in & 0b1111111110000000 == 0x0000 */ - *pOut=in; - ++pOut; - } else if ((in & 0xF800) == 0x0000) { /* in & 0b1111100000000000 == 0x0000 */ - register uchar byte; - in>>=6; - in&=0x001F; /* 0b0000000000011111 */ - in|=0x00C0; /* 0b0000000011000000 */ - *pOut=in; - ++pOut; - byte=ucs2; /* dmapD12U[offset+1]; */ - byte&=0x3F; /* 0b00111111; */ - byte|=0x80; /* 0b10000000; */ - *pOut=byte; - ++pOut; - } else if ((in & 0xFC00) == 0xD800) { /* There should not be no surrogate character in SBCS. */ - *pOut=0xEF; - ++pOut; - *pOut=0xBF; - ++pOut; - *pOut=0xBD; - ++pOut; - } else { - register uchar byte; - register uchar work; - byte=(ucs2>>8); /* dmapD12U[offset]; */ - byte>>=4; - byte|=0xE0; /* 0b11100000; */ - *pOut=byte; - ++pOut; - - byte=(ucs2>>8); /* dmapD12U[offset]; */ - byte<<=2; - work=ucs2; /* dmapD12U[offset+1]; */ - work>>=6; - byte|=work; - byte&=0x3F; /* 0b00111111; */ - byte|=0x80; /* 0b10000000; */ - *pOut=byte; - ++pOut; - - byte=ucs2; /* dmapD12U[offset+1]; */ - byte&=0x3F; /* 0b00111111; */ - byte|=0x80; /* 0b10000000; */ - *pOut=byte; - ++pOut; - } - /* end of U28 */ - } - } - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - *numSub+=numS; - return 0; - - } else if (cd->cnv_dmap->codingSchema == DMAP_U2D) { - register uchar * dmapU2D=cd->cnv_dmap->dmapU2D; - register int inLen=*inBytesLeft; - register char * pOut=*outBuf; - register char * pIn=*inBuf; - register char * pLastOutBuf = *outBuf + *outBytesLeft - 1; - register char subS=cd->subS; - register char * pSubD=(char *) &(cd->subD); - register size_t numS=0; - while (0 < inLen) { - register uint32_t in; - if (inLen == 1) { - errno=EINVAL; /* 22 */ - - *inBytesLeft=inLen; - *outBytesLeft-=(pOut-*outBuf); - *outBuf=pOut; - *inBuf=pIn; - return -1; - } - if (pLastOutBuf < pOut) - break; - in=pIn[0]; - in<<=8; - in+=pIn[1]; - if (in == 0x0000) { - *pOut=0x00; - ++pOut; - } else { - in<<=1; - *pOut=dmapU2D[in]; - ++pOut; - if (dmapU2D[in+1] == 0x00) { /* SBCS */ - if (*pOut == subS) { - if (in != cd->srcSubS) - ++numS; - } - } else { - *pOut=dmapU2D[in+1]; - ++pOut; - if (dmapU2D[in] == pSubD[0] && - dmapU2D[in+1] == pSubD[1]) { - in>>=1; - if (in != cd->srcSubD) - ++numS; - } - } - } - pIn+=2; - inLen-=2; - } - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - *numSub+=numS; - return numS; /* to minic iconv() behavior */ - - } else if (cd->cnv_dmap->codingSchema == DMAP_T2D) { - register uchar * dmapU2D=cd->cnv_dmap->dmapU2D; - register int inLen=*inBytesLeft; - register char * pOut=*outBuf; - register char * pIn=*inBuf; - register char * pLastOutBuf = *outBuf + *outBytesLeft - 1; - register char subS=cd->subS; - register char * pSubD=(char *) &(cd->subD); - register size_t numS=0; - while (0 < inLen) { - register uint32_t in; - if (inLen == 1) { - errno=EINVAL; /* 22 */ - *inBytesLeft=inLen-1; - *outBytesLeft-=(pOut-*outBuf); - *outBuf=pOut; - *inBuf=pIn; - ++numS; - *numSub+=numS; - return 0; - } - if (pLastOutBuf < pOut) - break; - in=pIn[0]; - in<<=8; - in+=pIn[1]; - if (in == 0x0000) { - *pOut=0x00; - ++pOut; - } else if (0xD800 <= in && in <= 0xDBFF) { /* first byte of surrogate */ - errno=EINVAL; /* 22 */ - *inBytesLeft=inLen-2; - *outBytesLeft-=(pOut-*outBuf); - *outBuf=pOut; - *inBuf=pIn+2; - ++numS; - *numSub+=numS; - return -1; - - } else if (0xDC00 <= in && in <= 0xDFFF) { /* second byte of surrogate */ - errno=EINVAL; /* 22 */ - *inBytesLeft=inLen-1; - *outBytesLeft-=(pOut-*outBuf); - *outBuf=pOut; - *inBuf=pIn; - ++numS; - *numSub+=numS; - return -1; - - } else { - in<<=1; - *pOut=dmapU2D[in]; - ++pOut; - if (dmapU2D[in+1] == 0x00) { /* SBCS */ - if (*pOut == subS) { - if (in != cd->srcSubS) - ++numS; - } - } else { - *pOut=dmapU2D[in+1]; - ++pOut; - if (dmapU2D[in] == pSubD[0] && - dmapU2D[in+1] == pSubD[1]) { - in>>=1; - if (in != cd->srcSubD) - ++numS; - } - } - } - pIn+=2; - inLen-=2; - } - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - *numSub+=numS; - return 0; /* to minic iconv() behavior */ - - } else if (cd->cnv_dmap->codingSchema == DMAP_82D) { - register uchar * dmapU2D=cd->cnv_dmap->dmapU2D; - register int inLen=*inBytesLeft; - register char * pOut=*outBuf; - register char * pIn=*inBuf; - register char * pLastOutBuf = *outBuf + *outBytesLeft - 1; - register char subS=cd->subS; - register char * pSubD=(char *) &(cd->subD); - register size_t numS=0; - while (0 < inLen) { - register uint32_t in; - uint32_t in2; - if (pLastOutBuf < pOut) - break; - /* convert from UTF-8 to UCS-2 */ - if (*pIn == 0x00) { - in=0x0000; - ++pIn; - --inLen; - } else { /* 82U: */ - register uchar byte1=*pIn; - if ((byte1 & 0x80) == 0x00) { /* if (byte1 & 0b10000000 == 0b00000000) { */ - /* 1 bytes sequence: 0xxxxxxx => 00000000 0xxxxxxx*/ - in=byte1; - ++pIn; - --inLen; - } else if ((byte1 & 0xE0) == 0xC0) { /* (byte1 & 0b11100000 == 0b11000000) { */ - if (inLen < 2) { - errno=EINVAL; /* 22 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - *numSub+=numS; - return -1; - } - if (byte1 == 0xC0 || byte1 == 0xC1) { /* invalid sequence */ - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - *numSub+=numS; - return -1; - } - /* 2 bytes sequence: - 110yyyyy 10xxxxxx => 00000yyy yyxxxxxx */ - register uchar byte2; - ++pIn; - byte2=*pIn; - if ((byte2 & 0xC0) == 0x80) { /* byte2 & 0b11000000 == 0b10000000) { */ - register uchar work=byte1; - work<<=6; - byte2&=0x3F; /* 0b00111111; */ - byte2|=work; - - byte1&=0x1F; /* 0b00011111; */ - byte1>>=2; - in=byte1; - in<<=8; - in+=byte2; - inLen-=2; - ++pIn; - } else { /* invalid sequence */ - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn-1; - *numSub+=numS; - return -1; - } - } else if ((byte1 & 0xF0) == 0xE0) { /* byte1 & 0b11110000 == 0b11100000 */ - /* 3 bytes sequence: - 1110zzzz 10yyyyyy 10xxxxxx => zzzzyyyy yyxxxxxx */ - register uchar byte2; - register uchar byte3; - if (inLen < 3) { - if (inLen == 2 && (pIn[1] & 0xC0) != 0x80) - errno=EILSEQ; /* 116 */ - else - errno=EINVAL; /* 22 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - *numSub+=numS; - return -1; - } - ++pIn; - byte2=*pIn; - ++pIn; - byte3=*pIn; - if ((byte2 & 0xC0) != 0x80 || - (byte3 & 0xC0) != 0x80 || - (byte1 == 0xE0 && byte2 < 0xA0)) { /* invalid sequence, only 0xA0-0xBF allowed after 0xE0 */ - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn-2; - *numSub+=numS; - return -1; - } - { - register uchar work=byte2; - work<<=6; - byte3&=0x3F; /* 0b00111111; */ - byte3|=work; - - byte2&=0x3F; /* 0b00111111; */ - byte2>>=2; - - byte1<<=4; - in=byte1 | byte2;; - in<<=8; - in+=byte3; - inLen-=3; - ++pIn; - } - } else if ((0xF0 <= byte1 && byte1 <= 0xF4)) { /* (bytes1 & 11111000) == 0x1110000 */ - /* 4 bytes sequence - 11110uuu 10uuzzzz 10yyyyyy 10xxxxxx => 110110ww wwzzzzyy 110111yy yyxxxxxx - where uuuuu = wwww + 1 */ - register uchar byte2; - register uchar byte3; - register uchar byte4; - if (inLen < 4) { - if ((inLen >= 2 && (pIn[1] & 0xC0) != 0x80) || - (inLen >= 3 && (pIn[2] & 0xC0) != 0x80) || - (cd->toCcsid == 13488) ) - errno=EILSEQ; /* 116 */ - else - errno=EINVAL; /* 22 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - *numSub+=numS; - return -1; - } - ++pIn; - byte2=*pIn; - ++pIn; - byte3=*pIn; - ++pIn; - byte4=*pIn; - if ((byte2 & 0xC0) == 0x80 && /* byte2 & 0b11000000 == 0b10000000 */ - (byte3 & 0xC0) == 0x80 && /* byte3 & 0b11000000 == 0b10000000 */ - (byte4 & 0xC0) == 0x80) { /* byte4 & 0b11000000 == 0b10000000 */ - register uchar work=byte2; - if (byte1 == 0xF0 && byte2 < 0x90) { - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn-3; - *numSub+=numS; - return -1; - /* iconv() returns 0 for 0xF4908080 and convert to 0x00 - } else if (byte1 == 0xF4 && byte2 > 0x8F) { - errno=EINVAL; - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn-3; - *numSub+=numS; - return -1; - */ - } - - work&=0x30; /* 0b00110000; */ - work>>=4; - byte1&=0x07; /* 0b00000111; */ - byte1<<=2; - byte1+=work; /* uuuuu */ - --byte1; /* wwww */ - - work=byte1 & 0x0F; - work>>=2; - work+=0xD8; /* 0b11011011; */ - in=work; - in<<=8; - - byte1<<=6; - byte2<<=2; - byte2&=0x3C; /* 0b00111100; */ - work=byte3; - work>>=4; - work&=0x03; /* 0b00000011; */ - work|=byte1; - work|=byte2; - in+=work; - - work=byte3; - work>>=2; - work&=0x03; /* 0b00000011; */ - work|=0xDC; /* 0b110111xx; */ - in2=work; - in2<<=8; - - byte3<<=6; - byte4&=0x3F; /* 0b00111111; */ - byte4|=byte3; - in2+=byte4; - inLen-=4; - ++pIn; -#ifdef match_with_GBK - if ((0xD800 == in && in2 < 0xDC80) || - (0xD840 == in && in2 < 0xDC80) || - (0xD880 == in && in2 < 0xDC80) || - (0xD8C0 == in && in2 < 0xDC80) || - (0xD900 == in && in2 < 0xDC80) || - (0xD940 == in && in2 < 0xDC80) || - (0xD980 == in && in2 < 0xDC80) || - (0xD9C0 == in && in2 < 0xDC80) || - (0xDA00 == in && in2 < 0xDC80) || - (0xDA40 == in && in2 < 0xDC80) || - (0xDA80 == in && in2 < 0xDC80) || - (0xDAC0 == in && in2 < 0xDC80) || - (0xDB00 == in && in2 < 0xDC80) || - (0xDB40 == in && in2 < 0xDC80) || - (0xDB80 == in && in2 < 0xDC80) || - (0xDBC0 == in && in2 < 0xDC80)) { -#else - if ((0xD800 <= in && in <= 0xDBFF) && - (0xDC00 <= in2 && in2 <= 0xDFFF)) { -#endif - *pOut=subS; - ++pOut; - ++numS; - continue; - } - } else { /* invalid sequence */ - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn-3; - *numSub+=numS; - return -1; - } - } else if (0xF5 <= byte1 && byte1 <= 0xFF) { /* minic iconv() behavior */ - if (inLen < 4 || - (inLen >= 4 && byte1 == 0xF8 && pIn[1] < 0x90) || - pIn[1] < 0x80 || 0xBF < pIn[1] || - pIn[2] < 0x80 || 0xBF < pIn[2] || - pIn[3] < 0x80 || 0xBF < pIn[3] ) { - if (inLen == 1) - errno=EINVAL; /* 22 */ - else if (inLen == 2 && (pIn[1] & 0xC0) != 0x80) - errno=EILSEQ; /* 116 */ - else if (inLen == 3 && ((pIn[1] & 0xC0) != 0x80 || (pIn[2] & 0xC0) != 0x80)) - errno=EILSEQ; /* 116 */ - else if (inLen >= 4 && (byte1 == 0xF8 || (pIn[1] & 0xC0) != 0x80 || (pIn[2] & 0xC0) != 0x80 || (pIn[3] & 0xC0) != 0x80)) - errno=EILSEQ; /* 116 */ - else - errno=EINVAL; /* 22 */ - - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - *numSub+=numS; - return -1; - } else if ((pIn[1] == 0x80 || pIn[1] == 0x90 || pIn[1] == 0xA0 || pIn[1] == 0xB0) && - pIn[2] < 0x82) { - *pOut=subS; /* Though returns replacement character, which iconv() does not return. */ - ++pOut; - ++numS; - pIn+=4; - inLen-=4; - continue; - } else { - *pOut=pSubD[0]; /* Though returns replacement character, which iconv() does not return. */ - ++pOut; - *pOut=pSubD[1]; - ++pOut; - ++numS; - pIn+=4; - inLen-=4; - continue; - /* iconv() returns 0 with strange 1 byte converted values */ - } - - } else { /* invalid sequence */ - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - *numSub+=numS; - return -1; - } - } - /* end of UTF-8 to UCS-2 */ - if (in == 0x0000) { - *pOut=0x00; - ++pOut; - } else { - in<<=1; - *pOut=dmapU2D[in]; - ++pOut; - if (dmapU2D[in+1] == 0x00) { /* SBCS */ - if (dmapU2D[in] == subS) { - in>>=1; - if (in != cd->srcSubS) - ++numS; - } - } else { - *pOut=dmapU2D[in+1]; - ++pOut; - if (dmapU2D[in] == pSubD[0] && - dmapU2D[in+1] == pSubD[1]) { - in>>=1; - if (in != cd->srcSubD) - ++numS; - } - } - } - } - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - *numSub+=numS; - return 0; - - } else if (cd->cnv_dmap->codingSchema == DMAP_82U) { - /* See http://unicode.org/versions/corrigendum1.html */ - /* convert from UTF-8 to UTF-16 can cover all conversion from UTF-8 to UCS-2 */ - register int inLen=*inBytesLeft; - register char * pOut=*outBuf; - register char * pIn=*inBuf; - register char * pLastOutBuf = *outBuf + *outBytesLeft - 1; - register size_t numS=0; - while (0 < inLen) { - if (pLastOutBuf < pOut) - break; - if (*pIn == 0x00) { - *pOut=0x00; - ++pOut; - *pOut=0x00; - ++pOut; - ++pIn; - --inLen; - } else { /* 82U: */ - register uchar byte1=*pIn; - if ((byte1 & 0x80) == 0x00) { /* if (byte1 & 0b10000000 == 0b00000000) { */ - /* 1 bytes sequence: 0xxxxxxx => 00000000 0xxxxxxx*/ - *pOut=0x00; - ++pOut; - *pOut=byte1; - ++pOut; - ++pIn; - --inLen; - } else if ((byte1 & 0xE0) == 0xC0) { /* (byte1 & 0b11100000 == 0b11000000) { */ - if (inLen < 2) { - errno=EINVAL; /* 22 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - *numSub+=numS; - return -1; - } - if (byte1 == 0xC0 || byte1 == 0xC1) { /* invalid sequence */ - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - *numSub+=numS; - return -1; - } - /* 2 bytes sequence: - 110yyyyy 10xxxxxx => 00000yyy yyxxxxxx */ - register uchar byte2; - ++pIn; - byte2=*pIn; - if ((byte2 & 0xC0) == 0x80) { /* byte2 & 0b11000000 == 0b10000000) { */ - register uchar work=byte1; - work<<=6; - byte2&=0x3F; /* 0b00111111; */ - byte2|=work; - - byte1&=0x1F; /* 0b00011111; */ - byte1>>=2; - *pOut=byte1; - ++pOut; - *pOut=byte2; - ++pOut; - inLen-=2; - ++pIn; - } else { /* invalid sequence */ - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn-1; - *numSub+=numS; - return -1; - } - } else if ((byte1 & 0xF0) == 0xE0) { /* byte1 & 0b11110000 == 0b11100000 */ - /* 3 bytes sequence: - 1110zzzz 10yyyyyy 10xxxxxx => zzzzyyyy yyxxxxxx */ - register uchar byte2; - register uchar byte3; - if (inLen < 3) { - if (inLen == 2 && (pIn[1] & 0xC0) != 0x80) - errno=EILSEQ; /* 116 */ - else - errno=EINVAL; /* 22 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - *numSub+=numS; - return -1; - } - ++pIn; - byte2=*pIn; - ++pIn; - byte3=*pIn; - if ((byte2 & 0xC0) != 0x80 || - (byte3 & 0xC0) != 0x80 || - (byte1 == 0xE0 && byte2 < 0xA0)) { /* invalid sequence, only 0xA0-0xBF allowed after 0xE0 */ - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn-2; - *numSub+=numS; - return -1; - } - { - register uchar work=byte2; - work<<=6; - byte3&=0x3F; /* 0b00111111; */ - byte3|=work; - - byte2&=0x3F; /* 0b00111111; */ - byte2>>=2; - - byte1<<=4; - *pOut=byte1 | byte2;; - ++pOut; - *pOut=byte3; - ++pOut; - inLen-=3; - ++pIn; - } - } else if ((0xF0 <= byte1 && byte1 <= 0xF4) || /* (bytes1 & 11111000) == 0x1110000 */ - ((byte1&=0xF7) && 0xF0 <= byte1 && byte1 <= 0xF4)) { /* minic iconv() behavior */ - /* 4 bytes sequence - 11110uuu 10uuzzzz 10yyyyyy 10xxxxxx => 110110ww wwzzzzyy 110111yy yyxxxxxx - where uuuuu = wwww + 1 */ - register uchar byte2; - register uchar byte3; - register uchar byte4; - if (inLen < 4 || cd->toCcsid == 13488) { - if ((inLen >= 2 && (pIn[1] & 0xC0) != 0x80) || - (inLen >= 3 && (pIn[2] & 0xC0) != 0x80) || - (cd->toCcsid == 13488) ) - errno=EILSEQ; /* 116 */ - else - errno=EINVAL; /* 22 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - *numSub+=numS; - return -1; - } - ++pIn; - byte2=*pIn; - ++pIn; - byte3=*pIn; - ++pIn; - byte4=*pIn; - if ((byte2 & 0xC0) == 0x80 && /* byte2 & 0b11000000 == 0b10000000 */ - (byte3 & 0xC0) == 0x80 && /* byte3 & 0b11000000 == 0b10000000 */ - (byte4 & 0xC0) == 0x80) { /* byte4 & 0b11000000 == 0b10000000 */ - register uchar work=byte2; - if (byte1 == 0xF0 && byte2 < 0x90) { - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn-3; - *numSub+=numS; - return -1; - } else if (byte1 == 0xF4 && byte2 > 0x8F) { - errno=EINVAL; /* 22 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn-3; - *numSub+=numS; - return -1; - } - - work&=0x30; /* 0b00110000; */ - work>>=4; - byte1&=0x07; /* 0b00000111; */ - byte1<<=2; - byte1+=work; /* uuuuu */ - --byte1; /* wwww */ - - work=byte1 & 0x0F; - work>>=2; - work+=0xD8; /* 0b11011011; */ - *pOut=work; - ++pOut; - - byte1<<=6; - byte2<<=2; - byte2&=0x3C; /* 0b00111100; */ - work=byte3; - work>>=4; - work&=0x03; /* 0b00000011; */ - work|=byte1; - work|=byte2; - *pOut=work; - ++pOut; - - work=byte3; - work>>=2; - work&=0x03; /* 0b00000011; */ - work|=0xDC; /* 0b110111xx; */ - *pOut=work; - ++pOut; - - byte3<<=6; - byte4&=0x3F; /* 0b00111111; */ - byte4|=byte3; - *pOut=byte4; - ++pOut; - inLen-=4; - ++pIn; - } else { /* invalid sequence */ - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn-3; - *numSub+=numS; - return -1; - } - } else if ((byte1 & 0xF0) == 0xF0) { - if (cd->toCcsid == 13488) { - errno=EILSEQ; /* 116 */ - } else { - if (inLen == 1) - errno=EINVAL; /* 22 */ - else if (inLen == 2 && (pIn[1] & 0xC0) != 0x80) - errno=EILSEQ; /* 116 */ - else if (inLen == 3 && ((pIn[1] & 0xC0) != 0x80 || (pIn[2] & 0xC0) != 0x80)) - errno=EILSEQ; /* 116 */ - else if (inLen >= 4 && ((pIn[1] & 0xC0) != 0x80 || (pIn[2] & 0xC0) != 0x80 || (pIn[3] & 0xC0) != 0x80)) - errno=EILSEQ; /* 116 */ - else - errno=EINVAL; /* 22 */ - } - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - *numSub+=numS; - return -1; - - } else { /* invalid sequence */ - errno=EILSEQ; /* 116 */ - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - *numSub+=numS; - return -1; - } - } - } - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - *numSub+=numS; - return 0; - } else if (cd->cnv_dmap->codingSchema == DMAP_U28) { - /* See http://unicode.org/versions/corrigendum1.html */ - register int inLen=*inBytesLeft; - register char * pOut=*outBuf; - register char * pIn=*inBuf; - register char * pLastOutBuf = *outBuf + *outBytesLeft - 1; - // register size_t numS=0; - while (0 < inLen) { - register uint32_t in; - if (inLen == 1) { - errno=EINVAL; /* 22 */ - *inBytesLeft=inLen; - *outBytesLeft-=(pOut-*outBuf); - *outBuf=pOut; - *inBuf=pIn; - return -1; - } - if (pLastOutBuf < pOut) - break; - in=pIn[0]; - in<<=8; - in+=pIn[1]; - if (in == 0x0000) { - *pOut=0x00; - ++pOut; - } else if ((in & 0xFF80) == 0x0000) { /* U28: in & 0b1111111110000000 == 0x0000 */ - *pOut=in; - ++pOut; - } else if ((in & 0xF800) == 0x0000) { /* in & 0b1111100000000000 == 0x0000 */ - register uchar byte; - in>>=6; - in&=0x001F; /* 0b0000000000011111 */ - in|=0x00C0; /* 0b0000000011000000 */ - *pOut=in; - ++pOut; - byte=pIn[1]; - byte&=0x3F; /* 0b00111111; */ - byte|=0x80; /* 0b10000000; */ - *pOut=byte; - ++pOut; - } else { - register uchar byte; - register uchar work; - byte=pIn[0]; - byte>>=4; - byte|=0xE0; /* 0b11100000; */ - *pOut=byte; - ++pOut; - - byte=pIn[0]; - byte<<=2; - work=pIn[1]; - work>>=6; - byte|=work; - byte&=0x3F; /* 0b00111111; */ - byte|=0x80; /* 0b10000000; */ - *pOut=byte; - ++pOut; - - byte=pIn[1]; - byte&=0x3F; /* 0b00111111; */ - byte|=0x80; /* 0b10000000; */ - *pOut=byte; - ++pOut; - } - pIn+=2; - inLen-=2; - } - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - // *numSub+=numS; - return 0; - - } else if (cd->cnv_dmap->codingSchema == DMAP_T28) { /* UTF-16_UTF-8 */ - /* See http://unicode.org/versions/corrigendum1.html */ - register int inLen=*inBytesLeft; - register char * pOut=*outBuf; - register char * pIn=*inBuf; - register char * pLastOutBuf = *outBuf + *outBytesLeft - 1; - // register size_t numS=0; - while (0 < inLen) { - register uint32_t in; - if (inLen == 1) { - errno=EINVAL; /* 22 */ - *inBytesLeft=0; - *outBytesLeft-=(pOut-*outBuf); - *outBuf=pOut; - *inBuf=pIn; - return 0; - } - if (pLastOutBuf < pOut) - break; - in=pIn[0]; - in<<=8; - in+=pIn[1]; - if (in == 0x0000) { - *pOut=0x00; - ++pOut; - } else if ((in & 0xFF80) == 0x0000) { /* U28: in & 0b1111111110000000 == 0x0000 */ - *pOut=in; - ++pOut; - } else if ((in & 0xF800) == 0x0000) { /* in & 0b1111100000000000 == 0x0000 */ - register uchar byte; - in>>=6; - in&=0x001F; /* 0b0000000000011111 */ - in|=0x00C0; /* 0b0000000011000000 */ - *pOut=in; - ++pOut; - byte=pIn[1]; - byte&=0x3F; /* 0b00111111; */ - byte|=0x80; /* 0b10000000; */ - *pOut=byte; - ++pOut; - } else if ((in & 0xFC00) == 0xD800) { /* in & 0b1111110000000000 == 0b1101100000000000, first surrogate character */ - if (0xDC00 <= in ) { - errno=EINVAL; /* 22 */ - *inBytesLeft=inLen-1; - *outBytesLeft-=(pOut-*outBuf); - *outBuf=pOut; - *inBuf=pIn; - return -1; - - } else if (inLen < 4) { - errno=EINVAL; /* 22 */ - *inBytesLeft=inLen-2; - *outBytesLeft-=(pOut-*outBuf); - *outBuf=pOut; - *inBuf=pIn+2; - return -1; - - } else if ((pIn[2] & 0xFC) != 0xDC) { /* pIn[2] & 0b11111100 == 0b11011100, second surrogate character */ - errno=EINVAL; /* 22 */ - *inBytesLeft=inLen-2; - *outBytesLeft-=(pOut-*outBuf); - *outBuf=pOut; - *inBuf=pIn+2; - return -1; - - } else { - register uchar byte; - register uchar work; - in>>=6; - in&=0x000F; /* 0b0000000000001111 */ - byte=in; /* wwww */ - ++byte; /* uuuuu */ - work=byte; /* save uuuuu */ - byte>>=2; - byte|=0xF0; /* 0b11110000; */ - *pOut=byte; - ++pOut; - - byte=work; - byte&=0x03; /* 0b00000011; */ - byte<<=4; - byte|=0x80; /* 0b10000000; */ - work=pIn[1]; - work&=0x3C; /* 0b00111100; */ - work>>=2; - byte|=work; - *pOut=byte; - ++pOut; - - byte=pIn[1]; - byte&=0x03; /* 0b00000011; */ - byte<<=4; - byte|=0x80; /* 0b10000000; */ - work=pIn[2]; - work&=0x03; /* 0b00000011; */ - work<<=2; - byte|=work; - work=pIn[3]; - work>>=6; - byte|=work; - *pOut=byte; - ++pOut; - - byte=pIn[3]; - byte&=0x3F; /* 0b00111111; */ - byte|=0x80; /* 0b10000000; */ - *pOut=byte; - ++pOut; - pIn+=2; - inLen-=2; - } - } else if ((in & 0xFC00) == 0xDC00) { /* in & 0b11111100 == 0b11011100, second surrogate character */ - errno=EINVAL; /* 22 */ - *inBytesLeft=inLen-1; - *outBytesLeft-=(pOut-*outBuf); - *outBuf=pOut; - *inBuf=pIn; - return -1; - - } else { - register uchar byte; - register uchar work; - byte=pIn[0]; - byte>>=4; - byte|=0xE0; /* 0b11100000; */ - *pOut=byte; - ++pOut; - - byte=pIn[0]; - byte<<=2; - work=pIn[1]; - work>>=6; - byte|=work; - byte&=0x3F; /* 0b00111111; */ - byte|=0x80; /* 0b10000000; */ - *pOut=byte; - ++pOut; - - byte=pIn[1]; - byte&=0x3F; /* 0b00111111; */ - byte|=0x80; /* 0b10000000; */ - *pOut=byte; - ++pOut; - } - pIn+=2; - inLen-=2; - } - *outBytesLeft-=(pOut-*outBuf); - *inBytesLeft=inLen; - *outBuf=pOut; - *inBuf=pIn; - // *numSub+=numS; - return 0; - - } else if (cd->cnv_dmap->codingSchema == DMAP_U2U) { /* UTF-16_UCS-2 */ - register int inLen=*inBytesLeft; - register int outLen=*outBytesLeft; - if (inLen <= outLen) { - memcpy(*outBuf, *inBuf, inLen); - (*outBytesLeft)-=inLen; - (*inBuf)+=inLen; - (*outBuf)+=inLen; - *inBytesLeft=0; - return 0; - } - memcpy(*outBuf, *inBuf, outLen); - (*outBytesLeft)=0; - (*inBuf)+=outLen; - (*outBuf)+=outLen; - *inBytesLeft-=outLen; - return (*inBytesLeft); - - } else { - return -1; - } - return 0; -} - - -#ifdef DEBUG -inline size_t myconv(myconv_t cd , - char** inBuf, - size_t* inBytesLeft, - char** outBuf, - size_t* outBytesLeft, - size_t* numSub) -{ - if (cd->converterType == CONVERTER_ICONV) { - return myconv_iconv(cd,inBuf,inBytesLeft,outBuf,outBytesLeft,numSub); - } else if (cd->converterType == CONVERTER_DMAP) { - return myconv_dmap(cd,inBuf,inBytesLeft,outBuf,outBytesLeft,numSub); - } - return -1; -} - -inline char * converterName(int32_t type) -{ - if (type == CONVERTER_ICONV) - return "iconv"; - else if (type == CONVERTER_DMAP) - return "dmap"; - - return "?????"; -} -#else -#define myconv(a,b,c,d,e,f) \ -(((a)->converterType == CONVERTER_ICONV)? myconv_iconv((a),(b),(c),(d),(e),(f)): (((a)->converterType == CONVERTER_DMAP)? myconv_dmap((a),(b),(c),(d),(e),(f)): -1)) - - -#define converterName(a) \ -(((a) == CONVERTER_ICONV)? "iconv": ((a) == CONVERTER_DMAP)? "dmap": "?????") -#endif - -void initMyconv(); -void cleanupMyconv(); - -#endif diff --git a/storage/ibmdb2i/db2i_rir.cc b/storage/ibmdb2i/db2i_rir.cc deleted file mode 100644 index 091c4d98383..00000000000 --- a/storage/ibmdb2i/db2i_rir.cc +++ /dev/null @@ -1,686 +0,0 @@ -/* -Licensed Materials - Property of IBM -DB2 Storage Engine Enablement -Copyright IBM Corporation 2007,2008 -All rights reserved - -Redistribution and use in source and binary forms, with or without modification, -are permitted provided that the following conditions are met: - (a) Redistributions of source code must retain this list of conditions, the - copyright notice in section {d} below, and the disclaimer following this - list of conditions. - (b) Redistributions in binary form must reproduce this list of conditions, the - copyright notice in section (d) below, and the disclaimer following this - list of conditions, in the documentation and/or other materials provided - with the distribution. - (c) The name of IBM may not be used to endorse or promote products derived from - this software without specific prior written permission. - (d) The text of the required copyright notice is: - Licensed Materials - Property of IBM - DB2 Storage Engine Enablement - Copyright IBM Corporation 2007,2008 - All rights reserved - -THIS SOFTWARE IS PROVIDED BY IBM CORPORATION "AS IS" AND ANY EXPRESS OR IMPLIED -WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF -MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT -SHALL IBM CORPORATION BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, -EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT -OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS -INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN -CONTRACT, STRICT LIABILITY, OR TORT INCLUDING NEGLIGENCE OR OTHERWISE) ARISING -IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY -OF SUCH DAMAGE. -*/ - - -#include "ha_ibmdb2i.h" - -/* Helper function for records_in_range. - Input: Bitmap of used key parts. - Output: Number of used key parts. */ - -static inline int getKeyCntFromMap(key_part_map keypart_map) -{ - int cnt = 0; - while (keypart_map) - { - keypart_map = keypart_map >> 1; - cnt++; - } - return (cnt); -} - -/** - @brief - Given a starting key and an ending key, estimate the number of rows that - will exist between the two keys. - - INPUT - inx Index to use - min_key Min key. Is NULL if no min range - max_key Max key. Is NULL if no max range - - NOTES - min_key.flag can have one of the following values: - HA_READ_KEY_EXACT Include the key in the range - HA_READ_AFTER_KEY Don't include key in range - - max_key.flag can have one of the following values: - HA_READ_BEFORE_KEY Don't include key in range - HA_READ_AFTER_KEY Include all 'end_key' values in the range - - RETURN - HA_POS_ERROR Error or the storage engine cannot estimate the number of rows - 1 There are no matching keys in the given range - n > 0 There are approximately n rows in the range -*/ -ha_rows ha_ibmdb2i::records_in_range(uint inx, - key_range *min_key, - key_range *max_key) -{ - DBUG_ENTER("ha_ibmdb2i::records_in_range"); - int rc = 0; // Return code - ha_rows rows = 0; // Row count returned to caller of this method - uint32 spcLen; // Length of space passed to DB2 - uint32 keyCnt; // Number of fields in the key composite - uint32 literalCnt = 0; // Number of literals - uint32 boundsOff; // Offset from beginning of space to range bounds - uint32 litDefOff; // Offset from beginning of space to literal definitions - uint32 literalsOff; // Offset from beginning of space to literal values - uint32 cutoff = 0; // Early exit cutoff (currently not used) - uint64 recCnt; // Row count from DB2 - uint16 rtnCode; // Return code from DB2 - Bounds* boundsPtr; // Pointer to a pair of range bounds - Bound* boundPtr; // Pointer to a single (high or low) range bound - LitDef* litDefPtr; // Pointer to a literal definition - char* literalsPtr; // Pointer to the start of all literal values - char* literalPtr; // Pointer to the start of this literal value - char* tempPtr; // Temporary pointer - char* tempMinPtr; // Temporary pointer into min_key - int minKeyCnt = 0; // Number of fields in the min_key composite - int maxKeyCnt = 0; // Number of fields in the max_key composite - size_t tempLen = 0; // Temporary length - uint16 DB2FieldWidth = 0; // DB2 field width - uint32 workFieldLen = 0; // Length of workarea needed for CCSID conversions - bool overrideInclusion; // Indicator for inclusion/exclusion - char* endOfLiteralPtr; // Pointer to the end of this literal - char* endOfMinPtr; // Pointer to end of min_key - uint16 endByte = 0; // End byte of char or graphic literal (padding not included) - bool reuseLiteral; // Indicator that hi and lo bounds use same literal - char* minPtr = NULL; // Work pointer for traversing min_key - char* maxPtr = NULL; // Work pointer for traversing max_key - /* - Handle the special case of 'x < null' anywhere in the key range. There are - no values less than null, but return 1 so that MySQL does not assume - the empty set for the query. - */ - if (min_key != NULL && max_key != NULL && - min_key->flag == HA_READ_AFTER_KEY && max_key->flag == HA_READ_BEFORE_KEY && - min_key->length == max_key->length && - (memcmp((uchar*)min_key->key,(uchar*)max_key->key,min_key->length)==0)) - { - DBUG_PRINT("ha_ibmdb2i::records_in_range",("Estimate 1 row for key %d; special case: < null", inx)); - DBUG_RETURN((ha_rows) 1 ); - } - /* - Determine the number of fields in the key composite. - */ - - if (min_key) - { - minKeyCnt = getKeyCntFromMap(min_key->keypart_map); - minPtr = (char*)min_key->key; - } - if (max_key) - { - maxKeyCnt = getKeyCntFromMap(max_key->keypart_map); - maxPtr = (char*)max_key->key; - } - keyCnt = maxKeyCnt >= minKeyCnt ? maxKeyCnt : minKeyCnt; - - /* - Handle the special case where MySQL does not pass either a min or max - key range. In this case, set the key count to 1 (knowing that there - is at least one key field) to flow through and create one bounds structure. - When both the min and max key ranges are nil, the bounds structure will - specify positive and negative infinity and DB2 will estimate the total - number of rows. */ - - if (keyCnt == 0) - keyCnt = 1; - - /* - Allocate the space needed to pass range information to DB2. The - space must be large enough to store the following: - - one pair of bounds (high and low) per field in the key composite - - one literal definition per literal value - - the literal values - - work area for literal CCSID conversions - Since we don't know yet how many of these structures are needed, - allocate enough space for the maximum that we will possibly need. - The workarea for the literal conversion must be big enough to hold the - largest of the DB2 key fields. - */ - KEY& curKey = table->key_info[inx]; - - for (int i = 0; i < keyCnt; i++) - { - DB2FieldWidth = - db2Table->db2Field(curKey.key_part[i].field->field_index).getByteLengthInRecord(); - if (DB2FieldWidth > workFieldLen) - workFieldLen = DB2FieldWidth; // Get length of largest DB2 field - tempLen = tempLen + DB2FieldWidth; // Tally the DB2 field lengths - } - spcLen = (sizeof(Bounds)*keyCnt) + (sizeof(LitDef)*keyCnt*2) + (tempLen*2) + workFieldLen; - - ValidatedPointer spcPtr(spcLen); // Pointer to space passed to DB2 - memset(spcPtr, 0, spcLen); // Clear the allocated space - /* - Set addressability to the various sections of the DB2 interface space. - */ - boundsOff = 0; // Range bounds are at the start of the space - litDefOff = sizeof(Bounds) * keyCnt; // Literal defs follow all the range bounds - literalsOff = litDefOff + (sizeof(LitDef) * keyCnt * 2); // Literal values are last - boundsPtr = (Bounds_t*)(void*)spcPtr; // Address first bounds structure - tempPtr = (char*)((char*)spcPtr + litDefOff); - litDefPtr = (LitDef_t*)tempPtr; // Address first literal definition - tempPtr = (char*)((char*)spcPtr + literalsOff); - literalsPtr = (char*)tempPtr; // Address start of literal values - literalPtr = literalsPtr; // Address first literal value - /* - For each key part, build the low (min) and high (max) DB2 range bounds. - If literals are specified in the MySQL range, build DB2 literal - definitions and store the literal values for access by DB2. - - If no value is specified for a key part, assume infinity. Negative - infinity will cause processing to start at the first index entry. - Positive infinity will cause processing to end at the last index entry. - When infinity is specified in a bound, inclusion/exclusion and position - are ignored, and there is no literal definition or literal value for - the bound. - - If the keypart value is null, the null indicator is set in the range - bound and the other fields in the bound are ignored. When the bound is - null, only index entries with the null value will be included in the - estimate. If one bound is null, both bounds must be null. When the bound - is not null, the data offset and length must be set, and the literal - value stored for access by DB2. - */ - for (int partsInUse = 0; partsInUse < keyCnt; ++partsInUse) - { - Field *field= curKey.key_part[partsInUse].field; - overrideInclusion = false; - reuseLiteral = false; - endOfLiteralPtr = NULL; - /* - Build the low bound for the key range. - */ - if ((partsInUse + 1) > minKeyCnt) // if no min_key info for this part - boundsPtr->LoBound.Infinity[0] = QMY_NEG_INFINITY; // select...where 3 between x and y - else - { - if ((curKey.key_part[partsInUse].null_bit) && (char*)minPtr[0]) - { // min_key is null - if (max_key == NULL || - ((partsInUse + 1) > maxKeyCnt)) // select...where x='ab' and y=null and z != 'c' - boundsPtr->LoBound.Infinity[0] = QMY_NEG_INFINITY; // select...where x not null or - // select...where x > null - else // max_key is not null - { - if (min_key->flag == HA_READ_KEY_EXACT) - boundsPtr->LoBound.IsNull[0] = QMY_YES; // select...where x is null - else - { - if ((char*)maxPtr[0]) - boundsPtr->LoBound.IsNull[0] = QMY_YES; // select...where a = null and b < 5 (max-before) - // select...where a='a' and b is null and c !='a' (max-after) - else - boundsPtr->LoBound.Infinity[0] = QMY_NEG_INFINITY; // select...where x < y - } - } // end min_key is null - } - else // min_key is not null - { - if (literalCnt) litDefPtr = litDefPtr + 1; - literalCnt = literalCnt + 1; - boundsPtr->LoBound.Position = literalCnt; - /* - Determine inclusion or exclusion. - */ - if (min_key->flag == HA_READ_KEY_EXACT || //select...where a like 'this%' - - /* An example for the following conditions is 'select...where a = 5 and b > null'. */ - - (max_key && - (memcmp((uchar*)minPtr,(uchar*)maxPtr, - curKey.key_part[partsInUse].store_length)==0))) - - { - if ((min_key->flag != HA_READ_KEY_EXACT) || - (max_key && - (memcmp((uchar*)minPtr,(uchar*)maxPtr, - curKey.key_part[partsInUse].store_length)==0))) - overrideInclusion = true; // Need inclusion for both min and max - } - else - boundsPtr->LoBound.Embodiment[0] = QMY_EXCLUSION; - litDefPtr->FieldNbr = field->field_index + 1; - DB2Field& db2Field = db2Table->db2Field(field->field_index); - litDefPtr->DataType = db2Field.getType(); - /* - Convert the literal to DB2 format - */ - if ((field->type() != MYSQL_TYPE_BIT) && // Don't do conversion on BIT data - (field->charset() != &my_charset_bin) && // Don't do conversion on BINARY data - (litDefPtr->DataType == QMY_CHAR || - litDefPtr->DataType == QMY_VARCHAR || - litDefPtr->DataType == QMY_GRAPHIC || - litDefPtr->DataType == QMY_VARGRAPHIC)) - { - // Most of the code is required by the considerable wrangling needed - // to prepare partial keys for use by DB2 - // 1. UTF8 (CCSID 1208) data can be copied across unmodified if it is - // utf8_bin. Otherwise, we need to convert the min and max - // characters into the min and max characters employed - // by the DB2 sort sequence. This is complicated by the fact that - // the character widths are not always equal. - // 2. Likewise, UCS2 (CCSID 13488) data can be copied across unmodified - // if it is ucs2_bin or ucs2_general_ci. Otherwise, we need to - // convert the min and max characters into the min and max characters - // employed by the DB2 sort sequence. - // 3. All other data will use standard iconv conversions. If an - // unconvertible character is encountered, we assume it is the min - // char and fill the remainder of the DB2 key with 0s. This may not - // always be accurate, but it is probably sufficient for range - // estimations. - const char* keyData = minPtr+((curKey.key_part[partsInUse].null_bit)? 1 : 0); - char* db2Data = literalPtr; - uint16 outLen = db2Field.getByteLengthInRecord(); - uint16 inLen; - if (litDefPtr->DataType == QMY_VARCHAR || - litDefPtr->DataType == QMY_VARGRAPHIC) - { - inLen = *(uint8*)keyData + ((*(uint8*)(keyData+1)) << 8); - keyData += 2; - outLen -= sizeof(uint16); - db2Data += sizeof(uint16); - } - else - { - inLen = field->max_display_length(); - } - - size_t convertedBytes = 0; - if (db2Field.getCCSID() == 1208) - { - DBUG_ASSERT(inLen <= outLen); - if (strcmp(field->charset()->name, "utf8_bin")) - { - const char* end = keyData+inLen; - const char* curKey = keyData; - char* curDB2 = db2Data; - uint32 min = field->charset()->min_sort_char; - while ((curKey < end) && (curDB2 < db2Data+outLen-3)) - { - my_wc_t temp; - int len = field->charset()->cset->mb_wc(field->charset(), - &temp, - (const uchar*)curKey, - (const uchar*)end); - if (temp != min) - { - DBUG_ASSERT(len <= 3); - switch (len) - { - case 3: *(curDB2+2) = *(curKey+2); - case 2: *(curDB2+1) = *(curKey+1); - case 1: *(curDB2) = *(curKey); - } - curDB2 += len; - } - else - { - *(curDB2++) = 0xEF; - *(curDB2++) = 0xBF; - *(curDB2++) = 0xBF; - } - curKey += len; - } - convertedBytes = curDB2 - db2Data; - } - else - { - memcpy(db2Data, keyData, inLen); - convertedBytes = inLen; - } - rc = 0; - } - else if (db2Field.getCCSID() == 13488) - { - DBUG_ASSERT(inLen <= outLen); - if (strcmp(field->charset()->name, "ucs2_bin") && - strcmp(field->charset()->name, "ucs2_general_ci")) - { - const char* end = keyData+inLen; - const uint16* curKey = (uint16*)keyData; - uint16* curDB2 = (uint16*)db2Data; - uint16 min = field->charset()->min_sort_char; - while (curKey < (uint16*)end) - { - if (*curKey != min) - *curDB2 = *curKey; - else - *curDB2 = 0xFFFF; - ++curKey; - ++curDB2; - } - } - else - { - memcpy(db2Data, keyData, inLen); - } - convertedBytes = inLen; - rc = 0; - } - else - { - rc = convertFieldChars(toDB2, - field->field_index, - keyData, - db2Data, - inLen, - outLen, - &convertedBytes, - true); - - if (rc == DB2I_ERR_ILL_CHAR) - { - // If an illegal character is encountered, we fill the remainder - // of the key with 0x00. This was implemented as a corollary to - // Bug#45012, though it should probably remain even after that - // bug is fixed. - memset(db2Data+convertedBytes, 0x00, outLen-convertedBytes); - convertedBytes = outLen; - rc = 0; - } - } - - if (!rc && - (litDefPtr->DataType == QMY_VARGRAPHIC || - litDefPtr->DataType == QMY_VARCHAR)) - { - *(uint16*)(db2Data-sizeof(uint16)) = - convertedBytes / (litDefPtr->DataType == QMY_VARGRAPHIC ? 2 : 1); - } - - } - else // Non-character fields - { - rc = convertMySQLtoDB2(field, - db2Field, - literalPtr, - (uchar*)minPtr+((curKey.key_part[partsInUse].null_bit)? 1 : 0)); - } - - if (rc != 0) break; - litDefPtr->Offset = (uint32_t)(literalPtr - literalsPtr); - litDefPtr->Length = db2Field.getByteLengthInRecord(); - literalPtr = literalPtr + litDefPtr->Length; // Bump pointer for next literal - } - /* If there is a max_key value for this field, and if the max_key value is - the same as the min_key value, then the low bound literal can be reused - for the high bound literal. This eliminates the overhead of copying and - converting the same value twice. */ - if (max_key && ((partsInUse + 1) <= maxKeyCnt) && - (memcmp((uchar*)minPtr,(uchar*)maxPtr, - curKey.key_part[partsInUse].store_length)==0 || endOfLiteralPtr)) - reuseLiteral = true; - minPtr += curKey.key_part[partsInUse].store_length; - } - /* - Build the high bound for the key range. - */ - if (max_key == NULL || ((partsInUse + 1) > maxKeyCnt)) - boundsPtr->HiBound.Infinity[0] = QMY_POS_INFINITY; - else - { - if ((curKey.key_part[partsInUse].null_bit) && (char*)maxPtr[0]) - { - if (min_key == NULL) - boundsPtr->HiBound.Infinity[0] = QMY_POS_INFINITY; - else - boundsPtr->HiBound.IsNull[0] = QMY_YES; // select...where x is null - } - else // max_key field is not null - { - if (boundsPtr->LoBound.IsNull[0] == QMY_YES) // select where x < 10 or x is null - { - rc = HA_POS_ERROR; - break; - } - if (!reuseLiteral) - { - if (literalCnt) - litDefPtr = litDefPtr + 1; - literalCnt = literalCnt + 1; - litDefPtr->FieldNbr = field->field_index + 1; - DB2Field& db2Field = db2Table->db2Field(field->field_index); - litDefPtr->DataType = db2Field.getType(); - /* - Convert the literal to DB2 format - */ - if ((field->type() != MYSQL_TYPE_BIT) && // Don't do conversion on BIT data - (field->charset() != &my_charset_bin) && // Don't do conversion on BINARY data - (litDefPtr->DataType == QMY_CHAR || - litDefPtr->DataType == QMY_VARCHAR || - litDefPtr->DataType == QMY_GRAPHIC || - litDefPtr->DataType == QMY_VARGRAPHIC)) - { - // We need to handle char fields in a special way in order to account - // for partial keys. Refer to the note above for a description of the - // basic design. - char* keyData = maxPtr+((curKey.key_part[partsInUse].null_bit)? 1 : 0); - char* db2Data = literalPtr; - uint16 outLen = db2Field.getByteLengthInRecord(); - uint16 inLen; - if (litDefPtr->DataType == QMY_VARCHAR || - litDefPtr->DataType == QMY_VARGRAPHIC) - { - inLen = *(uint8*)keyData + ((*(uint8*)(keyData+1)) << 8); - keyData += 2; - outLen -= sizeof(uint16); - db2Data += sizeof(uint16); - } - else - { - inLen = field->max_display_length(); - } - - size_t convertedBytes; - if (db2Field.getCCSID() == 1208) - { - if (strcmp(field->charset()->name, "utf8_bin")) - { - const char* end = keyData+inLen; - const char* curKey = keyData; - char* curDB2 = db2Data; - uint32 max = field->charset()->max_sort_char; - while (curKey < end && (curDB2 < db2Data+outLen-3)) - { - my_wc_t temp; - int len = field->charset()->cset->mb_wc(field->charset(), &temp, (const uchar*)curKey, (const uchar*)end); - if (temp != max) - { - DBUG_ASSERT(len <= 3); - switch (len) - { - case 3: *(curDB2+2) = *(curKey+2); - case 2: *(curDB2+1) = *(curKey+1); - case 1: *(curDB2) = *(curKey); - } - curDB2 += len; - } - else - { - *(curDB2++) = 0xE4; - *(curDB2++) = 0xB6; - *(curDB2++) = 0xBF; - } - curKey += len; - } - convertedBytes = curDB2 - db2Data; - } - else - { - DBUG_ASSERT(inLen <= outLen); - memcpy(db2Data, keyData, inLen); - convertedBytes = inLen; - } - rc = 0; - } - else if (db2Field.getCCSID() == 13488) - { - if (strcmp(field->charset()->name, "ucs2_bin") && - strcmp(field->charset()->name, "ucs2_general_ci")) - { - char* end = keyData+inLen; - uint16* curKey = (uint16*)keyData; - uint16* curDB2 = (uint16*)db2Data; - uint16 max = field->charset()->max_sort_char; - while (curKey < (uint16*)end) - { - if (*curKey != max) - *curDB2 = *curKey; - else - *curDB2 = 0x4DBF; - ++curKey; - ++curDB2; - } - } - else - { - memcpy(db2Data, keyData, outLen); - } - rc = 0; - } - else - { - size_t substituteChars = 0; - rc = convertFieldChars(toDB2, - field->field_index, - keyData, - db2Data, - inLen, - outLen, - &convertedBytes, - true, - &substituteChars); - - if (rc == DB2I_ERR_ILL_CHAR) - { - // If an illegal character is encountered, we fill the remainder - // of the key with 0xFF. This was implemented to work around - // Bug#45012, though it should probably remain even after that - // bug is fixed. - memset(db2Data+convertedBytes, 0xFF, outLen-convertedBytes); - rc = 0; - } - else if ((substituteChars && - (litDefPtr->DataType == QMY_VARCHAR || - litDefPtr->DataType == QMY_CHAR)) || - strcmp(field->charset()->name, "cp1251_bulgarian_ci") == 0) - { - // When iconv translates the max_sort_char with a substitute - // character, we have no way to know whether this affects - // the sort order of the key. Therefore, to be safe, when - // we know that substitute characters have been used in a - // single-byte string, we traverse the translated key - // in reverse, replacing substitue characters with 0xFF, which - // always sorts with the greatest weight in DB2 sort sequences. - // cp1251_bulgarian_ci is also handled this way because the - // max_sort_char is a control character which does not sort - // equivalently in DB2. - DBUG_ASSERT(inLen == outLen); - char* tmpKey = keyData + inLen - 1; - char* tmpDB2 = db2Data + outLen - 1; - while (*tmpKey == field->charset()->max_sort_char && - *tmpDB2 != 0xFF) - { - *tmpDB2 = 0xFF; - --tmpKey; - --tmpDB2; - } - } - } - - if (!rc && - (litDefPtr->DataType == QMY_VARGRAPHIC || - litDefPtr->DataType == QMY_VARCHAR)) - { - *(uint16*)(db2Data-sizeof(uint16)) = - outLen / (litDefPtr->DataType == QMY_VARGRAPHIC ? 2 : 1); - } - } - else - { - rc = convertMySQLtoDB2(field, - db2Field, - literalPtr, - (uchar*)maxPtr+((curKey.key_part[partsInUse].null_bit)? 1 : 0)); - } - if (rc != 0) break; - litDefPtr->Offset = (uint32_t)(literalPtr - literalsPtr); - litDefPtr->Length = db2Field.getByteLengthInRecord(); - literalPtr = literalPtr + litDefPtr->Length; // Bump pointer for next literal - } - boundsPtr->HiBound.Position = literalCnt; - if (max_key->flag == HA_READ_BEFORE_KEY && !overrideInclusion) - boundsPtr->HiBound.Embodiment[0] = QMY_EXCLUSION; - } - maxPtr += curKey.key_part[partsInUse].store_length; - } - /* - Bump to the next field in the key composite. - */ - - if ((partsInUse+1) < keyCnt) - boundsPtr = boundsPtr + 1; - } - - /* - Call DB2 to estimate the number of rows in the key range. - */ - if (rc == 0) - { - rc = db2i_ileBridge::getBridgeForThread()->recordsInRange((indexHandles[inx] ? indexHandles[inx] : db2Table->indexFile(inx)->getMasterDefnHandle()), - spcPtr, - keyCnt, - literalCnt, - boundsOff, - litDefOff, - literalsOff, - cutoff, - (uint32_t)(literalPtr - (char*)spcPtr), - endByte, - &recCnt, - &rtnCode); - } - /* - Set the row count and return. - Beware that if this method returns a zero row count, MySQL assumes the - result set for the query is zero; never return a zero row count. - */ - if ((rc == 0) && (rtnCode == QMY_SUCCESS || rtnCode == QMY_EARLY_EXIT)) - { - rows = recCnt ? (ha_rows)recCnt : 1; - } - - rows = (rows > 0 ? rows : HA_POS_ERROR); - - setIndexReadEstimate(inx, rows); - - DBUG_PRINT("ha_ibmdb2i::recordsInRange",("Estimate %d rows for key %d", uint32(rows), inx)); - - DBUG_RETURN(rows); -} diff --git a/storage/ibmdb2i/db2i_safeString.h b/storage/ibmdb2i/db2i_safeString.h deleted file mode 100644 index e353316c8fc..00000000000 --- a/storage/ibmdb2i/db2i_safeString.h +++ /dev/null @@ -1,98 +0,0 @@ -/* -Licensed Materials - Property of IBM -DB2 Storage Engine Enablement -Copyright IBM Corporation 2007,2008 -All rights reserved - -Redistribution and use in source and binary forms, with or without modification, -are permitted provided that the following conditions are met: - (a) Redistributions of source code must retain this list of conditions, the - copyright notice in section {d} below, and the disclaimer following this - list of conditions. - (b) Redistributions in binary form must reproduce this list of conditions, the - copyright notice in section (d) below, and the disclaimer following this - list of conditions, in the documentation and/or other materials provided - with the distribution. - (c) The name of IBM may not be used to endorse or promote products derived from - this software without specific prior written permission. - (d) The text of the required copyright notice is: - Licensed Materials - Property of IBM - DB2 Storage Engine Enablement - Copyright IBM Corporation 2007,2008 - All rights reserved - -THIS SOFTWARE IS PROVIDED BY IBM CORPORATION "AS IS" AND ANY EXPRESS OR IMPLIED -WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF -MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT -SHALL IBM CORPORATION BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, -EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT -OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS -INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN -CONTRACT, STRICT LIABILITY, OR TORT INCLUDING NEGLIGENCE OR OTHERWISE) ARISING -IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY -OF SUCH DAMAGE. -*/ - - - -#ifndef DB2I_SAFESTRING_H -#define DB2I_SAFESTRING_H - - -#include -#include - -/** - @class SafeString - - This class was designed to provide safe, but lightweight, concatenation - operations C strings inside pre-allocated buffers. -*/ -class SafeString -{ -public: - SafeString(char* buffer, size_t size) : - allocSize(size), curPos(0), buf(buffer) - { - DBUG_ASSERT(size > 0); - buf[allocSize - 1] = 0xFF; // Set an overflow indicator - } - - char* ptr() { return buf; } - operator char*() { return buf; } - - SafeString& strcat(const char* str) - { - return this->strncat(str, strlen(str)); - } - - SafeString& strcat(char one) - { - if (curPos < allocSize - 2) - { - buf[curPos++] = one; - } - buf[curPos] = 0; - - return *this; - } - - SafeString& strncat(const char* str, size_t len) - { - uint64 amountToCopy = min((allocSize-1) - curPos, len); - memcpy(buf + curPos, str, amountToCopy); - curPos += amountToCopy; - buf[curPos] = 0; - return *this; - } - - bool overflowed() const { return (buf[allocSize - 1] == 0);} - -private: - char* buf; - uint64 curPos; - size_t allocSize; -}; - - -#endif diff --git a/storage/ibmdb2i/db2i_sqlStatementStream.cc b/storage/ibmdb2i/db2i_sqlStatementStream.cc deleted file mode 100644 index 92a8b03fd00..00000000000 --- a/storage/ibmdb2i/db2i_sqlStatementStream.cc +++ /dev/null @@ -1,86 +0,0 @@ -/* -Licensed Materials - Property of IBM -DB2 Storage Engine Enablement -Copyright IBM Corporation 2007,2008 -All rights reserved - -Redistribution and use in source and binary forms, with or without modification, -are permitted provided that the following conditions are met: - (a) Redistributions of source code must retain this list of conditions, the - copyright notice in section {d} below, and the disclaimer following this - list of conditions. - (b) Redistributions in binary form must reproduce this list of conditions, the - copyright notice in section (d) below, and the disclaimer following this - list of conditions, in the documentation and/or other materials provided - with the distribution. - (c) The name of IBM may not be used to endorse or promote products derived from - this software without specific prior written permission. - (d) The text of the required copyright notice is: - Licensed Materials - Property of IBM - DB2 Storage Engine Enablement - Copyright IBM Corporation 2007,2008 - All rights reserved - -THIS SOFTWARE IS PROVIDED BY IBM CORPORATION "AS IS" AND ANY EXPRESS OR IMPLIED -WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF -MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT -SHALL IBM CORPORATION BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, -EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT -OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS -INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN -CONTRACT, STRICT LIABILITY, OR TORT INCLUDING NEGLIGENCE OR OTHERWISE) ARISING -IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY -OF SUCH DAMAGE. -*/ - - -#include "db2i_sqlStatementStream.h" -#include "as400_types.h" - -/** - Add a statement to the statement stream, allocating additional memory as needed. - - @parm stmt The statement text - @parm length The length of the statement text - @parm fileSortSequence The DB2 sort sequence identifier, in EBCDIC - @parm fileSortSequenceLibrary The DB2 sort sequence library, in EBCDIC - - @return Reference to this object -*/ -SqlStatementStream& SqlStatementStream::addStatementInternal(const char* stmt, - uint32 length, - const char* fileSortSequence, - const char* fileSortSequenceLibrary) -{ - uint32 storageNeeded = length + sizeof(StmtHdr_t); - storageNeeded = (storageNeeded + 3) & ~3; // We have to be 4-byte aligned. - if (storageNeeded > storageRemaining()) - { - // We overallocate new storage to reduce number of times reallocation is - // needed. - int newSize = curSize + 2 * storageNeeded; - DBUG_PRINT("SqlStatementStream::addStatementInternal", - ("PERF: Had to realloc! Old size=%d. New size=%d", curSize, newSize)); - char* old_space = block; - char* new_space = (char*)getNewSpace(newSize); - memcpy(new_space, old_space, curSize); - ptr = new_space + (ptr - old_space); - curSize = newSize; - } - - DBUG_ASSERT((address64_t)ptr % 4 == 0); - - memcpy(((StmtHdr_t*)ptr)->SrtSeqNam, - fileSortSequence, - sizeof(((StmtHdr_t*)ptr)->SrtSeqNam)); - memcpy(((StmtHdr_t*)ptr)->SrtSeqSch, - fileSortSequenceLibrary, - sizeof(((StmtHdr_t*)ptr)->SrtSeqSch)); - ((StmtHdr_t*)ptr)->Length = length; - memcpy(ptr + sizeof(StmtHdr_t), stmt, length); - - ptr += storageNeeded; - ++statements; - - return *this; -} diff --git a/storage/ibmdb2i/db2i_sqlStatementStream.h b/storage/ibmdb2i/db2i_sqlStatementStream.h deleted file mode 100644 index 11db41a6c5d..00000000000 --- a/storage/ibmdb2i/db2i_sqlStatementStream.h +++ /dev/null @@ -1,151 +0,0 @@ -/* -Licensed Materials - Property of IBM -DB2 Storage Engine Enablement -Copyright IBM Corporation 2007,2008 -All rights reserved - -Redistribution and use in source and binary forms, with or without modification, -are permitted provided that the following conditions are met: - (a) Redistributions of source code must retain this list of conditions, the - copyright notice in section {d} below, and the disclaimer following this - list of conditions. - (b) Redistributions in binary form must reproduce this list of conditions, the - copyright notice in section (d) below, and the disclaimer following this - list of conditions, in the documentation and/or other materials provided - with the distribution. - (c) The name of IBM may not be used to endorse or promote products derived from - this software without specific prior written permission. - (d) The text of the required copyright notice is: - Licensed Materials - Property of IBM - DB2 Storage Engine Enablement - Copyright IBM Corporation 2007,2008 - All rights reserved - -THIS SOFTWARE IS PROVIDED BY IBM CORPORATION "AS IS" AND ANY EXPRESS OR IMPLIED -WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF -MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT -SHALL IBM CORPORATION BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, -EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT -OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS -INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN -CONTRACT, STRICT LIABILITY, OR TORT INCLUDING NEGLIGENCE OR OTHERWISE) ARISING -IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY -OF SUCH DAMAGE. -*/ - - -#ifndef DB2I_SQLSTATEMENTSTREAM_H -#define DB2I_SQLSTATEMENTSTREAM_H - -#include "db2i_charsetSupport.h" -#include "qmyse.h" - -/** - @class SqlStatementStream - - This class handles building the stream of SQL statements expected by the - QMY_EXECUTE_IMMEDIATE and QMY_PREPARE_OPEN_CURSOR APIs. - Memory allocation is handled internally. -*/ -class SqlStatementStream -{ - public: - /** - ctor to be used when multiple strings may be appended. - */ - SqlStatementStream(uint32 firstStringSize) : statements(0) - { - curSize = firstStringSize + sizeof(StmtHdr_t); - curSize = (curSize + 3) & ~3; - ptr = (char*) getNewSpace(curSize); - if (ptr == NULL) - curSize = 0; - } - - /** - ctor to be used when only a single statement will be executed. - */ - SqlStatementStream(const String& statement) : statements(0), block(NULL), curSize(0), ptr(0) - { - addStatement(statement); - } - - /** - ctor to be used when only a single statement will be executed. - */ - SqlStatementStream(const char* statement) : statements(0), block(NULL), curSize(0), ptr(0) - { - addStatement(statement); - } - - /** - Append an SQL statement, specifiying the DB2 sort sequence under which - the statement should be executed. This is important for CREATE TABLE - and CREATE INDEX statements. - */ - SqlStatementStream& addStatement(const String& append, const char* fileSortSequence, const char* fileSortSequenceLibrary) - { - char sortSeqEbcdic[10]; - char sortSeqLibEbcdic[10]; - - DBUG_ASSERT(strlen(fileSortSequence) <= 10 && - strlen(fileSortSequenceLibrary) <= 10); - memset(sortSeqEbcdic, 0x40, 10); - memset(sortSeqLibEbcdic, 0x40, 10); - convToEbcdic(fileSortSequence, sortSeqEbcdic, strlen(fileSortSequence)); - convToEbcdic(fileSortSequenceLibrary, sortSeqLibEbcdic, strlen(fileSortSequenceLibrary)); - - return addStatementInternal(append.ptr(), append.length(), sortSeqEbcdic, sortSeqLibEbcdic); - } - - /** - Append an SQL statement using default (*HEX) sort sequence. - */ - SqlStatementStream& addStatement(const String& append) - { - const char splatHEX[] = {0x5C, 0xC8, 0xC5, 0xE7, 0x40, 0x40, 0x40, 0x40, 0x40, 0x40}; // *HEX - const char blanks[] = {0x40, 0x40, 0x40, 0x40, 0x40, 0x40, 0x40, 0x40, 0x40, 0x40}; // - - return addStatementInternal(append.ptr(), append.length(), splatHEX, blanks); - } - - /** - Append an SQL statement using default (*HEX) sort sequence. - */ - SqlStatementStream& addStatement(const char* stmt) - { - const char splatHEX[] = {0x5C, 0xC8, 0xC5, 0xE7, 0x40, 0x40, 0x40, 0x40, 0x40, 0x40}; // *HEX - const char blanks[] = {0x40, 0x40, 0x40, 0x40, 0x40, 0x40, 0x40, 0x40, 0x40, 0x40}; // - - return addStatementInternal(stmt, strlen(stmt), splatHEX, blanks); - } - - char* getPtrToData() const { return block; } - uint32 getStatementCount() const { return statements; } - private: - SqlStatementStream& addStatementInternal(const char* stmt, - uint32 length, - const char* fileSortSequence, - const char* fileSortSequenceLibrary); - - uint32 storageRemaining() const - { - return (block == NULL ? 0 : curSize - (ptr - block)); - } - - char* getNewSpace(size_t size) - { - allocBase = (char*)sql_alloc(size + 15); - block = (char*)roundToQuadWordBdy(allocBase); - return block; - } - - uint32 curSize; // The size of the usable memory. - char* allocBase; // The allocated memory (with padding for aligment) - char* block; // The usable memory chunck (aligned for ILE) - char* ptr; // The current position within block. - uint32 statements; // The number of statements that have been appended. -}; - -#endif - diff --git a/storage/ibmdb2i/db2i_validatedPointer.h b/storage/ibmdb2i/db2i_validatedPointer.h deleted file mode 100644 index c4e31d1f11b..00000000000 --- a/storage/ibmdb2i/db2i_validatedPointer.h +++ /dev/null @@ -1,162 +0,0 @@ -/* -Licensed Materials - Property of IBM -DB2 Storage Engine Enablement -Copyright IBM Corporation 2007,2008 -All rights reserved - -Redistribution and use in source and binary forms, with or without modification, -are permitted provided that the following conditions are met: - (a) Redistributions of source code must retain this list of conditions, the - copyright notice in section {d} below, and the disclaimer following this - list of conditions. - (b) Redistributions in binary form must reproduce this list of conditions, the - copyright notice in section (d) below, and the disclaimer following this - list of conditions, in the documentation and/or other materials provided - with the distribution. - (c) The name of IBM may not be used to endorse or promote products derived from - this software without specific prior written permission. - (d) The text of the required copyright notice is: - Licensed Materials - Property of IBM - DB2 Storage Engine Enablement - Copyright IBM Corporation 2007,2008 - All rights reserved - -THIS SOFTWARE IS PROVIDED BY IBM CORPORATION "AS IS" AND ANY EXPRESS OR IMPLIED -WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF -MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT -SHALL IBM CORPORATION BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, -EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT -OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS -INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN -CONTRACT, STRICT LIABILITY, OR TORT INCLUDING NEGLIGENCE OR OTHERWISE) ARISING -IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY -OF SUCH DAMAGE. -*/ - -#ifndef DB2I_VALIDATEDPOINTER_H -#define DB2I_VALIDATEDPOINTER_H - -#include "db2i_ileBridge.h" - -/** - @class ValidatedPointer - @brief Encapsulates a pointer registered for usage by the QMYSE APIs - - @details As a performance optimization, to prevent pointer validation each - time a particular pointer is thunked across to ILE, QMYSE allows us to - "register" a pointer such that it is validated once and then subsequently - referenced on QMYSE APIs by means of a handle value. This class should be - used to manage memory allocation/registration/unregistration of these - pointers. Using the alloc function guarantees that the resulting storage is - 16-byte aligned, a requirement for many pointers passed to QMYSE. -*/ -template -class ValidatedPointer -{ -public: - ValidatedPointer() : address(NULL), handle(NULL) {;} - - ValidatedPointer(size_t size) - { - alloc(size); - } - - ValidatedPointer(T* ptr) - { - assign(ptr); - } - - operator T*() - { - return address; - }; - - operator T*() const - { - return address; - }; - - operator void*() - { - return address; - }; - - operator ILEMemHandle() - { - return handle; - } - - void alloc(size_t size) - { - address = (T*)malloc_aligned(size); - if (address) - db2i_ileBridge::registerPtr(address, &handle); - mallocedHere = 1; - } - - void assign(T* ptr) - { - address = ptr; - db2i_ileBridge::registerPtr((void*)ptr, &handle); - mallocedHere = 0; - } - - void realloc(size_t size) - { - dealloc(); - alloc(size); - } - - void reassign(T* ptr) - { - dealloc(); - assign(ptr); - } - - void dealloc() - { - if (address) - { - db2i_ileBridge::unregisterPtr(handle); - - if (mallocedHere) - free_aligned((void*)address); - } - address = NULL; - handle = 0; - } - - ~ValidatedPointer() - { - dealloc(); - } - -private: - // Disable copy ctor and assignment operator, as these would break - // the registration guarantees provided by the class. - ValidatedPointer& operator= (const ValidatedPointer newVal); - ValidatedPointer(ValidatedPointer& newCopy); - - ILEMemHandle handle; - T* address; - char mallocedHere; -}; - - -/** - @class ValidatedObject - @brief This class allows users to instantiate and register a particular - object in a single step. -*/ -template -class ValidatedObject : public ValidatedPointer -{ - public: - ValidatedObject() : ValidatedPointer(&value) {;} - - T& operator= (const T newVal) { value = newVal; return value; } - - private: - T value; -}; -#endif diff --git a/storage/ibmdb2i/ha_ibmdb2i.cc b/storage/ibmdb2i/ha_ibmdb2i.cc deleted file mode 100644 index 39096be7848..00000000000 --- a/storage/ibmdb2i/ha_ibmdb2i.cc +++ /dev/null @@ -1,3359 +0,0 @@ -/* -Licensed Materials - Property of IBM -DB2 Storage Engine Enablement -Copyright IBM Corporation 2007,2008 -All rights reserved - -Redistribution and use in source and binary forms, with or without modification, -are permitted provided that the following conditions are met: - (a) Redistributions of source code must retain this list of conditions, the - copyright notice in section {d} below, and the disclaimer following this - list of conditions. - (b) Redistributions in binary form must reproduce this list of conditions, the - copyright notice in section (d) below, and the disclaimer following this - list of conditions, in the documentation and/or other materials provided - with the distribution. - (c) The name of IBM may not be used to endorse or promote products derived from - this software without specific prior written permission. - (d) The text of the required copyright notice is: - Licensed Materials - Property of IBM - DB2 Storage Engine Enablement - Copyright IBM Corporation 2007,2008 - All rights reserved - -THIS SOFTWARE IS PROVIDED BY IBM CORPORATION "AS IS" AND ANY EXPRESS OR IMPLIED -WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF -MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT -SHALL IBM CORPORATION BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, -EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT -OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS -INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN -CONTRACT, STRICT LIABILITY, OR TORT INCLUDING NEGLIGENCE OR OTHERWISE) ARISING -IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY -OF SUCH DAMAGE. -*/ - - -/** - @file ha_ibmdb2i.cc - - @brief - The ha_ibmdb2i storage engine provides an interface from MySQL to IBM DB2 for i. - -*/ - -#ifdef USE_PRAGMA_IMPLEMENTATION -#pragma implementation // gcc: Class implementation -#endif - -#include "ha_ibmdb2i.h" -#include "mysql_priv.h" -#include -#include "db2i_ileBridge.h" -#include "db2i_charsetSupport.h" -#include -#include "db2i_safeString.h" - -static const char __NOT_NULL_VALUE_EBCDIC = 0xF0; // '0' -static const char __NULL_VALUE_EBCDIC = 0xF1; // '1' -static const char __DEFAULT_VALUE_EBCDIC = 0xC4; // 'D' -static const char BlankASPName[19] = " "; -static const int DEFAULT_MAX_ROWS_TO_BUFFER = 4096; - -static const char SAVEPOINT_PREFIX[] = {0xD4, 0xE8, 0xE2, 0xD7}; // MYSP (in EBCDIC) - -OSVersion osVersion; - - -// ================================================================ -// ================================================================ -// System variables -static char* ibmdb2i_rdb_name; -static MYSQL_SYSVAR_STR(rdb_name, ibmdb2i_rdb_name, - PLUGIN_VAR_MEMALLOC | PLUGIN_VAR_READONLY, - "The name of the RDB to use", - NULL, - NULL, - BlankASPName); - -static MYSQL_THDVAR_BOOL(transaction_unsafe, - 0, - "Disable support for commitment control", - NULL, - NULL, - FALSE); - -static MYSQL_THDVAR_UINT(lob_alloc_size, - 0, - "Baseline allocation for lob read buffer", - NULL, - NULL, - 2*1024*1024, - 64*1024, - 128*1024*1024, - 1); - -static MYSQL_THDVAR_UINT(max_read_buffer_size, - 0, - "Maximum size of buffers used for read-ahead.", - NULL, - NULL, - 1*1024*1024, - 32*1024, - 16*1024*1024, - 1); - -static MYSQL_THDVAR_UINT(max_write_buffer_size, - 0, - "Maximum size of buffers used for bulk writes.", - NULL, - NULL, - 8*1024*1024, - 32*1024, - 64*1024*1024, - 1); - -static MYSQL_THDVAR_BOOL(compat_opt_time_as_duration, - 0, - "Control how new TIME columns should be defined in DB2. 0=time-of-day (default), 1=duration.", - NULL, - NULL, - FALSE); - -static MYSQL_THDVAR_UINT(compat_opt_year_as_int, - 0, - "Control how new YEAR columns should be defined in DB2. 0=CHAR(4) (default), 1=SMALLINT.", - NULL, - NULL, - 0, - 0, - 1, - 1); - -static MYSQL_THDVAR_UINT(compat_opt_blob_cols, - 0, - "Control how new TEXT and BLOB columns should be defined in DB2. 0=CLOB/BLOB (default), 1=VARCHAR/VARBINARY", - NULL, - NULL, - 0, - 0, - 1, - 1); - -static MYSQL_THDVAR_UINT(compat_opt_allow_zero_date_vals, - 0, - "Allow substitute values to be used when storing a column with a 0000-00-00 date component. 0=No substitution (default), 1=Substitute '0001-01-01'", - NULL, - NULL, - 0, - 0, - 1, - 1); - -static MYSQL_THDVAR_BOOL(propagate_default_col_vals, - 0, - "Should DEFAULT column values be propagated to the DB2 table definition.", - NULL, - NULL, - TRUE); - -static my_bool ibmdb2i_assume_exclusive_use; -static MYSQL_SYSVAR_BOOL(assume_exclusive_use, ibmdb2i_assume_exclusive_use, - 0, - "Can MySQL assume that this process is the only one modifying the DB2 tables. ", - NULL, - NULL, - FALSE); - -static MYSQL_THDVAR_BOOL(async_enabled, - 0, - "Should reads be done asynchronously when possible", - NULL, - NULL, - TRUE); - -static MYSQL_THDVAR_UINT(create_index_option, - 0, - "Control whether additional indexes are created. 0=No (default), 1=Create additional *HEX-based index", - NULL, - NULL, - 0, - 0, - 1, - 1); - -/* static MYSQL_THDVAR_UINT(discovery_mode, - 0, - "Unsupported", - NULL, - NULL, - 0, - 0, - 1, - 1); */ - -static uint32 ibmdb2i_system_trace; -static MYSQL_SYSVAR_UINT(system_trace_level, ibmdb2i_system_trace, - 0, - "Set system tracing level", - NULL, - NULL, - 0, - 0, - 63, - 1); - - -inline uint8 ha_ibmdb2i::getCommitLevel(THD* thd) -{ - if (!THDVAR(thd, transaction_unsafe)) - { - switch (thd_tx_isolation(thd)) - { - case ISO_READ_UNCOMMITTED: - return (accessIntent == QMY_READ_ONLY ? QMY_READ_UNCOMMITTED : QMY_REPEATABLE_READ); - case ISO_READ_COMMITTED: - return (accessIntent == QMY_READ_ONLY ? QMY_READ_COMMITTED : QMY_REPEATABLE_READ); - case ISO_REPEATABLE_READ: - return QMY_REPEATABLE_READ; - case ISO_SERIALIZABLE: - return QMY_SERIALIZABLE; - } - } - - return QMY_NONE; -} - -inline uint8 ha_ibmdb2i::getCommitLevel() -{ - return getCommitLevel(ha_thd()); -} - -//===================================================================== - -static handler *ibmdb2i_create_handler(handlerton *hton, - TABLE_SHARE *table, - MEM_ROOT *mem_root); -static void ibmdb2i_drop_database(handlerton *hton, char* path); -static int ibmdb2i_savepoint_set(handlerton *hton, THD* thd, void *sv); -static int ibmdb2i_savepoint_rollback(handlerton *hton, THD* thd, void *sv); -static int ibmdb2i_savepoint_release(handlerton *hton, THD* thd, void *sv); -static uint ibmdb2i_alter_table_flags(uint flags); - -handlerton *ibmdb2i_hton; -static bool was_ILE_inited; - -/* Tracks the number of open tables */ -static HASH ibmdb2i_open_tables; - -/* Mutex used to synchronize initialization of the hash */ -static pthread_mutex_t ibmdb2i_mutex; - - -/** - Create hash key for tracking open tables. -*/ - -static uchar* ibmdb2i_get_key(IBMDB2I_SHARE *share,size_t *length, - bool not_used __attribute__((unused))) -{ - *length=share->table_name_length; - return (uchar*) share->table_name; -} - - -int ibmdb2i_close_connection(handlerton* hton, THD *thd) -{ - DBUG_PRINT("ha_ibmdb2i::close_connection", ("Closing %d", thd->thread_id)); - db2i_ileBridge::getBridgeForThread(thd)->closeConnection(thd->thread_id); - db2i_ileBridge::destroyBridgeForThread(thd); - - return 0; -} - - -static int ibmdb2i_init_func(void *p) -{ - DBUG_ENTER("ibmdb2i_init_func"); - - utsname tempName; - uname(&tempName); - osVersion.v = atoi(tempName.version); - osVersion.r = atoi(tempName.release); - - was_ILE_inited = false; - ibmdb2i_hton= (handlerton *)p; - VOID(pthread_mutex_init(&ibmdb2i_mutex,MY_MUTEX_INIT_FAST)); - (void) hash_init(&ibmdb2i_open_tables,table_alias_charset,32,0,0, - (hash_get_key) ibmdb2i_get_key,0,0); - - ibmdb2i_hton->state= SHOW_OPTION_YES; - ibmdb2i_hton->create= ibmdb2i_create_handler; - ibmdb2i_hton->drop_database= ibmdb2i_drop_database; - ibmdb2i_hton->commit= ha_ibmdb2i::doCommit; - ibmdb2i_hton->rollback= ha_ibmdb2i::doRollback; - ibmdb2i_hton->savepoint_offset= 0; - ibmdb2i_hton->savepoint_set= ibmdb2i_savepoint_set; - ibmdb2i_hton->savepoint_rollback= ibmdb2i_savepoint_rollback; - ibmdb2i_hton->savepoint_release= ibmdb2i_savepoint_release; - ibmdb2i_hton->alter_table_flags=ibmdb2i_alter_table_flags; - ibmdb2i_hton->close_connection=ibmdb2i_close_connection; - - int rc; - - rc = initCharsetSupport(); - - if (!rc) - rc = db2i_ileBridge::setup(); - - if (!rc) - { - int nameLen = strlen(ibmdb2i_rdb_name); - for (int i = 0; i < nameLen; ++i) - { - ibmdb2i_rdb_name[i] = my_toupper(system_charset_info, (uchar)ibmdb2i_rdb_name[i]); - } - - rc = db2i_ileBridge::initILE(ibmdb2i_rdb_name, (uint16*)(((char*)&ibmdb2i_system_trace)+2)); - if (rc == 0) - { - was_ILE_inited = true; - } - } - - DBUG_RETURN(rc); -} - - -static int ibmdb2i_done_func(void *p) -{ - int error= 0; - DBUG_ENTER("ibmdb2i_done_func"); - - if (ibmdb2i_open_tables.records) - error= 1; - - if (was_ILE_inited) - db2i_ileBridge::exitILE(); - - db2i_ileBridge::takedown(); - - doneCharsetSupport(); - - hash_free(&ibmdb2i_open_tables); - pthread_mutex_destroy(&ibmdb2i_mutex); - - DBUG_RETURN(0); -} - - -IBMDB2I_SHARE *ha_ibmdb2i::get_share(const char *table_name, TABLE *table) -{ - IBMDB2I_SHARE *share; - uint length; - char *tmp_name; - - pthread_mutex_lock(&ibmdb2i_mutex); - length=(uint) strlen(table_name); - - if (!(share=(IBMDB2I_SHARE*) hash_search(&ibmdb2i_open_tables, - (uchar*)table_name, - length))) - { - if (!(share=(IBMDB2I_SHARE *) - my_multi_malloc(MYF(MY_WME | MY_ZEROFILL), - &share, sizeof(*share), - &tmp_name, length+1, - NullS))) - { - pthread_mutex_unlock(&ibmdb2i_mutex); - return NULL; - } - - share->use_count=0; - share->table_name_length=length; - share->table_name=tmp_name; - strmov(share->table_name,table_name); - if (my_hash_insert(&ibmdb2i_open_tables, (uchar*) share)) - goto error; - thr_lock_init(&share->lock); - pthread_mutexattr_t mutexattr = MY_MUTEX_INIT_FAST; - pthread_mutexattr_settype(&mutexattr, PTHREAD_MUTEX_RECURSIVE); - pthread_mutex_init(&share->mutex, &mutexattr); - - share->db2Table = new db2i_table(table->s, table_name); - int32 rc = share->db2Table->initDB2Objects(table_name); - - if (rc) - { - delete share->db2Table; - hash_delete(&ibmdb2i_open_tables, (uchar*) share); - thr_lock_delete(&share->lock); - my_errno = rc; - goto error; - } - - memset(&share->cachedStats, 0, sizeof(share->cachedStats)); - } - share->use_count++; - pthread_mutex_unlock(&ibmdb2i_mutex); - - db2Table = share->db2Table; - - return share; - -error: - pthread_mutex_destroy(&share->mutex); - my_free((uchar*) share, MYF(0)); - pthread_mutex_unlock(&ibmdb2i_mutex); - - return NULL; -} - - - -int ha_ibmdb2i::free_share(IBMDB2I_SHARE *share) -{ - pthread_mutex_lock(&ibmdb2i_mutex); - if (!--share->use_count) - { - delete share->db2Table; - db2Table = NULL; - - hash_delete(&ibmdb2i_open_tables, (uchar*) share); - thr_lock_delete(&share->lock); - pthread_mutex_destroy(&share->mutex); - my_free(share, MYF(0)); - pthread_mutex_unlock(&ibmdb2i_mutex); - return 1; - } - pthread_mutex_unlock(&ibmdb2i_mutex); - - return 0; -} - -static handler* ibmdb2i_create_handler(handlerton *hton, - TABLE_SHARE *table, - MEM_ROOT *mem_root) -{ - return new (mem_root) ha_ibmdb2i(hton, table); -} - -static void ibmdb2i_drop_database(handlerton *hton, char* path) -{ - DBUG_ENTER("ha_ibmdb2i::ibmdb2i_drop_database"); - int rc = 0; - char queryBuffer[200]; - String query(queryBuffer, sizeof(queryBuffer), system_charset_info); - query.length(0); - query.append(STRING_WITH_LEN(" DROP SCHEMA \"")); - query.append(path+2, strchr(path+2, '/')-(path+2)); - query.append('"'); - - SqlStatementStream sqlStream(query); - - rc = db2i_ileBridge::getBridgeForThread()->execSQL(sqlStream.getPtrToData(), - sqlStream.getStatementCount(), - QMY_NONE, - FALSE, - TRUE); - DBUG_VOID_RETURN; -} - -inline static void genSavepointName(const void* sv, char* out) -{ - *(uint32*)out = *(uint32*)SAVEPOINT_PREFIX; - DBUG_ASSERT(sizeof(SAVEPOINT_PREFIX) == 4); - out += sizeof(SAVEPOINT_PREFIX); - - longlong2str((longlong)sv, out, 10); - while (*out) - { - out += 0xF0; - ++out; - } -} - - -/********************************************************************* -Sets a transaction savepoint. */ -static int ibmdb2i_savepoint_set(handlerton* hton, THD* thd, void* sv) -{ - DBUG_ENTER("ibmdb2i_savepoint_set"); - int rc = 0; - if (!THDVAR(thd ,transaction_unsafe)) - { - char name[64]; - genSavepointName(sv, name); - DBUG_PRINT("ibmdb2i_savepoint_set",("Setting %s", name)); - rc = ha_ibmdb2i::doSavepointSet(thd, name); - } - DBUG_RETURN(rc); -} - - -/********************************************************************* -Rollback a savepoint. */ -static int ibmdb2i_savepoint_rollback(handlerton* hton, THD* thd, void* sv) -{ - DBUG_ENTER("ibmdb2i_savepoint_rollback"); - int rc = 0; - if (!THDVAR(thd,transaction_unsafe)) - { - char name[64]; - genSavepointName(sv, name); - DBUG_PRINT("ibmdb2i_savepoint_rollback",("Rolling back %s", name)); - rc = ha_ibmdb2i::doSavepointRollback(thd, name); - } - DBUG_RETURN(rc); -} - - -/********************************************************************* -Release a savepoint. */ -static int ibmdb2i_savepoint_release(handlerton* hton, THD* thd, void* sv) -{ - DBUG_ENTER("ibmdb2i_savepoint_release"); - int rc = 0; - if (!THDVAR(thd,transaction_unsafe)) - { - char name[64]; - genSavepointName(sv, name); - DBUG_PRINT("ibmdb2i_savepoint_release",("Releasing %s", name)); - rc = ha_ibmdb2i::doSavepointRelease(thd, name); - } - DBUG_RETURN(rc); -} - -/* Thse flags allow for the online add and drop of an index via the CREATE INDEX, - DROP INDEX, and ALTER TABLE statements. These flags indicate that MySQL is not - required to lock the table before calling the storage engine to add or drop the - index(s). */ -static uint ibmdb2i_alter_table_flags(uint flags) -{ - return (HA_ONLINE_ADD_INDEX | HA_ONLINE_DROP_INDEX | - HA_ONLINE_ADD_UNIQUE_INDEX | HA_ONLINE_DROP_UNIQUE_INDEX | - HA_ONLINE_ADD_PK_INDEX | HA_ONLINE_DROP_PK_INDEX); -} - -ha_ibmdb2i::ha_ibmdb2i(handlerton *hton, TABLE_SHARE *table_arg) - :share(NULL), handler(hton, table_arg), - activeHandle(0), dataHandle(0), - activeReadBuf(NULL), activeWriteBuf(NULL), - blobReadBuffers(NULL), accessIntent(QMY_UPDATABLE), currentRRN(0), - releaseRowNeeded(FALSE), - indexReadSizeEstimates(NULL), - outstanding_start_bulk_insert(false), - last_rnd_init_rc(0), - last_index_init_rc(0), - last_start_bulk_insert_rc(0), - autoIncLockAcquired(false), - got_auto_inc_values(false), - next_identity_value(0), - indexHandles(0), - returnDupKeysImmediately(false), - onDupUpdate(false), - blobWriteBuffers(NULL), - forceSingleRowRead(false) - { - activeReferences = 0; - ref_length = sizeof(currentRRN); - if (table_share && table_share->keys > 0) - { - indexHandles = (FILE_HANDLE*)my_malloc(table_share->keys * sizeof(FILE_HANDLE), MYF(MY_WME | MY_ZEROFILL)); - } - clear_alloc_root(&conversionBufferMemroot); - } - - -ha_ibmdb2i::~ha_ibmdb2i() -{ - DBUG_ASSERT(activeReferences == 0 || outstanding_start_bulk_insert); - - if (indexHandles) - my_free(indexHandles, MYF(0)); - if (indexReadSizeEstimates) - my_free(indexReadSizeEstimates, MYF(0)); - - cleanupBuffers(); -} - - -static const char *ha_ibmdb2i_exts[] = { - FID_EXT, - NullS -}; - -const char **ha_ibmdb2i::bas_ext() const -{ - return ha_ibmdb2i_exts; -} - - -int ha_ibmdb2i::open(const char *name, int mode, uint test_if_locked) -{ - DBUG_ENTER("ha_ibmdb2i::open"); - - initBridge(); - - dataHandle = bridge()->findAndRemovePreservedHandle(name, &share); - - if (share) - db2Table = share->db2Table; - - if (!share && (!(share = get_share(name, table)))) - DBUG_RETURN(my_errno); - thr_lock_data_init(&share->lock,&lock,NULL); - - info(HA_STATUS_NO_LOCK | HA_STATUS_CONST | HA_STATUS_VARIABLE); - - - DBUG_RETURN(0); -} - - - - -int ha_ibmdb2i::close(void) -{ - DBUG_ENTER("ha_ibmdb2i::close"); - int32 rc = 0; - bool preserveShare = false; - - db2i_ileBridge* bridge = db2i_ileBridge::getBridgeForThread(); - - if (dataHandle) - { - if (bridge->expectErrors(QMY_ERR_PEND_LOCKS)->deallocateFile(dataHandle, FALSE) == QMY_ERR_PEND_LOCKS) - { - bridge->preserveHandle(share->table_name, dataHandle, share); - preserveShare = true; - } - dataHandle = 0; - } - - for (int idx = 0; idx < table_share->keys; ++idx) - { - if (indexHandles[idx] != 0) - { - bridge->deallocateFile(indexHandles[idx], FALSE); - } - } - - cleanupBuffers(); - - if (!preserveShare) - { - if (free_share(share)) - share = NULL; - } - - DBUG_RETURN(rc); -} - - - -int ha_ibmdb2i::write_row(uchar * buf) -{ - - DBUG_ENTER("ha_ibmdb2i::write_row"); - - if (last_start_bulk_insert_rc) - DBUG_RETURN( last_start_bulk_insert_rc ); - - ha_statistic_increment(&SSV::ha_write_count); - int rc = 0; - - bool fileHandleNeedsRelease = false; - - if (!activeHandle) - { - rc = useDataFile(); - if (rc) DBUG_RETURN(rc); - fileHandleNeedsRelease = true; - } - - if (!outstanding_start_bulk_insert) - rc = prepWriteBuffer(1, getFileForActiveHandle()); - - if (!rc) - { - if (table->timestamp_field_type & TIMESTAMP_AUTO_SET_ON_INSERT) - table->timestamp_field->set_time(); - - char* writeBuffer = activeWriteBuf->addRow(); - rc = prepareRowForWrite(writeBuffer, - writeBuffer+activeWriteBuf->getRowNullOffset(), - true); - if (rc == 0) - { - // If we are doing block inserts, if the MI is supposed to generate an auto_increment - // (i.e. identity column) value for this record, and if this is not the first record in - // the block, then store the value (that the MI will generate for the identity column) - // into the MySQL write buffer. We can predetermine the value because the file is locked. - - if ((autoIncLockAcquired) && (default_identity_value) && (got_auto_inc_values)) - { - if (unlikely((next_identity_value - 1) == - maxValueForField(table->next_number_field))) - { - rc = QMY_ERR_MAXVALUE; - } - else - { - rc = table->next_number_field->store((longlong) next_identity_value, TRUE); - next_identity_value = next_identity_value + incrementByValue; - } - } - // If the buffer is full, or if we locked the file and this is the first or last row - // of a blocked insert, then flush the buffer. - if (!rc && (activeWriteBuf->endOfBuffer()) || - ((autoIncLockAcquired) && - ((!got_auto_inc_values))) || - (returnDupKeysImmediately)) - rc = flushWrite(activeHandle, buf); - } - else - activeWriteBuf->deleteRow(); - } - - if (fileHandleNeedsRelease) - releaseActiveHandle(); - - DBUG_RETURN(rc); -} - -/** - @brief - Helper function used by write_row and update_row to prepare the MySQL - row for insertion into DB2. -*/ -int ha_ibmdb2i::prepareRowForWrite(char* data, char* nulls, bool honorIdentCols) -{ - int rc = 0; - - // set null map all to non nulls - memset(nulls,__NOT_NULL_VALUE_EBCDIC, table->s->fields); - default_identity_value = FALSE; - - ulong sql_mode = ha_thd()->variables.sql_mode; - - my_bitmap_map *old_map= dbug_tmp_use_all_columns(table, table->read_set); - for (Field **field = table->field; *field && !rc; ++field) - { - int fieldIndex = (*field)->field_index; - if ((*field)->Field::is_null()) - { - nulls[fieldIndex] = __NULL_VALUE_EBCDIC; - } - if (honorIdentCols && ((*field)->flags & AUTO_INCREMENT_FLAG) && - *field == table->next_number_field) -// && ((!autoIncLockAcquired) || (!got_auto_inc_values))) - { - if (sql_mode & MODE_NO_AUTO_VALUE_ON_ZERO) - { - if (!table->auto_increment_field_not_null) - { - nulls[fieldIndex] = __DEFAULT_VALUE_EBCDIC; - default_identity_value = TRUE; - } - } - else if ((*field)->val_int() == 0) - { - nulls[fieldIndex] = __DEFAULT_VALUE_EBCDIC; - default_identity_value = TRUE; - } - } - - DB2Field& db2Field = db2Table->db2Field(fieldIndex); - if (nulls[fieldIndex] == __NOT_NULL_VALUE_EBCDIC || - db2Field.isBlob()) - { - rc = convertMySQLtoDB2(*field, db2Field, data + db2Field.getBufferOffset()); - } - } - - if (!rc && db2Table->hasBlobs()) - rc = db2i_ileBridge::getBridgeForThread()->objectOverride(activeHandle, - activeWriteBuf->ptr()); - - dbug_tmp_restore_column_map(table->read_set, old_map); - - return rc; -} - - - -int ha_ibmdb2i::update_row(const uchar * old_data, uchar * new_data) -{ - DBUG_ENTER("ha_ibmdb2i::update_row"); - ha_statistic_increment(&SSV::ha_update_count); - int rc; - - bool fileHandleNeedsRelease = false; - - if (!activeHandle) - { - rc = useFileByHandle(QMY_UPDATABLE, rrnAssocHandle); - if (rc) DBUG_RETURN(rc); - fileHandleNeedsRelease = true; - } - - if (table->timestamp_field_type & TIMESTAMP_AUTO_SET_ON_UPDATE) - table->timestamp_field->set_time(); - - char* writeBuf = activeWriteBuf->addRow(); - rc = prepareRowForWrite(writeBuf, - writeBuf+activeWriteBuf->getRowNullOffset(), - onDupUpdate); - - char* lastDupKeyNamePtr = NULL; - uint32 lastDupKeyNameLen = 0; - - if (!rc) - { - rc = db2i_ileBridge::getBridgeForThread()->updateRow(activeHandle, - currentRRN, - activeWriteBuf->ptr(), - &lastDupKeyRRN, - &lastDupKeyNamePtr, - &lastDupKeyNameLen); - } - - if (lastDupKeyNameLen) - { - lastDupKeyID = getKeyFromName(lastDupKeyNamePtr, lastDupKeyNameLen); - rrnAssocHandle = activeHandle; - } - - if (fileHandleNeedsRelease) - releaseActiveHandle(); - - activeWriteBuf->resetAfterWrite(); - - DBUG_RETURN(rc); -} - - -int ha_ibmdb2i::delete_row(const uchar * buf) -{ - DBUG_ENTER("ha_ibmdb2i::delete_row"); - ha_statistic_increment(&SSV::ha_delete_count); - - bool needReleaseFile = false; - int rc = 0; - - if (!activeHandle) // In some circumstances, MySQL comes here after - { // closing the active handle. We need to re-open. - rc = useFileByHandle(QMY_UPDATABLE, rrnAssocHandle); - needReleaseFile = true; - } - - if (likely(!rc)) - { - rc = db2i_ileBridge::getBridgeForThread()->deleteRow(activeHandle, - currentRRN); - invalidateCachedStats(); - if (needReleaseFile) - releaseActiveHandle(); - } - - DBUG_RETURN(rc); -} - - - -int ha_ibmdb2i::index_init(uint idx, bool sorted) -{ - DBUG_ENTER("ha_ibmdb2i::index_init"); - - int& rc = last_index_init_rc; - rc = 0; - - invalidDataFound=false; - tweakReadSet(); - - active_index=idx; - - rc = useIndexFile(idx); - - if (!rc) - { -// THD* thd = ha_thd(); -// if (accessIntent == QMY_UPDATABLE && -// thd_tx_isolation(thd) == ISO_REPEATABLE_READ && -// !THDVAR(thd, transaction_unsafe)) -// { -// readAccessIntent = QMY_READ_ONLY; -// } -// else -// { - readAccessIntent = accessIntent; -// } - - if (!rc && accessIntent != QMY_READ_ONLY) - rc = prepWriteBuffer(1, db2Table->indexFile(idx)); - - if (rc) - releaseIndexFile(idx); - } - - rrnAssocHandle= 0; - - DBUG_RETURN(rc); -} - - - -int ha_ibmdb2i::index_read(uchar * buf, const uchar * key, - uint key_len, - enum ha_rkey_function find_flag) -{ - DBUG_ENTER("ha_ibmdb2i::index_read"); - - if (unlikely(last_index_init_rc)) DBUG_RETURN(last_index_init_rc); - - int rc; - - ha_rows estimatedRows = getIndexReadEstimate(active_index); - rc = prepReadBuffer(estimatedRows, db2Table->indexFile(active_index), readAccessIntent); - if (unlikely(rc)) DBUG_RETURN(rc); - - DBUG_ASSERT(activeReadBuf); - - keyBuf.allocBuf(activeReadBuf->getRowLength(), - activeReadBuf->getRowNullOffset(), - activeReadBuf->getRowLength()); - keyBuf.zeroBuf(); - - char* db2KeyBufPtr = keyBuf.ptr(); - char* nullKeyMap = db2KeyBufPtr + activeReadBuf->getRowNullOffset(); - - const uchar* keyBegin = key; - int partsInUse; - - KEY& curKey = table->key_info[active_index]; - - for (partsInUse = 0; partsInUse < curKey.key_parts, key - keyBegin < key_len; ++partsInUse) - { - Field* field = curKey.key_part[partsInUse].field; - if ((curKey.key_part[partsInUse].null_bit) && - (char*)key[0]) - { - if (field->flags & AUTO_INCREMENT_FLAG) - { - table->status = STATUS_NOT_FOUND; - DBUG_RETURN(HA_ERR_END_OF_FILE); - } - else - { - nullKeyMap[partsInUse] = __NULL_VALUE_EBCDIC; - } - } - else - { - nullKeyMap[partsInUse] = __NOT_NULL_VALUE_EBCDIC; - convertMySQLtoDB2(field, - db2Table->db2Field(field->field_index), - db2KeyBufPtr, - (uchar*)key+((curKey.key_part[partsInUse].null_bit)? 1 : 0) ); // + (curKey.key_parts+7) / 8); - } - - db2KeyBufPtr += db2Table->db2Field(field->field_index).getByteLengthInRecord(); - key += curKey.key_part[partsInUse].store_length; - } - - keyLen = db2KeyBufPtr - (char*)keyBuf.ptr(); - - DBUG_PRINT("ha_ibmdb2i::index_read", ("find_flag: %d", find_flag)); - - char readDirection = QMY_NEXT; - - switch (find_flag) - { - case HA_READ_AFTER_KEY: - doInitialRead(QMY_AFTER_EQUAL, estimatedRows, - keyBuf.ptr(), keyLen, partsInUse); - break; - case HA_READ_BEFORE_KEY: - doInitialRead(QMY_BEFORE_EQUAL, estimatedRows, - keyBuf.ptr(), keyLen, partsInUse); - break; - case HA_READ_KEY_OR_NEXT: - doInitialRead(QMY_AFTER_OR_EQUAL, estimatedRows, - keyBuf.ptr(), keyLen, partsInUse); - break; - case HA_READ_KEY_OR_PREV: - DBUG_ASSERT(0); // This function is unused - doInitialRead(QMY_BEFORE_OR_EQUAL, estimatedRows, - keyBuf.ptr(), keyLen, partsInUse); - break; - case HA_READ_PREFIX_LAST_OR_PREV: - doInitialRead(QMY_LAST_PREVIOUS, estimatedRows, - keyBuf.ptr(), keyLen, partsInUse); - readDirection = QMY_PREVIOUS; - break; - case HA_READ_PREFIX_LAST: - doInitialRead(QMY_PREFIX_LAST, estimatedRows, - keyBuf.ptr(), keyLen, partsInUse); - readDirection = QMY_PREVIOUS; - break; - case HA_READ_KEY_EXACT: - doInitialRead(QMY_EQUAL, estimatedRows, keyBuf.ptr(), keyLen, partsInUse); - break; - default: - DBUG_ASSERT(0); - return HA_ERR_GENERIC; - break; - } - - ha_statistic_increment(&SSV::ha_read_key_count); - rc = readFromBuffer(buf, readDirection); - - table->status= (rc ? STATUS_NOT_FOUND: 0); - DBUG_RETURN(rc); -} - - -int ha_ibmdb2i::index_next(uchar * buf) -{ - DBUG_ENTER("ha_ibmdb2i::index_next"); - ha_statistic_increment(&SSV::ha_read_next_count); - - int rc = readFromBuffer(buf, QMY_NEXT); - - table->status= (rc ? STATUS_NOT_FOUND: 0); - DBUG_RETURN(rc); -} - - -int ha_ibmdb2i::index_next_same(uchar *buf, const uchar *key, uint keylen) -{ - DBUG_ENTER("ha_ibmdb2i::index_next_same"); - ha_statistic_increment(&SSV::ha_read_next_count); - - int rc = readFromBuffer(buf, QMY_NEXT_EQUAL); - - if (rc == HA_ERR_KEY_NOT_FOUND) - { - rc = HA_ERR_END_OF_FILE; - } - - table->status= (rc ? STATUS_NOT_FOUND: 0); - DBUG_RETURN(rc); -} - -int ha_ibmdb2i::index_read_last(uchar * buf, const uchar * key, uint key_len) -{ - DBUG_ENTER("ha_ibmdb2i::index_read_last"); - DBUG_RETURN(index_read(buf, key, key_len, HA_READ_PREFIX_LAST)); -} - - - -int ha_ibmdb2i::index_prev(uchar * buf) -{ - DBUG_ENTER("ha_ibmdb2i::index_prev"); - ha_statistic_increment(&SSV::ha_read_prev_count); - - int rc = readFromBuffer(buf, QMY_PREVIOUS); - - table->status= (rc ? STATUS_NOT_FOUND: 0); - DBUG_RETURN(rc); -} - - -int ha_ibmdb2i::index_first(uchar * buf) -{ - DBUG_ENTER("ha_ibmdb2i::index_first"); - - if (unlikely(last_index_init_rc)) DBUG_RETURN(last_index_init_rc); - - int rc = prepReadBuffer(DEFAULT_MAX_ROWS_TO_BUFFER, - db2Table->indexFile(active_index), - readAccessIntent); - - if (rc == 0) - { - doInitialRead(QMY_FIRST, DEFAULT_MAX_ROWS_TO_BUFFER); - ha_statistic_increment(&SSV::ha_read_first_count); - rc = readFromBuffer(buf, QMY_NEXT); - } - - table->status= (rc ? STATUS_NOT_FOUND: 0); - DBUG_RETURN(rc); -} - - -int ha_ibmdb2i::index_last(uchar * buf) -{ - DBUG_ENTER("ha_ibmdb2i::index_last"); - - if (unlikely(last_index_init_rc)) DBUG_RETURN(last_index_init_rc); - - int rc = prepReadBuffer(DEFAULT_MAX_ROWS_TO_BUFFER, - db2Table->indexFile(active_index), - readAccessIntent); - - if (rc == 0) - { - doInitialRead(QMY_LAST, DEFAULT_MAX_ROWS_TO_BUFFER); - ha_statistic_increment(&SSV::ha_read_last_count); - rc = readFromBuffer(buf, QMY_PREVIOUS); - } - - table->status= (rc ? STATUS_NOT_FOUND: 0); - DBUG_RETURN(rc); -} - - -int ha_ibmdb2i::rnd_init(bool scan) -{ - DBUG_ENTER("ha_ibmdb2i::rnd_init"); - - int& rc = last_rnd_init_rc; - rc = 0; - - tweakReadSet(); - invalidDataFound=false; - - uint32 rowsToBlockOnRead; - - if (!scan) - { - rowsToBlockOnRead = 1; - } - else - { - rowsToBlockOnRead = DEFAULT_MAX_ROWS_TO_BUFFER; - } - - rc = useDataFile(); - - if (!rc) - { -// THD* thd = ha_thd(); -// if (accessIntent == QMY_UPDATABLE && -// thd_tx_isolation(thd) == ISO_REPEATABLE_READ && -// !THDVAR(thd, transaction_unsafe)) -// { -// readAccessIntent = QMY_READ_ONLY; -// } -// else -// { - readAccessIntent = accessIntent; -// } - - rc = prepReadBuffer(rowsToBlockOnRead, db2Table->dataFile(), readAccessIntent); - - if (!rc && accessIntent != QMY_READ_ONLY) - rc = prepWriteBuffer(1, db2Table->dataFile()); - - if (!rc && scan) - doInitialRead(QMY_FIRST, rowsToBlockOnRead); - - if (rc) - releaseDataFile(); - } - - rrnAssocHandle= 0; - - DBUG_RETURN(0); // MySQL sometimes does not check the return code, causing - // an assert in ha_rnd_end later on if we return a non-zero - // value here. -} - -int ha_ibmdb2i::rnd_end() -{ - DBUG_ENTER("ha_ibmdb2i::rnd_end"); - - warnIfInvalidData(); - if (likely(activeReadBuf)) - activeReadBuf->endRead(); - if (last_rnd_init_rc == 0) - releaseActiveHandle(); - last_rnd_init_rc = 0; - DBUG_RETURN(0); -} - - -int32 ha_ibmdb2i::mungeDB2row(uchar* record, const char* dataPtr, const char* nullMapPtr, bool skipLOBs) -{ - DBUG_ASSERT(dataPtr); - - my_bitmap_map *old_write_map= dbug_tmp_use_all_columns(table, table->write_set); - my_bitmap_map *old_read_map; - - if (unlikely(readAllColumns)) - old_read_map = tmp_use_all_columns(table, table->read_set); - - resetCharacterConversionBuffers(); - - my_ptrdiff_t old_ptr= (my_ptrdiff_t) (record - table->record[0]); - int fieldIndex = 0; - for (Field **field = table->field; *field; ++field, ++fieldIndex) - { - if (unlikely(old_ptr)) - (*field)->move_field_offset(old_ptr); - if (nullMapPtr[fieldIndex] == __NULL_VALUE_EBCDIC || - (!bitmap_is_set(table->read_set, fieldIndex)) || - (skipLOBs && db2Table->db2Field(fieldIndex).isBlob())) - { - (*field)->set_null(); - } - else - { - (*field)->set_notnull(); - convertDB2toMySQL(db2Table->db2Field(fieldIndex), *field, dataPtr); - } - if (unlikely(old_ptr)) - (*field)->move_field_offset(-old_ptr); - - } - - if (unlikely(readAllColumns)) - tmp_restore_column_map(table->read_set, old_read_map); - dbug_tmp_restore_column_map(table->write_set, old_write_map); - - return 0; -} - - -int ha_ibmdb2i::rnd_next(uchar *buf) -{ - DBUG_ENTER("ha_ibmdb2i::rnd_next"); - - if (unlikely(last_rnd_init_rc)) DBUG_RETURN(last_rnd_init_rc); - ha_statistic_increment(&SSV::ha_read_rnd_next_count); - - int rc; - - rc = readFromBuffer(buf, QMY_NEXT); - - table->status= (rc ? STATUS_NOT_FOUND: 0); - DBUG_RETURN(rc); -} - - -void ha_ibmdb2i::position(const uchar *record) -{ - DBUG_ENTER("ha_ibmdb2i::position"); - my_store_ptr(ref, ref_length, currentRRN); - DBUG_VOID_RETURN; -} - - -int ha_ibmdb2i::rnd_pos(uchar * buf, uchar *pos) -{ - DBUG_ENTER("ha_ibmdb2i::rnd_pos"); - if (unlikely(last_rnd_init_rc)) DBUG_RETURN( last_rnd_init_rc); - ha_statistic_increment(&SSV::ha_read_rnd_count); - - currentRRN = my_get_ptr(pos, ref_length); - - tweakReadSet(); - - int rc = 0; - - if (rrnAssocHandle && - (activeHandle != rrnAssocHandle)) - { - if (activeHandle) releaseActiveHandle(); - rc = useFileByHandle(QMY_UPDATABLE, rrnAssocHandle); - } - - if (likely(rc == 0)) - { - rc = prepReadBuffer(1, getFileForActiveHandle(), accessIntent); - - if (likely(rc == 0) && accessIntent == QMY_UPDATABLE) - rc = prepWriteBuffer(1, getFileForActiveHandle()); - - if (likely(rc == 0)) - { - rc = db2i_ileBridge::getBridgeForThread()->readByRRN(activeHandle, - activeReadBuf->ptr(), - currentRRN, - accessIntent, - getCommitLevel()); - - if (likely(rc == 0)) - { - rrnAssocHandle = activeHandle; - const char* readBuf = activeReadBuf->getRowN(0); - rc = mungeDB2row(buf, readBuf, readBuf + activeReadBuf->getRowNullOffset(), false); - releaseRowNeeded = TRUE; - } - } - } - - DBUG_RETURN(rc); -} - - -int ha_ibmdb2i::info(uint flag) -{ - DBUG_ENTER("ha_ibmdb2i::info"); - - uint16 infoRequested = 0; - ValidatedPointer rowKeySpcPtr; // Space pointer passed to DB2 - uint32 rowKeySpcLen; // Length of space passed to DB2 - THD* thd = ha_thd(); - int command = thd_sql_command(thd); - - if (flag & HA_STATUS_AUTO) - stats.auto_increment_value = (ulonglong) 0; - - if (flag & HA_STATUS_ERRKEY) - { - errkey = lastDupKeyID; - my_store_ptr(dup_ref, ref_length, lastDupKeyRRN); - } - - if (flag & HA_STATUS_TIME) - { - if ((flag & HA_STATUS_NO_LOCK) && - ibmdb2i_assume_exclusive_use && - share && - (share->cachedStats.isInited(lastModTime))) - stats.update_time = share->cachedStats.getUpdateTime(); - else - infoRequested |= lastModTime; - } - - if (flag & HA_STATUS_CONST) - { - stats.block_size=4096; - infoRequested |= createTime; - - if (table->s->keys) - { - infoRequested |= rowsPerKey; - rowKeySpcLen = (table->s->keys) * MAX_DB2_KEY_PARTS * sizeof(uint64); - rowKeySpcPtr.alloc(rowKeySpcLen); - memset(rowKeySpcPtr, 0, rowKeySpcLen); // Clear the allocated space - } - } - - if (flag & HA_STATUS_VARIABLE) - { - if ((flag & HA_STATUS_NO_LOCK) && - (command != SQLCOM_SHOW_TABLE_STATUS) && - ibmdb2i_assume_exclusive_use && - share && - (share->cachedStats.isInited(rowCount | deletedRowCount | meanRowLen | ioCount)) && - (share->cachedStats.getRowCount() >= 2)) - { - stats.records = share->cachedStats.getRowCount(); - stats.deleted = share->cachedStats.getDelRowCount(); - stats.mean_rec_length = share->cachedStats.getMeanLength(); - stats.data_file_length = share->cachedStats.getAugmentedDataLength(); - } - else - { - infoRequested |= rowCount | deletedRowCount | meanRowLen; - if (command == SQLCOM_SHOW_TABLE_STATUS) - infoRequested |= objLength; - else - infoRequested |= ioCount; - } - } - - int rc = 0; - - if (infoRequested) - { - DBUG_PRINT("ha_ibmdb2i::info",("Retrieving fresh stats %d", flag)); - - initBridge(thd); - rc = bridge()->retrieveTableInfo((dataHandle ? dataHandle : db2Table->dataFile()->getMasterDefnHandle()), - infoRequested, - stats, - rowKeySpcPtr); - - if (!rc) - { - if ((flag & HA_STATUS_VARIABLE) && - (command != SQLCOM_SHOW_TABLE_STATUS)) - stats.data_file_length = stats.data_file_length * IO_SIZE; - - if ((ibmdb2i_assume_exclusive_use) && - (share) && - (command != SQLCOM_SHOW_TABLE_STATUS)) - { - if (flag & HA_STATUS_VARIABLE) - { - share->cachedStats.cacheRowCount(stats.records); - share->cachedStats.cacheDelRowCount(stats.deleted); - share->cachedStats.cacheMeanLength(stats.mean_rec_length); - share->cachedStats.cacheAugmentedDataLength(stats.data_file_length); - } - - if (flag & HA_STATUS_TIME) - { - share->cachedStats.cacheUpdateTime(stats.update_time); - } - } - - if (flag & HA_STATUS_CONST) - { - ulong i; // Loop counter for indexes - ulong j; // Loop counter for key parts - RowKey* rowKeyPtr; // Pointer to 'number of unique rows' array for this index - - rowKeyPtr = (RowKey_t*)(void*)rowKeySpcPtr; // Address first array of DB2 row counts - for (i = 0; i < table->s->keys; i++) // Do for each index, including primary - { - for (j = 0; j < table->key_info[i].key_parts; j++) - { - table->key_info[i].rec_per_key[j]= rowKeyPtr->RowKeyArray[j]; - } - rowKeyPtr = rowKeyPtr + 1; // Address next array of DB2 row counts - } - } - } - else if (rc == HA_ERR_LOCK_WAIT_TIMEOUT && share) - { - // If we couldn't retrieve the info because the object was locked, - // we'll do our best by returning the most recently cached data. - if ((infoRequested & rowCount) && - share->cachedStats.isInited(rowCount)) - stats.records = share->cachedStats.getRowCount(); - if ((infoRequested & deletedRowCount) && - share->cachedStats.isInited(deletedRowCount)) - stats.deleted = share->cachedStats.getDelRowCount(); - if ((infoRequested & meanRowLen) && - share->cachedStats.isInited(meanRowLen)) - stats.mean_rec_length = share->cachedStats.getMeanLength(); - if ((infoRequested & lastModTime) && - share->cachedStats.isInited(lastModTime)) - stats.update_time = share->cachedStats.getUpdateTime(); - - rc = 0; - } - } - - DBUG_RETURN(rc); -} - - -ha_rows ha_ibmdb2i::records() -{ - DBUG_ENTER("ha_ibmdb2i::records"); - int rc; - rc = bridge()->retrieveTableInfo((dataHandle ? dataHandle : db2Table->dataFile()->getMasterDefnHandle()), - rowCount, - stats); - - if (unlikely(rc)) - { - if (rc == HA_ERR_LOCK_WAIT_TIMEOUT && - share && - (share->cachedStats.isInited(rowCount))) - DBUG_RETURN(share->cachedStats.getRowCount()); - else - DBUG_RETURN(HA_POS_ERROR); - } - else if (share) - { - share->cachedStats.cacheRowCount(stats.records); - } - - DBUG_RETURN(stats.records); -} - - -int ha_ibmdb2i::extra(enum ha_extra_function operation) -{ - DBUG_ENTER("ha_ibmdb2i::extra"); - - switch(operation) - { - // Can these first five flags be replaced by attending to HA_EXTRA_WRITE_CACHE? - case HA_EXTRA_NO_IGNORE_DUP_KEY: - case HA_EXTRA_WRITE_CANNOT_REPLACE: - { - returnDupKeysImmediately = false; - onDupUpdate = false; - } - break; - case HA_EXTRA_INSERT_WITH_UPDATE: - { - returnDupKeysImmediately = true; - onDupUpdate = true; - } - break; - case HA_EXTRA_IGNORE_DUP_KEY: - case HA_EXTRA_WRITE_CAN_REPLACE: - returnDupKeysImmediately = true; - break; - case HA_EXTRA_FLUSH_CACHE: - if (outstanding_start_bulk_insert) - finishBulkInsert(); - break; - } - - - DBUG_RETURN(0); -} - -/** - @brief - The DB2 storage engine will ignore a MySQL generated value and will generate - a new value in SLIC. We arbitrarily set first_value to 1, and set the - interval to infinity for better performance on multi-row inserts. -*/ -void ha_ibmdb2i::get_auto_increment(ulonglong offset, ulonglong increment, - ulonglong nb_desired_values, - ulonglong *first_value, - ulonglong *nb_reserved_values) -{ - DBUG_ENTER("ha_ibmdb2i::get_auto_increment"); - *first_value= 1; - *nb_reserved_values= ULONGLONG_MAX; -} - - - -void ha_ibmdb2i::update_create_info(HA_CREATE_INFO *create_info) -{ - DBUG_ENTER("ha_ibmdb2i::update_create_info"); - - if ((!(create_info->used_fields & HA_CREATE_USED_AUTO)) && - (table->found_next_number_field != NULL)) - { - initBridge(); - - create_info->auto_increment_value= 1; - - ha_rows rowCount = records(); - - if (rowCount == 0) - { - create_info->auto_increment_value = db2Table->getStartId(); - DBUG_VOID_RETURN; - } - else if (rowCount == HA_POS_ERROR) - { - DBUG_VOID_RETURN; - } - - getNextIdVal(&create_info->auto_increment_value); - } - DBUG_VOID_RETURN; -} - - -int ha_ibmdb2i::getNextIdVal(ulonglong *value) -{ - DBUG_ENTER("ha_ibmdb2i::getNextIdVal"); - - char queryBuffer[MAX_DB2_COLNAME_LENGTH + MAX_DB2_QUALIFIEDNAME_LENGTH + 64]; - strcpy(queryBuffer, " SELECT CAST(MAX( "); - convertMySQLNameToDB2Name(table->found_next_number_field->field_name, - strend(queryBuffer), - MAX_DB2_COLNAME_LENGTH+1); - strcat(queryBuffer, ") AS BIGINT) FROM "); - db2Table->getDB2QualifiedName(strend(queryBuffer)); - DBUG_ASSERT(strlen(queryBuffer) < sizeof(queryBuffer)); - - SqlStatementStream sqlStream(queryBuffer); - DBUG_PRINT("ha_ibmdb2i::getNextIdVal", ("Sent to DB2: %s",queryBuffer)); - - int rc = 0; - FILE_HANDLE fileHandle2; - uint32 db2RowDataLen2; - rc = bridge()->prepOpen(sqlStream.getPtrToData(), - &fileHandle2, - &db2RowDataLen2); - if (likely(rc == 0)) - { - IOReadBuffer rowBuffer(1, db2RowDataLen2); - rc = bridge()->read(fileHandle2, - rowBuffer.ptr(), - QMY_READ_ONLY, - QMY_NONE, - QMY_FIRST); - - if (likely(rc == 0)) - { - /* This check is here for the case where the table is not empty, - but the auto_increment starting value has been changed since - the last record was written. */ - - longlong maxIdVal = *(longlong*)(rowBuffer.getRowN(0)); - if ((maxIdVal + 1) > db2Table->getStartId()) - *value = maxIdVal + 1; - else - *value = db2Table->getStartId(); - } - - bridge()->deallocateFile(fileHandle2); - } - DBUG_RETURN(rc); -} - - -/* - Updates index cardinalities. -*/ -int ha_ibmdb2i::analyze(THD* thd, HA_CHECK_OPT *check_opt) -{ - DBUG_ENTER("ha_ibmdb2i::analyze"); - info(HA_STATUS_TIME | HA_STATUS_CONST | HA_STATUS_VARIABLE); - DBUG_RETURN(0); -} - -int ha_ibmdb2i::optimize(THD* thd, HA_CHECK_OPT *check_opt) -{ - DBUG_ENTER("ha_ibmdb2i::optimize"); - - initBridge(thd); - - if (unlikely(records() == 0)) - DBUG_RETURN(0); // DB2 doesn't like to reorganize a table with no data. - - quiesceAllFileHandles(); - - int32 rc = bridge()->optimizeTable(db2Table->dataFile()->getMasterDefnHandle()); - info(HA_STATUS_TIME | HA_STATUS_CONST | HA_STATUS_VARIABLE); - - DBUG_RETURN(rc); -} - - -/** - @brief - Determines if an ALTER TABLE is allowed to switch the storage engine - for this table. If the table has a foreign key or is referenced by a - foreign key, then it cannot be switched. -*/ -bool ha_ibmdb2i::can_switch_engines(void) -/*=================================*/ -{ - DBUG_ENTER("ha_ibmdb2i::can_switch_engines"); - - int rc = 0; - FILE_HANDLE queryFile = 0; - uint32 resultRowLen; - uint count = 0; - bool can_switch = FALSE; // 1 if changing storage engine is allowed - - const char* libName = db2Table->getDB2LibName(db2i_table::ASCII_SQL); - const char* fileName = db2Table->getDB2TableName(db2i_table::ASCII_SQL); - - String query(256); - query.append(STRING_WITH_LEN(" SELECT COUNT(*) FROM SYSIBM.SQLFOREIGNKEYS WHERE ((PKTABLE_SCHEM = '")); - query.append(libName+1, strlen(libName)-2); // Remove quotes from parent schema name - query.append(STRING_WITH_LEN("' AND PKTABLE_NAME = '")); - query.append(fileName+1,strlen(fileName)-2); // Remove quotes from file name - query.append(STRING_WITH_LEN("') OR (FKTABLE_SCHEM = '")); - query.append(libName+1,strlen(libName)-2); // Remove quotes from child schema - query.append(STRING_WITH_LEN("' AND FKTABLE_NAME = '")); - query.append(fileName+1,strlen(fileName)-2); // Remove quotes from child name - query.append(STRING_WITH_LEN("'))")); - - SqlStatementStream sqlStream(query); - - rc = bridge()->prepOpen(sqlStream.getPtrToData(), - &queryFile, - &resultRowLen); - if (rc == 0) - { - IOReadBuffer rowBuffer(1, resultRowLen); - - rc = bridge()->read(queryFile, - rowBuffer.ptr(), - QMY_READ_ONLY, - QMY_NONE, - QMY_FIRST); - if (!rc) - { - count = *(uint*)(rowBuffer.getRowN(0)); - if (count == 0) - can_switch = TRUE; - } - - bridge()->deallocateFile(queryFile); - } - DBUG_RETURN(can_switch); -} - - - -bool ha_ibmdb2i::check_if_incompatible_data(HA_CREATE_INFO *info, - uint table_changes) -{ - DBUG_ENTER("ha_ibmdb2i::check_if_incompatible_data"); - uint i; - /* Check that auto_increment value and field definitions were - not changed. */ - if ((info->used_fields & HA_CREATE_USED_AUTO && - info->auto_increment_value != 0) || - table_changes != IS_EQUAL_YES) - DBUG_RETURN(COMPATIBLE_DATA_NO); - /* Check if any fields were renamed. */ - for (i= 0; i < table->s->fields; i++) - { - Field *field= table->field[i]; - if (field->flags & FIELD_IS_RENAMED) - { - DBUG_PRINT("info", ("Field has been renamed, copy table")); - DBUG_RETURN(COMPATIBLE_DATA_NO); - } - } - DBUG_RETURN(COMPATIBLE_DATA_YES); -} - -int ha_ibmdb2i::reset_auto_increment(ulonglong value) - { - DBUG_ENTER("ha_ibmdb2i::reset_auto_increment"); - - int rc = 0; - - quiesceAllFileHandles(); - - const char* libName = db2Table->getDB2LibName(db2i_table::ASCII_SQL); - const char* fileName = db2Table->getDB2TableName(db2i_table::ASCII_SQL); - - String query(512); - query.append(STRING_WITH_LEN(" ALTER TABLE ")); - query.append(libName); - query.append('.'); - query.append(fileName); - query.append(STRING_WITH_LEN(" ALTER COLUMN ")); - char colName[MAX_DB2_COLNAME_LENGTH+1]; - convertMySQLNameToDB2Name(table->found_next_number_field->field_name, - colName, - sizeof(colName)); - query.append(colName); - - char restart_value[22]; - CHARSET_INFO *cs= &my_charset_bin; - uint len = (uint)(cs->cset->longlong10_to_str)(cs,restart_value,sizeof(restart_value), 10, value); - restart_value[len] = 0; - - query.append(STRING_WITH_LEN(" RESTART WITH ")); - query.append(restart_value); - - SqlStatementStream sqlStream(query); - DBUG_PRINT("ha_ibmdb2i::reset_auto_increment", ("Sent to DB2: %s",query.c_ptr())); - - rc = db2i_ileBridge::getBridgeForThread()->execSQL(sqlStream.getPtrToData(), - sqlStream.getStatementCount(), - QMY_NONE, //getCommitLevel(), - FALSE, - FALSE, - TRUE, //FALSE, - dataHandle); - if (rc == 0) - db2Table->updateStartId(value); - - DBUG_RETURN(rc); -} - - -/** - @brief - This function receives an error code that was previously set by the handler. - It returns to MySQL the error string associated with that error. -*/ -bool ha_ibmdb2i::get_error_message(int error, String *buf) -{ - DBUG_ENTER("ha_ibmdb2i::get_error_message"); - if ((error >= DB2I_FIRST_ERR && error <= DB2I_LAST_ERR) || - (error >= QMY_ERR_MIN && error <= QMY_ERR_MAX)) - { - db2i_ileBridge* bridge = db2i_ileBridge::getBridgeForThread(ha_thd()); - char* errMsg = bridge->getErrorStorage(); - buf->copy(errMsg, strlen(errMsg),system_charset_info); - bridge->freeErrorStorage(); - } - DBUG_RETURN(FALSE); -} - - -int ha_ibmdb2i::delete_all_rows() -{ - DBUG_ENTER("ha_ibmdb2i::delete_all_rows"); - int rc = 0; - char queryBuffer[MAX_DB2_QUALIFIEDNAME_LENGTH + 64]; - strcpy(queryBuffer, " DELETE FROM "); - db2Table->getDB2QualifiedName(strend(queryBuffer)); - DBUG_ASSERT(strlen(queryBuffer) < sizeof(queryBuffer)); - - SqlStatementStream sqlStream(queryBuffer); - DBUG_PRINT("ha_ibmdb2i::delete_all_rows", ("Sent to DB2: %s",queryBuffer)); - rc = bridge()->execSQL(sqlStream.getPtrToData(), - sqlStream.getStatementCount(), - getCommitLevel(), - false, - false, - true, - dataHandle); - - /* If this method was called on behalf of a TRUNCATE TABLE statement, and if */ - /* the table has an auto_increment field, then reset the starting value for */ - /* the auto_increment field to 1. - */ - if (rc == 0 && thd_sql_command(ha_thd()) == SQLCOM_TRUNCATE && - table->found_next_number_field ) - rc = reset_auto_increment(1); - - invalidateCachedStats(); - - DBUG_RETURN(rc); -} - - -int ha_ibmdb2i::external_lock(THD *thd, int lock_type) -{ - int rc = 0; - - DBUG_ENTER("ha_ibmdb2i::external_lock"); - DBUG_PRINT("ha_ibmdb2i::external_lock",("Lock type: %d", lock_type)); - - if (lock_type == F_RDLCK) - accessIntent = QMY_READ_ONLY; - else if (lock_type == F_WRLCK) - accessIntent = QMY_UPDATABLE; - - initBridge(thd); - int command = thd_sql_command(thd); - - if (!THDVAR(thd,transaction_unsafe)) - { - if (lock_type != F_UNLCK) - { - if (autoCommitIsOn(thd) == QMY_YES) - { - trans_register_ha(thd, FALSE, ibmdb2i_hton); - } - else - { - trans_register_ha(thd, TRUE, ibmdb2i_hton); - if (likely(command != SQLCOM_CREATE_TABLE)) - { - trans_register_ha(thd, FALSE, ibmdb2i_hton); - bridge()->beginStmtTx(); - } - } - } - } - - if (command == SQLCOM_LOCK_TABLES || - command == SQLCOM_ALTER_TABLE || - command == SQLCOM_UNLOCK_TABLES || - (accessIntent == QMY_UPDATABLE && - (command == SQLCOM_UPDATE || - command == SQLCOM_UPDATE_MULTI || - command == SQLCOM_DELETE || - command == SQLCOM_DELETE_MULTI || - command == SQLCOM_REPLACE || - command == SQLCOM_REPLACE_SELECT) && - getCommitLevel(thd) == QMY_NONE)) - { - char action; - char type; - if (lock_type == F_UNLCK) - { - action = QMY_UNLOCK; - type = accessIntent == QMY_READ_ONLY ? QMY_LSRD : QMY_LENR; - } - else - { - action = QMY_LOCK; - type = lock_type == F_RDLCK ? QMY_LSRD : QMY_LENR; - } - - DBUG_PRINT("ha_ibmdb2i::external_lock",("%socking table", action==QMY_LOCK ? "L" : "Unl")); - - if (!dataHandle) - rc = db2Table->dataFile()->allocateNewInstance(&dataHandle, curConnection); - - rc = bridge()->lockObj(dataHandle, - 0, - action, - type, - (command == SQLCOM_LOCK_TABLES ? QMY_NO : QMY_YES)); - - } - - // Cache this away so we don't have to access it on each row operation - cachedZeroDateOption = (enum_ZeroDate)THDVAR(thd, compat_opt_allow_zero_date_vals); - - DBUG_RETURN(rc); -} - - -THR_LOCK_DATA **ha_ibmdb2i::store_lock(THD *thd, - THR_LOCK_DATA **to, - enum thr_lock_type lock_type) -{ - if (lock_type != TL_IGNORE && lock.type == TL_UNLOCK) - { - if ((lock_type >= TL_WRITE_CONCURRENT_INSERT && - lock_type <= TL_WRITE) && !(thd->in_lock_tables && thd_sql_command(thd) == SQLCOM_LOCK_TABLES)) - lock_type= TL_WRITE_ALLOW_WRITE; - lock.type=lock_type; - } - *to++= &lock; - return to; -} - - -int ha_ibmdb2i::delete_table(const char *name) -{ - DBUG_ENTER("ha_ibmdb2i::delete_table"); - THD* thd = ha_thd(); - db2i_ileBridge* bridge = db2i_ileBridge::getBridgeForThread(thd); - - char db2Name[MAX_DB2_QUALIFIEDNAME_LENGTH]; - db2i_table::getDB2QualifiedNameFromPath(name, db2Name); - - String query(128); - query.append(STRING_WITH_LEN(" DROP TABLE ")); - query.append(db2Name); - - if (thd_sql_command(thd) == SQLCOM_DROP_TABLE && - thd->lex->drop_mode == DROP_RESTRICT) - query.append(STRING_WITH_LEN(" RESTRICT ")); - DBUG_PRINT("ha_ibmdb2i::delete_table", ("Sent to DB2: %s",query.c_ptr())); - - SqlStatementStream sqlStream(query); - - db2i_table::getDB2LibNameFromPath(name, db2Name); - bool isTemporary = (strcmp(db2Name, DB2I_TEMP_TABLE_SCHEMA) == 0 ? TRUE : FALSE); - - int rc = bridge->execSQL(sqlStream.getPtrToData(), - sqlStream.getStatementCount(), - (isTemporary ? QMY_NONE : getCommitLevel(thd)), - FALSE, - FALSE, - isTemporary); - - if (rc == HA_ERR_NO_SUCH_TABLE) - { - warning(thd, DB2I_ERR_TABLE_NOT_FOUND, name); - rc = 0; - } - - if (rc == 0) - { - db2i_table::deleteAssocFiles(name); - } - - FILE_HANDLE savedHandle = bridge->findAndRemovePreservedHandle(name, &share); - while (savedHandle) - { - bridge->deallocateFile(savedHandle, TRUE); - DBUG_ASSERT(share); - if (free_share(share)) - share = NULL; - savedHandle = bridge->findAndRemovePreservedHandle(name, &share); - } - - my_errno = rc; - DBUG_RETURN(rc); -} - - -int ha_ibmdb2i::rename_table(const char * from, const char * to) -{ - DBUG_ENTER("ha_ibmdb2i::rename_table "); - - char db2FromFileName[MAX_DB2_FILENAME_LENGTH + 1]; - char db2ToFileName[MAX_DB2_FILENAME_LENGTH+1]; - char db2FromLibName[MAX_DB2_SCHEMANAME_LENGTH+1]; - char db2ToLibName[MAX_DB2_SCHEMANAME_LENGTH+1]; - - db2i_table::getDB2LibNameFromPath(from, db2FromLibName); - db2i_table::getDB2LibNameFromPath(to, db2ToLibName); - - if (strcmp(db2FromLibName, db2ToLibName) != 0 ) - { - getErrTxt(DB2I_ERR_RENAME_MOVE,from,to); - DBUG_RETURN(DB2I_ERR_RENAME_MOVE); - } - - db2i_table::getDB2FileNameFromPath(from, db2FromFileName, db2i_table::ASCII_NATIVE); - db2i_table::getDB2FileNameFromPath(to, db2ToFileName); - - char escapedFromFileName[2 * MAX_DB2_FILENAME_LENGTH + 1]; - - uint o = 0; - uint i = 1; - do - { - escapedFromFileName[o++] = db2FromFileName[i]; - if (db2FromFileName[i] == '+') - escapedFromFileName[o++] = '+'; - } while (db2FromFileName[++i]); - escapedFromFileName[o-1] = 0; - - - int rc = 0; - - char queryBuffer[sizeof(db2FromLibName) + 2 * sizeof(db2FromFileName) + 256]; - SafeString selectQuery(queryBuffer, sizeof(queryBuffer)); - selectQuery.strncat(STRING_WITH_LEN("SELECT CAST(INDEX_NAME AS VARCHAR(128) CCSID 1208) FROM QSYS2.SYSINDEXES WHERE INDEX_NAME LIKE '%+_+_+_%")); - selectQuery.strcat(escapedFromFileName); - selectQuery.strncat(STRING_WITH_LEN("' ESCAPE '+' AND TABLE_NAME='")); - selectQuery.strncat(db2FromFileName+1, strlen(db2FromFileName)-2); - selectQuery.strncat(STRING_WITH_LEN("' AND TABLE_SCHEMA='")); - selectQuery.strncat(db2FromLibName+1, strlen(db2FromLibName)-2); - selectQuery.strcat('\''); - DBUG_ASSERT(!selectQuery.overflowed()); - - SqlStatementStream indexQuery(selectQuery.ptr()); - - FILE_HANDLE queryFile = 0; - uint32 resultRowLen; - - initBridge(); - rc = bridge()->prepOpen(indexQuery.getPtrToData(), - &queryFile, - &resultRowLen); - - if (unlikely(rc)) - DBUG_RETURN(rc); - - IOReadBuffer rowBuffer(1, resultRowLen); - - int tableNameLen = strlen(db2FromFileName) - 2; - - SqlStatementStream renameQuery(64); - String query; - while (rc == 0) - { - query.length(0); - - rc = bridge()->read(queryFile, - rowBuffer.ptr(), - QMY_READ_ONLY, - QMY_NONE, - QMY_NEXT); - - if (!rc) - { - const char* rowData = rowBuffer.getRowN(0); - char indexFileName[MAX_DB2_FILENAME_LENGTH]; - memset(indexFileName, 0, sizeof(indexFileName)); - - uint16 fileNameLen = *(uint16*)(rowData); - strncpy(indexFileName, rowData + sizeof(uint16), fileNameLen); - - int bytesToRetain = fileNameLen - tableNameLen; - if (bytesToRetain <= 0) - /* We can't handle index names in which the MySQL index name and - the table name together are longer than the max index name. */ - { - getErrTxt(DB2I_ERR_INVALID_NAME,"index","*generated*"); - DBUG_RETURN(DB2I_ERR_INVALID_NAME); - } - char indexName[MAX_DB2_FILENAME_LENGTH]; - memset(indexName, 0, sizeof(indexName)); - - strncpy(indexName, - indexFileName, - bytesToRetain); - - char db2IndexName[MAX_DB2_FILENAME_LENGTH+1]; - - convertMySQLNameToDB2Name(indexFileName, db2IndexName, sizeof(db2IndexName)); - - query.append(STRING_WITH_LEN("RENAME INDEX ")); - query.append(db2FromLibName); - query.append('.'); - query.append(db2IndexName); - query.append(STRING_WITH_LEN(" TO ")); - if (db2i_table::appendQualifiedIndexFileName(indexName, db2ToFileName, query, db2i_table::ASCII_SQL, typeNone) == -1) - { - getErrTxt(DB2I_ERR_INVALID_NAME,"index","*generated*"); - DBUG_RETURN(DB2I_ERR_INVALID_NAME ); - } - renameQuery.addStatement(query); - DBUG_PRINT("ha_ibmdb2i::rename_table", ("Sent to DB2: %s",query.c_ptr_safe())); - } - } - - - if (queryFile) - bridge()->deallocateFile(queryFile); - - if (rc != HA_ERR_END_OF_FILE) - DBUG_RETURN(rc); - - char db2Name[MAX_DB2_QUALIFIEDNAME_LENGTH]; - - /* Rename the table */ - query.length(0); - query.append(STRING_WITH_LEN(" RENAME TABLE ")); - db2i_table::getDB2QualifiedNameFromPath(from, db2Name); - query.append(db2Name); - query.append(STRING_WITH_LEN(" TO ")); - query.append(db2ToFileName); - DBUG_PRINT("ha_ibmdb2i::rename_table", ("Sent to DB2: %s",query.c_ptr_safe())); - renameQuery.addStatement(query); - rc = bridge()->execSQL(renameQuery.getPtrToData(), - renameQuery.getStatementCount(), - getCommitLevel()); - - if (!rc) - db2i_table::renameAssocFiles(from, to); - - DBUG_RETURN(rc); -} - - -int ha_ibmdb2i::create(const char *name, TABLE *table_arg, - HA_CREATE_INFO *create_info) -{ - DBUG_ENTER("ha_ibmdb2i::create"); - - int rc; - char fileSortSequence[11] = "*HEX"; - char fileSortSequenceLibrary[11] = ""; - char fileSortSequenceType = ' '; - char libName[MAX_DB2_SCHEMANAME_LENGTH+1]; - char fileName[MAX_DB2_FILENAME_LENGTH+1]; - char colName[MAX_DB2_COLNAME_LENGTH+1]; - bool isTemporary; - ulong auto_inc_value; - - db2i_table::getDB2LibNameFromPath(name, libName); - db2i_table::getDB2FileNameFromPath(name, fileName); - - if (osVersion.v < 6) - { - if (strlen(libName) > - MAX_DB2_V5R4_LIBNAME_LENGTH + (isOrdinaryIdentifier(libName) ? 2 : 0)) - { - getErrTxt(DB2I_ERR_TOO_LONG_SCHEMA,libName, MAX_DB2_V5R4_LIBNAME_LENGTH); - DBUG_RETURN(DB2I_ERR_TOO_LONG_SCHEMA); - } - } - else if (strlen(libName) > MAX_DB2_V6R1_LIBNAME_LENGTH) - { - getErrTxt(DB2I_ERR_TOO_LONG_SCHEMA,libName, MAX_DB2_V6R1_LIBNAME_LENGTH); - DBUG_RETURN(DB2I_ERR_TOO_LONG_SCHEMA); - } - - String query(256); - - if (strcmp(libName, DB2I_TEMP_TABLE_SCHEMA)) - { - query.append(STRING_WITH_LEN("CREATE TABLE ")); - query.append(libName); - query.append('.'); - query.append(fileName); - isTemporary = FALSE; - } - else - { - query.append(STRING_WITH_LEN("DECLARE GLOBAL TEMPORARY TABLE ")); - query.append(fileName); - isTemporary = TRUE; - } - query.append(STRING_WITH_LEN(" (")); - - THD* thd = ha_thd(); - enum_TimeFormat timeFormat = (enum_TimeFormat)(THDVAR(thd, compat_opt_time_as_duration)); - enum_YearFormat yearFormat = (enum_YearFormat)(THDVAR(thd, compat_opt_year_as_int)); - enum_BlobMapping blobMapping = (enum_BlobMapping)(THDVAR(thd, compat_opt_blob_cols)); - enum_ZeroDate zeroDate = (enum_ZeroDate)(THDVAR(thd, compat_opt_allow_zero_date_vals)); - bool propagateDefaults = THDVAR(thd, propagate_default_col_vals); - - Field **field; - for (field= table_arg->field; *field; field++) - { - if ( field != table_arg->field ) // Not the first one - query.append(STRING_WITH_LEN(" , ")); - - if (!convertMySQLNameToDB2Name((*field)->field_name, colName, sizeof(colName))) - { - getErrTxt(DB2I_ERR_INVALID_NAME,"field",(*field)->field_name); - DBUG_RETURN(DB2I_ERR_INVALID_NAME ); - } - - query.append(colName); - query.append(' '); - - if (rc = getFieldTypeMapping(*field, - query, - timeFormat, - blobMapping, - zeroDate, - propagateDefaults, - yearFormat)) - DBUG_RETURN(rc); - - if ( (*field)->flags & NOT_NULL_FLAG ) - { - query.append(STRING_WITH_LEN(" NOT NULL ")); - } - if ( (*field)->flags & AUTO_INCREMENT_FLAG ) - { -#ifdef WITH_PARTITION_STORAGE_ENGINE - if (table_arg->part_info) - { - getErrTxt(DB2I_ERR_PART_AUTOINC); - DBUG_RETURN(DB2I_ERR_PART_AUTOINC); - } -#endif - query.append(STRING_WITH_LEN(" GENERATED BY DEFAULT AS IDENTITY ") ); - if (create_info->auto_increment_value != 0) - { - /* Query was ALTER TABLE...AUTO_INCREMENT = x; or - CREATE TABLE ...AUTO_INCREMENT = x; Set the starting - value for the auto_increment column. */ - char stringValue[22]; - CHARSET_INFO *cs= &my_charset_bin; - uint len = (uint)(cs->cset->longlong10_to_str)(cs,stringValue,sizeof(stringValue), 10, create_info->auto_increment_value); - stringValue[len] = 0; - query.append(STRING_WITH_LEN(" (START WITH ")); - query.append(stringValue); - - uint64 maxValue=maxValueForField(*field); - - if (maxValue) - { - len = (uint)(cs->cset->longlong10_to_str)(cs,stringValue,sizeof(stringValue), 10, maxValue); - stringValue[len] = 0; - query.append(STRING_WITH_LEN(" MAXVALUE ")); - query.append(stringValue); - } - - query.append(STRING_WITH_LEN(") ")); - } - - } - } - - String fieldDefinition(128); - - if (table_arg->s->primary_key != MAX_KEY && !isTemporary) - { - query.append(STRING_WITH_LEN(", PRIMARY KEY ")); - rc = buildIndexFieldList(fieldDefinition, - table_arg->key_info[table_arg->s->primary_key], - true, - &fileSortSequenceType, - fileSortSequence, - fileSortSequenceLibrary); - if (rc) DBUG_RETURN(rc); - query.append(fieldDefinition); - } - - rc = buildDB2ConstraintString(thd->lex, - query, - name, - table_arg->field, - &fileSortSequenceType, - fileSortSequence, - fileSortSequenceLibrary); - if (rc) DBUG_RETURN (rc); - - query.append(STRING_WITH_LEN(" ) ")); - - if (isTemporary) - query.append(STRING_WITH_LEN(" ON COMMIT PRESERVE ROWS ")); - - if (create_info->alias) - generateAndAppendRCDFMT(create_info->alias, query); - else if (((TABLE_LIST*)(thd->lex->select_lex.table_list.first))->table_name) - generateAndAppendRCDFMT((char*)((TABLE_LIST*)(thd->lex->select_lex.table_list.first))->table_name, query); - - DBUG_PRINT("ha_ibmdb2i::create", ("Sent to DB2: %s",query.c_ptr())); - SqlStatementStream sqlStream(query.length()); - sqlStream.addStatement(query,fileSortSequence,fileSortSequenceLibrary); - - if (table_arg->s->primary_key != MAX_KEY && - !isTemporary && - (THDVAR(thd, create_index_option)==1) && - (fileSortSequenceType != 'B') && - (fileSortSequenceType != ' ')) - { - rc = generateShadowIndex(sqlStream, - table_arg->key_info[table_arg->s->primary_key], - libName, - fileName, - fieldDefinition); - if (rc) DBUG_RETURN(rc); - } - for (uint i = 0; i < table_arg->s->keys; ++i) - { - if (i != table_arg->s->primary_key || isTemporary) - { - rc = buildCreateIndexStatement(sqlStream, - table_arg->key_info[i], - false, - libName, - fileName); - if (rc) DBUG_RETURN (rc); - } - } - - bool noCommit = isTemporary || ((!autoCommitIsOn(thd)) && (thd_sql_command(thd) == SQLCOM_ALTER_TABLE)); - - initBridge(); - -// if (THDVAR(thd, discovery_mode) == 1) -// bridge()->expectErrors(QMY_ERR_TABLE_EXISTS); - - rc = bridge()->execSQL(sqlStream.getPtrToData(), - sqlStream.getStatementCount(), - (isTemporary ? QMY_NONE : getCommitLevel(thd)), - TRUE, - FALSE, - noCommit ); - - if (unlikely(rc == QMY_ERR_MSGID) && - memcmp(bridge()->getErrorMsgID(), DB2I_SQL0350, 7) == 0) - { - my_error(ER_BLOB_USED_AS_KEY, MYF(0), "*unknown*"); - rc = ER_BLOB_USED_AS_KEY; - } -/* else if (unlikely(rc == QMY_ERR_TABLE_EXISTS) && - THDVAR(thd, discovery_mode) == 1) - { - db2i_table* temp = new db2i_table(table_arg->s, name); - int32 rc = temp->fastInitForCreate(name); - delete temp; - - if (!rc) - warning(thd, DB2I_ERR_WARN_CREATE_DISCOVER); - - DBUG_RETURN(rc); - } -*/ - - if (!rc && !isTemporary) - { - db2i_table* temp = new db2i_table(table_arg->s, name); - rc = temp->fastInitForCreate(name); - delete temp; - if (rc) - delete_table(name); - } - - DBUG_RETURN(rc); -} - - -/** - @brief - Add an index on-line to a table. This method is called on behalf of - a CREATE INDEX or ALTER TABLE statement. - It is implemented via a composed DDL statement passed to DB2. -*/ -int ha_ibmdb2i::add_index(TABLE *table_arg, - KEY *key_info, - uint num_of_keys) -{ - DBUG_ENTER("ha_ibmdb2i::add_index"); - - int rc; - SqlStatementStream sqlStream(256); - const char* libName = db2Table->getDB2LibName(db2i_table::ASCII_SQL); - const char* fileName = db2Table->getDB2TableName(db2i_table::ASCII_SQL); - - quiesceAllFileHandles(); - - uint primaryKey = MAX_KEY; - if (table_arg->s->primary_key >= MAX_KEY && !db2Table->isTemporary()) - { - for (int i = 0; i < num_of_keys; ++i) - { - if (strcmp(key_info[i].name, "PRIMARY") == 0) - { - primaryKey = i; - break; - } - else if (primaryKey == MAX_KEY && - key_info[i].flags & HA_NOSAME) - { - primaryKey = i; - for (int j=0 ; j < key_info[i].key_parts ;j++) - { - uint fieldnr= key_info[i].key_part[j].fieldnr; - if (table_arg->s->field[fieldnr]->null_ptr || - table_arg->s->field[fieldnr]->key_length() != - key_info[i].key_part[j].length) - { - primaryKey = MAX_KEY; - break; - } - } - } - } - } - - - for (int i = 0; i < num_of_keys; ++i) - { - KEY& curKey= key_info[i]; - rc = buildCreateIndexStatement(sqlStream, - curKey, - (i == primaryKey), - libName, - fileName); - if (rc) DBUG_RETURN (rc); - } - - rc = bridge()->execSQL(sqlStream.getPtrToData(), - sqlStream.getStatementCount(), - getCommitLevel(), - FALSE, - FALSE, - FALSE, - dataHandle); - - /* Handle the case where a unique index is being created but an error occurs - because the file contains duplicate key values. */ - if (rc == ER_DUP_ENTRY) - print_keydup_error(MAX_KEY,ER(ER_DUP_ENTRY_WITH_KEY_NAME)); - - DBUG_RETURN(rc); -} - -/** - @brief - Drop an index on-line from a table. This method is called on behalf of - a DROP INDEX or ALTER TABLE statement. - It is implemented via a composed DDL statement passed to DB2. -*/ -int ha_ibmdb2i::prepare_drop_index(TABLE *table_arg, - uint *key_num, uint num_of_keys) -{ - DBUG_ENTER("ha_ibmdb2i::prepare_drop_index"); - int rc; - int i = 0; - String query(64); - SqlStatementStream sqlStream(64 * num_of_keys); - SqlStatementStream shadowStream(64 * num_of_keys); - - quiesceAllFileHandles(); - - const char* libName = db2Table->getDB2LibName(db2i_table::ASCII_SQL); - const char* fileName = db2Table->getDB2TableName(db2i_table::ASCII_SQL); - - while (i < num_of_keys) - { - query.length(0); - DBUG_PRINT("info", ("ha_ibmdb2i::prepare_drop_index %u", key_num[i])); - KEY& curKey= table_arg->key_info[key_num[i]]; - if (key_num[i] == table->s->primary_key && !db2Table->isTemporary()) - { - query.append(STRING_WITH_LEN("ALTER TABLE ")); - query.append(libName); - query.append(STRING_WITH_LEN(".")); - query.append(fileName); - query.append(STRING_WITH_LEN(" DROP PRIMARY KEY")); - } - else - { - query.append(STRING_WITH_LEN("DROP INDEX ")); - query.append(libName); - query.append(STRING_WITH_LEN(".")); - db2i_table::appendQualifiedIndexFileName(curKey.name, fileName, query); - } - DBUG_PRINT("ha_ibmdb2i::prepare_drop_index", ("Sent to DB2: %s",query.c_ptr_safe())); - sqlStream.addStatement(query); - - query.length(0); - query.append(STRING_WITH_LEN("DROP INDEX ")); - query.append(libName); - query.append(STRING_WITH_LEN(".")); - db2i_table::appendQualifiedIndexFileName(curKey.name, fileName, query, db2i_table::ASCII_SQL, typeHex); - - DBUG_PRINT("ha_ibmdb2i::prepare_drop_index", ("Sent to DB2: %s",query.c_ptr_safe())); - shadowStream.addStatement(query); - - ++i; - } - - rc = bridge()->execSQL(sqlStream.getPtrToData(), - sqlStream.getStatementCount(), - getCommitLevel(), - FALSE, - FALSE, - FALSE, - dataHandle); - - if (rc == 0) - bridge()->execSQL(shadowStream.getPtrToData(), - shadowStream.getStatementCount(), - getCommitLevel()); - - DBUG_RETURN(rc); -} - - -void -ha_ibmdb2i::unlock_row() -{ - DBUG_ENTER("ha_ibmdb2i::unlock_row"); - DBUG_VOID_RETURN; -} - -int -ha_ibmdb2i::index_end() -{ - DBUG_ENTER("ha_ibmdb2i::index_end"); - warnIfInvalidData(); - last_index_init_rc = 0; - if (likely(activeReadBuf)) - activeReadBuf->endRead(); - if (likely(!last_index_init_rc)) - releaseIndexFile(active_index); - active_index= MAX_KEY; - DBUG_RETURN (0); -} - -int ha_ibmdb2i::doCommit(handlerton *hton, THD *thd, bool all) -{ - if (!THDVAR(thd, transaction_unsafe)) - { - if (all || autoCommitIsOn(thd)) - { - DBUG_PRINT("ha_ibmdb2i::doCommit",("Committing all")); - return (db2i_ileBridge::getBridgeForThread(thd)->commitmentControl(QMY_COMMIT)); - } - else - { - DBUG_PRINT("ha_ibmdb2i::doCommit",("Committing stmt")); - return (db2i_ileBridge::getBridgeForThread(thd)->commitStmtTx()); - } - } - - return (0); -} - - -int ha_ibmdb2i::doRollback(handlerton *hton, THD *thd, bool all) -{ - if (!THDVAR(thd,transaction_unsafe)) - { - if (all || autoCommitIsOn(thd)) - { - DBUG_PRINT("ha_ibmdb2i::doRollback",("Rolling back all")); - return ( db2i_ileBridge::getBridgeForThread(thd)->commitmentControl(QMY_ROLLBACK)); - } - else - { - DBUG_PRINT("ha_ibmdb2i::doRollback",("Rolling back stmt")); - return (db2i_ileBridge::getBridgeForThread(thd)->rollbackStmtTx()); - } - } - return (0); -} - - -void ha_ibmdb2i::start_bulk_insert(ha_rows rows) -{ - DBUG_ENTER("ha_ibmdb2i::start_bulk_insert"); - DBUG_PRINT("ha_ibmdb2i::start_bulk_insert",("Rows hinted %d", rows)); - int rc; - THD* thd = ha_thd(); - int command = thd_sql_command(thd); - - if (db2Table->hasBlobs() || - (command == SQLCOM_REPLACE || command == SQLCOM_REPLACE_SELECT)) - rows = 1; - else if (rows == 0) - rows = DEFAULT_MAX_ROWS_TO_BUFFER; // Shoot the moon - - // If we're doing a multi-row insert, binlogging is active, and the table has an - // auto_increment column, then we'll attempt to lock the file while we perform a 'fast path' blocked - // insert. If we can't get the lock, then we'll do a row-by-row 'slow path' insert instead. The reason is - // because the MI generates the auto_increment (identity value), and if we can't lock the file, - // then we can't predetermine what that value will be for insertion into the MySQL write buffer. - - if ((rows > 1) && // Multi-row insert - (thd->options & OPTION_BIN_LOG) && // Binlogging is on - (table->found_next_number_field)) // Table has an auto_increment column - { - if (!dataHandle) - rc = db2Table->dataFile()->allocateNewInstance(&dataHandle, curConnection); - - rc = bridge()->lockObj(dataHandle, 1, QMY_LOCK, QMY_LEAR, QMY_YES); - if (rc==0) // Got the lock - { - autoIncLockAcquired = TRUE; - got_auto_inc_values = FALSE; - } - else // Didn't get the lock - rows = 1; // No problem, but don't block inserts - } - - if (activeHandle == 0) - { - last_start_bulk_insert_rc = useDataFile(); - if (last_start_bulk_insert_rc == 0) - last_start_bulk_insert_rc = prepWriteBuffer(rows, db2Table->dataFile()); - } - - if (last_start_bulk_insert_rc == 0) - outstanding_start_bulk_insert = true; - else - { - if (autoIncLockAcquired == TRUE) - { - bridge()->lockObj(dataHandle, 0, QMY_UNLOCK, QMY_LEAR, QMY_YES); - autoIncLockAcquired = FALSE; - } - } - - DBUG_VOID_RETURN; -} - - -int ha_ibmdb2i::end_bulk_insert() -{ - DBUG_ENTER("ha_ibmdb2i::end_bulk_insert"); - int rc = 0; - - if (outstanding_start_bulk_insert) - { - rc = finishBulkInsert(); - } - - my_errno = rc; - - DBUG_RETURN(rc); -} - - -int ha_ibmdb2i::prepReadBuffer(ha_rows rowsToRead, const db2i_file* file, char intent) -{ - DBUG_ENTER("ha_ibmdb2i::prepReadBuffer"); - DBUG_ASSERT(rowsToRead > 0); - - THD* thd = ha_thd(); - char cmtLvl = getCommitLevel(thd); - - const db2i_file::RowFormat* format; - int rc = file->obtainRowFormat(activeHandle, intent, cmtLvl, &format); - - if (unlikely(rc)) DBUG_RETURN(rc); - - if (lobFieldsRequested()) - { - forceSingleRowRead = true; - rowsToRead = 1; - } - - rowsToRead = min(stats.records+1,min(rowsToRead, DEFAULT_MAX_ROWS_TO_BUFFER)); - - uint bufSize = min((format->readRowLen * rowsToRead), THDVAR(thd, max_read_buffer_size)); - multiRowReadBuf.allocBuf(format->readRowLen, format->readRowNullOffset, bufSize); - activeReadBuf = &multiRowReadBuf; - - if (db2Table->hasBlobs()) - { - if (!blobReadBuffers) - blobReadBuffers = new BlobCollection(db2Table, THDVAR(thd, lob_alloc_size)); - rc = prepareReadBufferForLobs(); - if (rc) DBUG_RETURN(rc); - } - -// if (accessIntent == QMY_UPDATABLE && -// thd_tx_isolation(thd) == ISO_REPEATABLE_READ && -// !THDVAR(thd, transaction_unsafe)) -// activeReadBuf->update(QMY_READ_ONLY, &releaseRowNeeded, QMY_REPEATABLE_READ); -// else - activeReadBuf->update(intent, &releaseRowNeeded, cmtLvl); - - DBUG_RETURN(rc); -} - - -int ha_ibmdb2i::prepWriteBuffer(ha_rows rowsToWrite, const db2i_file* file) -{ - DBUG_ENTER("ha_ibmdb2i::prepWriteBuffer"); - DBUG_ASSERT(accessIntent == QMY_UPDATABLE && rowsToWrite > 0); - - const db2i_file::RowFormat* format; - int rc = file->obtainRowFormat(activeHandle, - QMY_UPDATABLE, - getCommitLevel(ha_thd()), - &format); - - if (unlikely(rc)) DBUG_RETURN(rc); - - rowsToWrite = min(rowsToWrite, DEFAULT_MAX_ROWS_TO_BUFFER); - - uint bufSize = min((format->writeRowLen * rowsToWrite), THDVAR(ha_thd(), max_write_buffer_size)); - multiRowWriteBuf.allocBuf(format->writeRowLen, format->writeRowNullOffset, bufSize); - activeWriteBuf = &multiRowWriteBuf; - - if (!blobWriteBuffers && db2Table->hasBlobs()) - { - blobWriteBuffers = new ValidatedPointer[db2Table->getBlobCount()]; - } - DBUG_RETURN(rc); -} - - -int ha_ibmdb2i::flushWrite(FILE_HANDLE fileHandle, uchar* buf ) -{ - DBUG_ENTER("ha_ibmdb2i::flushWrite"); - int rc; - int64 generatedIdValue = 0; - bool IdValueWasGenerated = FALSE; - char* lastDupKeyNamePtr = NULL; - uint32 lastDupKeyNameLen = 0; - int loopCnt = 0; - bool retry_dup = FALSE; - - while (loopCnt == 0 || retry_dup == TRUE) - { - rc = bridge()->writeRows(fileHandle, - activeWriteBuf->ptr(), - getCommitLevel(), - &generatedIdValue, - &IdValueWasGenerated, - &lastDupKeyRRN, - &lastDupKeyNamePtr, - &lastDupKeyNameLen, - &incrementByValue); - loopCnt++; - retry_dup = FALSE; - invalidateCachedStats(); - if (lastDupKeyNameLen) - { - rrnAssocHandle = fileHandle; - - int command = thd_sql_command(ha_thd()); - - if (command == SQLCOM_REPLACE || - command == SQLCOM_REPLACE_SELECT) - lastDupKeyID = 0; - else - { - lastDupKeyID = getKeyFromName(lastDupKeyNamePtr, lastDupKeyNameLen); - - if (likely(lastDupKeyID != MAX_KEY)) - { - uint16 failedRow = activeWriteBuf->rowsWritten()+1; - - if (buf && (failedRow != activeWriteBuf->rowCount())) - { - const char* badRow = activeWriteBuf->getRowN(failedRow-1); - bool savedReadAllColumns = readAllColumns; - readAllColumns = true; - mungeDB2row(buf, - badRow, - badRow + activeWriteBuf->getRowNullOffset(), - true); - readAllColumns = savedReadAllColumns; - - if (table->found_next_number_field) - { - table->next_number_field->store(next_identity_value - (incrementByValue * (activeWriteBuf->rowCount() - (failedRow - 1)))); - } - } - - if (default_identity_value && // Table has ID colm and generating a value - (!autoIncLockAcquired || !got_auto_inc_values) && - // Writing first or only row in block - loopCnt == 1 && // Didn't already retry - lastDupKeyID == table->s->next_number_index) // Autoinc column is in failed index - { - if (alterStartWith() == 0) // Reset next Identity value to max+1 - retry_dup = TRUE; // Rtry the write operation - } - } - else - { - char unknownIndex[MAX_DB2_FILENAME_LENGTH+1]; - convFromEbcdic(lastDupKeyNamePtr, unknownIndex, min(lastDupKeyNameLen, MAX_DB2_FILENAME_LENGTH)); - unknownIndex[min(lastDupKeyNameLen, MAX_DB2_FILENAME_LENGTH)] = 0; - getErrTxt(DB2I_ERR_UNKNOWN_IDX, unknownIndex); - } - } - } - } - - if ((rc == 0 || rc == HA_ERR_FOUND_DUPP_KEY) - && default_identity_value && IdValueWasGenerated && - (!autoIncLockAcquired || !got_auto_inc_values)) - { - /* Save the generated identity value for the MySQL last_insert_id() function. */ - insert_id_for_cur_row = generatedIdValue; - - /* Store the value into MySQL's buf for row-based replication - or for an 'on duplicate key update' clause. */ - table->next_number_field->store((longlong) generatedIdValue, TRUE); - if (autoIncLockAcquired) - { - got_auto_inc_values = TRUE; - next_identity_value = generatedIdValue + incrementByValue; - } - } - else - { - if (!autoIncLockAcquired) // Don't overlay value for first row of a block - insert_id_for_cur_row = 0; - } - - - activeWriteBuf->resetAfterWrite(); - DBUG_RETURN(rc); -} - -int ha_ibmdb2i::alterStartWith() -{ - DBUG_ENTER("ha_ibmdb2i::alterStartWith"); - int rc = 0; - ulonglong nextIdVal; - if (!dataHandle) - rc = db2Table->dataFile()->allocateNewInstance(&dataHandle, curConnection); - if (!rc) {rc = bridge()->lockObj(dataHandle, 1, QMY_LOCK, QMY_LENR, QMY_YES);} - if (!rc) - { - rc = getNextIdVal(&nextIdVal); - if (!rc) {rc = reset_auto_increment(nextIdVal);} - bridge()->lockObj(dataHandle, 0, QMY_UNLOCK, QMY_LENR, QMY_YES); - } - DBUG_RETURN(rc); -} - -bool ha_ibmdb2i::lobFieldsRequested() -{ - if (!db2Table->hasBlobs()) - { - DBUG_PRINT("ha_ibmdb2i::lobFieldsRequested",("No LOBs")); - return (false); - } - - if (readAllColumns) - { - DBUG_PRINT("ha_ibmdb2i::lobFieldsRequested",("All cols requested")); - return (true); - } - - for (int i = 0; i < db2Table->getBlobCount(); ++i) - { - if (bitmap_is_set(table->read_set, db2Table->blobFields[i])) - { - DBUG_PRINT("ha_ibmdb2i::lobFieldsRequested",("LOB requested")); - return (true); - } - } - - DBUG_PRINT("ha_ibmdb2i::lobFieldsRequested",("No LOBs requested")); - return (false); -} - - -int ha_ibmdb2i::prepareReadBufferForLobs() -{ - DBUG_ENTER("ha_ibmdb2i::prepareReadBufferForLobs"); - DBUG_ASSERT(db2Table->hasBlobs()); - - uint32 activeLobFields = 0; - DB2LobField* lobField; - uint16 blobCount = db2Table->getBlobCount(); - - char* readBuf = activeReadBuf->getRowN(0); - - for (int i = 0; i < blobCount; ++i) - { - int fieldID = db2Table->blobFields[i]; - DB2Field& db2Field = db2Table->db2Field(fieldID); - lobField = db2Field.asBlobField(readBuf); - if (readAllColumns || - bitmap_is_set(table->read_set, fieldID)) - { - lobField->dataHandle = (ILEMemHandle)blobReadBuffers->getBufferPtr(fieldID); - activeLobFields++; - } - else - { - lobField->dataHandle = NULL; - } - } - - if (activeLobFields == 0) - { - for (int i = 0; i < blobCount; ++i) - { - DB2Field& db2Field = db2Table->db2Field(db2Table->blobFields[i]); - uint16 offset = db2Field.getBufferOffset() + db2Field.calcBlobPad(); - - for (int r = 1; r < activeReadBuf->getRowCapacity(); ++r) - { - lobField = (DB2LobField*)(activeReadBuf->getRowN(r) + offset); - lobField->dataHandle = NULL; - } - } - } - - activeReadBuf->setRowsToProcess((activeLobFields ? 1 : activeReadBuf->getRowCapacity())); - int rc = bridge()->objectOverride(activeHandle, - activeReadBuf->ptr(), - activeReadBuf->getRowLength()); - DBUG_RETURN(rc); -} - - -uint32 ha_ibmdb2i::adjustLobBuffersForRead() -{ - DBUG_ENTER("ha_ibmdb2i::adjustLobBuffersForRead"); - - char* readBuf = activeReadBuf->getRowN(0); - - for (int i = 0; i < db2Table->getBlobCount(); ++i) - { - DB2Field& db2Field = db2Table->db2Field(db2Table->blobFields[i]); - DB2LobField* lobField = db2Field.asBlobField(readBuf); - if (readAllColumns || - bitmap_is_set(table->read_set, db2Table->blobFields[i])) - { - lobField->dataHandle = (ILEMemHandle)blobReadBuffers->reallocBuffer(db2Table->blobFields[i], lobField->length); - - if (lobField->dataHandle == NULL) - DBUG_RETURN(HA_ERR_OUT_OF_MEM); - } - else - { - lobField->dataHandle = 0; - } - } - - int32 rc = bridge()->objectOverride(activeHandle, - activeReadBuf->ptr()); - DBUG_RETURN(rc); -} - - - -int ha_ibmdb2i::reset() -{ - DBUG_ENTER("ha_ibmdb2i::reset"); - - if (outstanding_start_bulk_insert) - { - finishBulkInsert(); - } - - if (activeHandle != 0) - { - releaseActiveHandle(); - } - - cleanupBuffers(); - - db2i_ileBridge::getBridgeForThread(ha_thd())->freeErrorStorage(); - - last_rnd_init_rc = last_index_init_rc = last_start_bulk_insert_rc = 0; - - returnDupKeysImmediately = false; - onDupUpdate = false; - forceSingleRowRead = false; - -#ifndef DBUG_OFF - cachedBridge=NULL; -#endif - - DBUG_RETURN(0); -} - - -int32 ha_ibmdb2i::buildCreateIndexStatement(SqlStatementStream& sqlStream, - KEY& key, - bool isPrimary, - const char* db2LibName, - const char* db2FileName) -{ - DBUG_ENTER("ha_ibmdb2i::buildCreateIndexStatement"); - - char fileSortSequence[11] = "*HEX"; - char fileSortSequenceLibrary[11] = ""; - char fileSortSequenceType = ' '; - String query(256); - query.length(0); - int rc = 0; - - if (isPrimary) - { - query.append(STRING_WITH_LEN("ALTER TABLE ")); - query.append(db2LibName); - query.append('.'); - query.append(db2FileName); - query.append(STRING_WITH_LEN(" ADD PRIMARY KEY ")); - } - else - { - query.append(STRING_WITH_LEN("CREATE")); - - if (key.flags & HA_NOSAME) - query.append(STRING_WITH_LEN(" UNIQUE WHERE NOT NULL")); - - query.append(STRING_WITH_LEN(" INDEX ")); - - query.append(db2LibName); - query.append('.'); - if (db2i_table::appendQualifiedIndexFileName(key.name, db2FileName, query)) - { - getErrTxt(DB2I_ERR_INVALID_NAME,"index","*generated*"); - DBUG_RETURN(DB2I_ERR_INVALID_NAME ); - } - - query.append(STRING_WITH_LEN(" ON ")); - - query.append(db2LibName); - query.append('.'); - query.append(db2FileName); - } - - String fieldDefinition(128); - rc = buildIndexFieldList(fieldDefinition, - key, - isPrimary, - &fileSortSequenceType, - fileSortSequence, - fileSortSequenceLibrary); - - if (rc) DBUG_RETURN(rc); - - query.append(fieldDefinition); - - if ((THDVAR(ha_thd(), create_index_option)==1) && - (fileSortSequenceType != 'B') && - (fileSortSequenceType != ' ')) - { - rc = generateShadowIndex(sqlStream, - key, - db2LibName, - db2FileName, - fieldDefinition); - if (rc) DBUG_RETURN(rc); - } - - DBUG_PRINT("ha_ibmdb2i::buildCreateIndexStatement", ("Sent to DB2: %s",query.c_ptr_safe())); - sqlStream.addStatement(query,fileSortSequence,fileSortSequenceLibrary); - - DBUG_RETURN(0); -} - -/** - Generate the SQL syntax for the list of fields to be assigned to the - specified key. The corresponding sort sequence is also calculated. - - @param[out] appendHere The string to receive the generated SQL - @param key The key to evaluate - @param isPrimary True if this is being generated on behalf of the primary key - @param[out] fileSortSequenceType The type of the associated sort sequence - @param[out] fileSortSequence The name of the associated sort sequence - @param[out] fileSortSequenceLibrary The library of the associated sort sequence - - @return 0 if successful; error value otherwise -*/ -int32 ha_ibmdb2i::buildIndexFieldList(String& appendHere, - const KEY& key, - bool isPrimary, - char* fileSortSequenceType, - char* fileSortSequence, - char* fileSortSequenceLibrary) -{ - DBUG_ENTER("ha_ibmdb2i::buildIndexFieldList"); - appendHere.append(STRING_WITH_LEN(" ( ")); - for (int j = 0; j < key.key_parts; ++j) - { - char colName[MAX_DB2_COLNAME_LENGTH+1]; - if (j != 0) - { - appendHere.append(STRING_WITH_LEN(" , ")); - } - - KEY_PART_INFO& kpi = key.key_part[j]; - Field* field = kpi.field; - - convertMySQLNameToDB2Name(field->field_name, - colName, - sizeof(colName)); - appendHere.append(colName); - - int32 rc; - rc = updateAssociatedSortSequence(field->charset(), - fileSortSequenceType, - fileSortSequence, - fileSortSequenceLibrary); - if (rc) DBUG_RETURN (rc); - } - - appendHere.append(STRING_WITH_LEN(" ) ")); - - DBUG_RETURN(0); -} - - -/** - Generate an SQL statement that defines a *HEX sorted index to implement - the ibmdb2i_create_index. - - @param[out] stream The stream to append the generated statement to - @param key The key to evaluate - @param[out] libName The library containg the table - @param[out] fileName The DB2-compatible name of the table - @param[out] fieldDefinition The list of the fields in the index, in SQL syntax - - @return 0 if successful; error value otherwise -*/ -int32 ha_ibmdb2i::generateShadowIndex(SqlStatementStream& stream, - const KEY& key, - const char* libName, - const char* fileName, - const String& fieldDefinition) -{ - String shadowQuery(256); - shadowQuery.length(0); - shadowQuery.append(STRING_WITH_LEN("CREATE INDEX ")); - shadowQuery.append(libName); - shadowQuery.append('.'); - if (db2i_table::appendQualifiedIndexFileName(key.name, fileName, shadowQuery, db2i_table::ASCII_SQL, typeHex)) - { - getErrTxt(DB2I_ERR_INVALID_NAME,"index","*generated*"); - return DB2I_ERR_INVALID_NAME; - } - shadowQuery.append(STRING_WITH_LEN(" ON ")); - shadowQuery.append(libName); - shadowQuery.append('.'); - shadowQuery.append(fileName); - shadowQuery.append(fieldDefinition); - DBUG_PRINT("ha_ibmdb2i::generateShadowIndex", ("Sent to DB2: %s",shadowQuery.c_ptr_safe())); - stream.addStatement(shadowQuery,"*HEX","QSYS"); - return 0; -} - - -void ha_ibmdb2i::doInitialRead(char orientation, - uint32 rowsToBuffer, - ILEMemHandle key, - int keyLength, - int keyParts) -{ - DBUG_ENTER("ha_ibmdb2i::doInitialRead"); - - if (forceSingleRowRead) - rowsToBuffer = 1; - else - rowsToBuffer = min(rowsToBuffer, activeReadBuf->getRowCapacity()); - - activeReadBuf->newReadRequest(activeHandle, - orientation, - rowsToBuffer, - THDVAR(ha_thd(), async_enabled), - key, - keyLength, - keyParts); - DBUG_VOID_RETURN; -} - - -int ha_ibmdb2i::start_stmt(THD *thd, thr_lock_type lock_type) -{ - DBUG_ENTER("ha_ibmdb2i::start_stmt"); - initBridge(thd); - if (!THDVAR(thd, transaction_unsafe)) - { - trans_register_ha(thd, FALSE, ibmdb2i_hton); - - if (!autoCommitIsOn(thd)) - { - bridge()->beginStmtTx(); - } - } - - DBUG_RETURN(0); -} - -int32 ha_ibmdb2i::handleLOBReadOverflow() -{ - DBUG_ENTER("ha_ibmdb2i::handleLOBReadOverflow"); - DBUG_ASSERT(db2Table->hasBlobs() && (activeReadBuf->getRowCapacity() == 1)); - - int32 rc = adjustLobBuffersForRead(); - - if (!rc) - { - activeReadBuf->rewind(); - rc = bridge()->expectErrors(QMY_ERR_END_OF_BLOCK) - ->read(activeHandle, - activeReadBuf->ptr(), - accessIntent, - getCommitLevel(), - QMY_SAME); - releaseRowNeeded = TRUE; - - } - DBUG_RETURN(rc); -} - - -int32 ha_ibmdb2i::finishBulkInsert() -{ - int32 rc = 0; - - if (activeWriteBuf->rowCount() && activeHandle) - rc = flushWrite(activeHandle, table->record[0]); - - if (activeHandle) - releaseActiveHandle(); - - if (autoIncLockAcquired == TRUE) - { - // We could check the return code on the unlock, but beware not - // to overlay the return code from the flushwrite or we will mask - // duplicate key errors.. - bridge()->lockObj(dataHandle, 0, QMY_UNLOCK, QMY_LEAR, QMY_YES); - autoIncLockAcquired = FALSE; - } - outstanding_start_bulk_insert = false; - multiRowWriteBuf.freeBuf(); - last_start_bulk_insert_rc = 0; - - resetCharacterConversionBuffers(); - - return rc; -} - -int ha_ibmdb2i::getKeyFromName(const char* name, size_t len) -{ - for (int i = 0; i < table_share->keys; ++i) - { - const char* indexName = db2Table->indexFile(i)->getDB2FileName(); - if ((strncmp(name, indexName, len) == 0) && - (strlen(indexName) == len)) - { - return i; - } - } - return MAX_KEY; -} - -/* -Determine the number of I/O's it takes to read through the table. - */ -double ha_ibmdb2i::scan_time() - { - DBUG_ENTER("ha_ibmdb2i::scan_time"); - DBUG_RETURN(ulonglong2double((stats.data_file_length)/IO_SIZE)); - } - - -/** - Estimate the number of I/O's it takes to read a set of ranges through - an index. - - @param index - @param ranges - @param rows - - @return The estimate number of I/Os -*/ - -double ha_ibmdb2i::read_time(uint index, uint ranges, ha_rows rows) -{ - DBUG_ENTER("ha_ibmdb2i::read_time"); - int rc; - uint64 idxPageCnt = 0; - double cost; - - if (unlikely(rows == HA_POS_ERROR)) - DBUG_RETURN(double(rows) + ranges); - - rc = bridge()->retrieveIndexInfo(db2Table->indexFile(index)->getMasterDefnHandle(), - &idxPageCnt); - if (!rc) - { - if ((idxPageCnt == 1) || // Retrieving rows in requested order or - (ranges == rows)) // 'Sweep' full records retrieval - cost = idxPageCnt/4; - else - { - uint64 totalRecords = stats.records + 1; - double dataPageCount = stats.data_file_length/IO_SIZE; - - cost = (rows * dataPageCount / totalRecords) + - min(idxPageCnt, (log_2(idxPageCnt) * ranges + - rows * (log_2(idxPageCnt) + log_2(rows) - log_2(totalRecords)))); - } - } - else - { - cost = rows2double(ranges+rows); // Use default costing - } - DBUG_RETURN(cost); -} - -int ha_ibmdb2i::useIndexFile(int idx) -{ - DBUG_ENTER("ha_ibmdb2i::useIndexFile"); - - if (activeHandle) - releaseActiveHandle(); - - int rc = 0; - - if (!indexHandles[idx]) - rc = db2Table->indexFile(idx)->allocateNewInstance(&indexHandles[idx], curConnection); - - if (rc == 0) - { - activeHandle = indexHandles[idx]; - bumpInUseCounter(1); - } - - DBUG_RETURN(rc); -} - - -ulong ha_ibmdb2i::index_flags(uint inx, uint part, bool all_parts) const -{ - return HA_READ_NEXT | HA_READ_PREV | HA_KEYREAD_ONLY | HA_READ_ORDER | HA_READ_RANGE; -} - - -static struct st_mysql_sys_var* ibmdb2i_system_variables[] = { - MYSQL_SYSVAR(rdb_name), - MYSQL_SYSVAR(transaction_unsafe), - MYSQL_SYSVAR(lob_alloc_size), - MYSQL_SYSVAR(max_read_buffer_size), - MYSQL_SYSVAR(max_write_buffer_size), - MYSQL_SYSVAR(async_enabled), - MYSQL_SYSVAR(assume_exclusive_use), - MYSQL_SYSVAR(compat_opt_blob_cols), - MYSQL_SYSVAR(compat_opt_time_as_duration), - MYSQL_SYSVAR(compat_opt_allow_zero_date_vals), - MYSQL_SYSVAR(compat_opt_year_as_int), - MYSQL_SYSVAR(propagate_default_col_vals), - MYSQL_SYSVAR(create_index_option), -// MYSQL_SYSVAR(discovery_mode), - MYSQL_SYSVAR(system_trace_level), - NULL -}; - - -struct st_mysql_storage_engine ibmdb2i_storage_engine= -{ MYSQL_HANDLERTON_INTERFACE_VERSION }; - -mysql_declare_plugin(ibmdb2i) -{ - MYSQL_STORAGE_ENGINE_PLUGIN, - &ibmdb2i_storage_engine, - "IBMDB2I", - "The IBM development team in Rochester, Minnesota", - "IBM DB2 for i Storage Engine", - PLUGIN_LICENSE_GPL, - ibmdb2i_init_func, /* Plugin Init */ - ibmdb2i_done_func, /* Plugin Deinit */ - 0x0100 /* 1.0 */, - NULL, /* status variables */ - ibmdb2i_system_variables, /* system variables */ - NULL /* config options */ -} -mysql_declare_plugin_end; diff --git a/storage/ibmdb2i/ha_ibmdb2i.h b/storage/ibmdb2i/ha_ibmdb2i.h deleted file mode 100644 index b2a43232f2d..00000000000 --- a/storage/ibmdb2i/ha_ibmdb2i.h +++ /dev/null @@ -1,822 +0,0 @@ -/* -Licensed Materials - Property of IBM -DB2 Storage Engine Enablement -Copyright IBM Corporation 2007,2008 -All rights reserved - -Redistribution and use in source and binary forms, with or without modification, -are permitted provided that the following conditions are met: - (a) Redistributions of source code must retain this list of conditions, the - copyright notice in section {d} below, and the disclaimer following this - list of conditions. - (b) Redistributions in binary form must reproduce this list of conditions, the - copyright notice in section (d) below, and the disclaimer following this - list of conditions, in the documentation and/or other materials provided - with the distribution. - (c) The name of IBM may not be used to endorse or promote products derived from - this software without specific prior written permission. - (d) The text of the required copyright notice is: - Licensed Materials - Property of IBM - DB2 Storage Engine Enablement - Copyright IBM Corporation 2007,2008 - All rights reserved - -THIS SOFTWARE IS PROVIDED BY IBM CORPORATION "AS IS" AND ANY EXPRESS OR IMPLIED -WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF -MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT -SHALL IBM CORPORATION BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, -EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT -OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS -INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN -CONTRACT, STRICT LIABILITY, OR TORT INCLUDING NEGLIGENCE OR OTHERWISE) ARISING -IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY -OF SUCH DAMAGE. -*/ - -/** @file ha_ibmdb2i.h - - @brief - - @note - - @see -*/ - -#ifdef USE_PRAGMA_INTERFACE -#pragma interface /* gcc class implementation */ -#endif - -#include "as400_types.h" -#include "as400_protos.h" -#include "db2i_global.h" -#include "db2i_ileBridge.h" -#include "builtins.h" -#include "db2i_misc.h" -#include "db2i_file.h" -#include "db2i_blobCollection.h" -#include "db2i_collationSupport.h" -#include "db2i_validatedPointer.h" -#include "db2i_ioBuffers.h" -#include "db2i_errors.h" -#include "db2i_sqlStatementStream.h" - -/** @brief - IBMDB2I_SHARE is a structure that will be shared among all open handlers. - It is used to describe the underlying table definition, and it caches - table statistics. -*/ -struct IBMDB2I_SHARE { - char *table_name; - uint table_name_length,use_count; - pthread_mutex_t mutex; - THR_LOCK lock; - - db2i_table* db2Table; - - class CStats - { - public: - void cacheUpdateTime(time_t time) - {update_time = time; initFlag |= lastModTime;} - time_t getUpdateTime() const - {return update_time;} - void cacheRowCount(ha_rows rows) - {records = rows; initFlag |= rowCount;} - ha_rows getRowCount() const - {return records;} - void cacheDelRowCount(ha_rows rows) - {deleted = rows; initFlag |= deletedRowCount;} - ha_rows getDelRowCount() const - {return deleted;} - void cacheMeanLength(ulong len) - {mean_rec_length = len; initFlag |= meanRowLen;} - ulong getMeanLength() - {return mean_rec_length;} - void cacheAugmentedDataLength(ulong len) - {data_file_length = len; initFlag |= ioCount;} - ulong getAugmentedDataLength() - {return data_file_length;} - bool isInited(uint flags) - {return initFlag & flags;} - void invalidate(uint flags) - {initFlag &= ~flags;} - - private: - uint initFlag; - time_t update_time; - ha_rows records; - ha_rows deleted; - ulong mean_rec_length; - ulong data_file_length; - } cachedStats; - -}; - -class ha_ibmdb2i: public handler -{ - THR_LOCK_DATA lock; ///< MySQL lock - IBMDB2I_SHARE *share; ///< Shared lock info - - // The record we are positioned on, together with the handle used to get - // i. - uint32 currentRRN; - uint32 rrnAssocHandle; - - // Dup key values needed by info() - uint32 lastDupKeyRRN; - uint32 lastDupKeyID; - - bool returnDupKeysImmediately; - - // Dup key value need by update() - bool onDupUpdate; - - - db2i_table* db2Table; - - // The file handle of the PF or LF being accessed by the current operation. - FILE_HANDLE activeHandle; - - // The file handle of the underlying PF - FILE_HANDLE dataHandle; - - // Array of file handles belonging to the underlying LFs - FILE_HANDLE* indexHandles; - - // Flag to indicate whether a call needs to be made to unlock a row when - // a read operation has ended. DB2 will handle row unlocking as we move - // through rows, but if an operation ends before we reach the end of a file, - // DB2 needs to know to unlock the last row read. - bool releaseRowNeeded; - - // Pointer to a definition of the layout of the row buffer for the file - // described by activeHandle - const db2i_file::RowFormat* activeFormat; - - IORowBuffer keyBuf; - uint32 keyLen; - - IOWriteBuffer multiRowWriteBuf; - IOAsyncReadBuffer multiRowReadBuf; - - IOAsyncReadBuffer* activeReadBuf; - IOWriteBuffer* activeWriteBuf; - - BlobCollection* blobReadBuffers; // Dynamically allocated per query and used - // to manage the buffers used for reading LOBs - ValidatedPointer* blobWriteBuffers; - - // Return codes are not used/honored by rnd_init and start_bulk_insert - // so we need a way to signal the failure "downstream" to subsequent - // functions. - int last_rnd_init_rc; - int last_index_init_rc; - int last_start_bulk_insert_rc; - - // end_bulk_insert may get called twice for a single start_bulk_insert - // This is our way to do cleanup only once. - bool outstanding_start_bulk_insert; - - // Auto_increment 'increment by' value needed by write_row() - uint32 incrementByValue; - bool default_identity_value; - - // Flags and values used during write operations for auto_increment processing - bool autoIncLockAcquired; - bool got_auto_inc_values; - uint64 next_identity_value; - - // The access intent indicated by the last external_locks() call. - // May be either QMY_READ or QMY_UPDATABLE - char accessIntent; - char readAccessIntent; - - ha_rows* indexReadSizeEstimates; - - MEM_ROOT conversionBufferMemroot; - - bool forceSingleRowRead; - - bool readAllColumns; - - bool invalidDataFound; - - db2i_ileBridge* cachedBridge; - - ValidatedObject curConnection; - uint16 activeReferences; - -public: - - ha_ibmdb2i(handlerton *hton, TABLE_SHARE *table_arg); - ~ha_ibmdb2i(); - - const char *table_type() const { return "IBMDB2I"; } - const char *index_type(uint inx) { return "RADIX"; } - const key_map *keys_to_use_for_scanning() { return &key_map_full; } - const char **bas_ext() const; - - ulonglong table_flags() const - { - return HA_NULL_IN_KEY | HA_REC_NOT_IN_SEQ | HA_AUTO_PART_KEY | - HA_PARTIAL_COLUMN_READ | - HA_DUPLICATE_POS | HA_NO_PREFIX_CHAR_KEYS | - HA_HAS_RECORDS | HA_BINLOG_ROW_CAPABLE | HA_REQUIRES_KEY_COLUMNS_FOR_DELETE | - HA_CAN_INDEX_BLOBS; - } - - ulong index_flags(uint inx, uint part, bool all_parts) const; - -// Note that we do not implement max_supported_record_length. -// We'll let create fail accordingly if the row is -// too long. This allows us to hide the fact that varchars > 32K are being -// implemented as DB2 LOBs. - - uint max_supported_keys() const { return 4000; } - uint max_supported_key_parts() const { return MAX_DB2_KEY_PARTS; } - uint max_supported_key_length() const { return 32767; } - uint max_supported_key_part_length() const { return 32767; } - double read_time(uint index, uint ranges, ha_rows rows); - double scan_time(); - int open(const char *name, int mode, uint test_if_locked); - int close(void); - int write_row(uchar * buf); - int update_row(const uchar * old_data, uchar * new_data); - int delete_row(const uchar * buf); - int index_init(uint idx, bool sorted); - int index_read(uchar * buf, const uchar * key, - uint key_len, enum ha_rkey_function find_flag); - int index_next(uchar * buf); - int index_read_last(uchar * buf, const uchar * key, uint key_len); - int index_next_same(uchar *buf, const uchar *key, uint keylen); - int index_prev(uchar * buf); - int index_first(uchar * buf); - int index_last(uchar * buf); - int rnd_init(bool scan); - int rnd_end(); - int rnd_next(uchar *buf); - int rnd_pos(uchar * buf, uchar *pos); - void position(const uchar *record); - int info(uint); - ha_rows records(); - int extra(enum ha_extra_function operation); - int external_lock(THD *thd, int lock_type); - int delete_all_rows(void); - ha_rows records_in_range(uint inx, key_range *min_key, - key_range *max_key); - int delete_table(const char *from); - int rename_table(const char * from, const char * to); - int create(const char *name, TABLE *form, - HA_CREATE_INFO *create_info); - int updateFrm(TABLE *table_def, File file); - int openTableDef(TABLE *table_def); - int add_index(TABLE *table_arg, KEY *key_info, uint num_of_keys); - int prepare_drop_index(TABLE *table_arg, uint *key_num, uint num_of_keys); - int final_drop_index(TABLE *table_arg) {return 0;} - void get_auto_increment(ulonglong offset, ulonglong increment, - ulonglong nb_desired_values, - ulonglong *first_value, - ulonglong *nb_reserved_values); - int reset_auto_increment(ulonglong value); - void restore_auto_increment(ulonglong prev_insert_id) {return;} - void update_create_info(HA_CREATE_INFO *create_info); - int getNextIdVal(ulonglong *value); - int analyze(THD* thd,HA_CHECK_OPT* check_opt); - int optimize(THD* thd, HA_CHECK_OPT* check_opt); - bool can_switch_engines(); - void free_foreign_key_create_info(char* str); - char* get_foreign_key_create_info(); - int get_foreign_key_list(THD *thd, List *f_key_list); - uint referenced_by_foreign_key(); - bool check_if_incompatible_data(HA_CREATE_INFO *info, uint table_changes); - virtual bool get_error_message(int error, String *buf); - - THR_LOCK_DATA **store_lock(THD *thd, THR_LOCK_DATA **to, - enum thr_lock_type lock_type); - - bool low_byte_first() const { return 0; } - void unlock_row(); - int index_end(); - int reset(); - static int doCommit(handlerton *hton, THD *thd, bool all); - static int doRollback(handlerton *hton, THD *thd, bool all); - void start_bulk_insert(ha_rows rows); - int end_bulk_insert(); - int start_stmt(THD *thd, thr_lock_type lock_type); - - void initBridge(THD* thd = NULL) - { - if (thd == NULL) thd = ha_thd(); - DBUG_PRINT("ha_ibmdb2i::initBridge",("Initing bridge. Conn ID=%d", thd->thread_id)); - cachedBridge = db2i_ileBridge::getBridgeForThread(thd); - } - - db2i_ileBridge* bridge() {DBUG_ASSERT(cachedBridge); return cachedBridge;} - - static uint8 autoCommitIsOn(THD* thd) - { return (thd_test_options(thd, OPTION_NOT_AUTOCOMMIT | OPTION_BEGIN) ? QMY_NO : QMY_YES); } - - uint8 getCommitLevel(); - uint8 getCommitLevel(THD* thd); - - static int doSavepointSet(THD* thd, char* name) - { - return db2i_ileBridge::getBridgeForThread(thd)->savepoint(QMY_SET_SAVEPOINT, - name); - } - - static int doSavepointRollback(THD* thd, char* name) - { - return db2i_ileBridge::getBridgeForThread(thd)->savepoint(QMY_ROLLBACK_SAVEPOINT, - name); - } - - static int doSavepointRelease(THD* thd, char* name) - { - return db2i_ileBridge::getBridgeForThread(thd)->savepoint(QMY_RELEASE_SAVEPOINT, - name); - } - - // We can't guarantee that the rows we know about when this is called - // will be the same number of rows that read returns (since DB2 activity - // may insert additional rows). Therefore, we do as the Federated SE and - // return the max possible. - ha_rows estimate_rows_upper_bound() - { - return HA_POS_ERROR; - } - - -private: - - enum enum_TimeFormat - { - TIME_OF_DAY, - DURATION - }; - - enum enum_BlobMapping - { - AS_BLOB, - AS_VARCHAR - }; - - enum enum_ZeroDate - { - NO_SUBSTITUTE, - SUBSTITUTE_0001_01_01 - }; - - enum enum_YearFormat - { - CHAR4, - SMALLINT - }; - - enum_ZeroDate cachedZeroDateOption; - - IBMDB2I_SHARE *get_share(const char *table_name, TABLE *table); - int free_share(IBMDB2I_SHARE *share); - int32 mungeDB2row(uchar* record, const char* dataPtr, const char* nullMapPtr, bool skipLOBs); - int prepareRowForWrite(char* data, char* nulls, bool honorIdentCols); - int prepareReadBufferForLobs(); - int32 prepareWriteBufferForLobs(); - uint32 adjustLobBuffersForRead(); - bool lobFieldsRequested(); - int convertFieldChars(enum_conversionDirection direction, - uint16 fieldID, - const char* input, - char* output, - size_t ilen, - size_t olen, - size_t* outDataLen, - bool tacitErrors=FALSE, - size_t* substChars=NULL); - - /** - Fast integer log2 function - */ - uint64 log_2(uint64 val) - { - uint64 exp = 0; - while( (val >> exp) != 0) - { - exp++; - } - DBUG_ASSERT(exp-1 == (uint64)log2(val)); - return exp-1; - } - - void bumpInUseCounter(uint16 amount) - { - activeReferences += amount; - DBUG_PRINT("ha_ibmdb2i::bumpInUseCounter", ("activeReferences = %d", activeReferences)); - if (activeReferences) - curConnection = (uint32)(ha_thd()->thread_id); - else - curConnection = 0; - } - - - int useDataFile() - { - DBUG_ENTER("ha_ibmdb2i::useDataFile"); - - int rc = 0; - if (!dataHandle) - rc = db2Table->dataFile()->allocateNewInstance(&dataHandle, curConnection); - else if (activeHandle == dataHandle) - DBUG_RETURN(0); - - DBUG_ASSERT(activeHandle == 0); - - if (likely(rc == 0)) - { - activeHandle = dataHandle; - bumpInUseCounter(1); - } - - DBUG_RETURN(rc); - } - - void releaseAnyLockedRows() - { - if (releaseRowNeeded) - { - DBUG_PRINT("ha_ibmdb2i::releaseAnyLockedRows", ("Releasing rows")); - db2i_ileBridge::getBridgeForThread()->rrlslck(activeHandle, accessIntent); - releaseRowNeeded = FALSE; - } - } - - - void releaseDataFile() - { - DBUG_ENTER("ha_ibmdb2i::releaseDataFile"); - releaseAnyLockedRows(); - bumpInUseCounter(-1); - DBUG_ASSERT((volatile int)activeReferences >= 0); - activeHandle = 0; - DBUG_VOID_RETURN; - } - - int useIndexFile(int idx); - - void releaseIndexFile(int idx) - { - DBUG_ENTER("ha_ibmdb2i::releaseIndexFile"); - releaseAnyLockedRows(); - bumpInUseCounter(-1); - DBUG_ASSERT((volatile int)activeReferences >= 0); - activeHandle = 0; - DBUG_VOID_RETURN; - } - - FILE_HANDLE allocateFileHandle(char* database, char* table, int* activityReference, bool hasBlobs); - - int updateBuffers(const db2i_file::RowFormat* format, uint rowsToRead, uint rowsToWrite); - - int flushWrite(FILE_HANDLE fileHandle, uchar* buf = NULL); - - int alterStartWith(); - - int buildDB2ConstraintString(LEX* lex, - String& appendHere, - const char* database, - Field** fields, - char* fileSortSequenceType, - char* fileSortSequence, - char* fileSortSequenceLibrary); - - void releaseWriteBuffer(); - - void setIndexReadEstimate(uint index, ha_rows rows) - { - if (!indexReadSizeEstimates) - { - indexReadSizeEstimates = (ha_rows*)my_malloc(sizeof(ha_rows) * table->s->keys, MYF(MY_WME | MY_ZEROFILL)); - } - indexReadSizeEstimates[index] = rows; - } - - ha_rows getIndexReadEstimate(uint index) - { - if (indexReadSizeEstimates) - return max(indexReadSizeEstimates[index], 1); - - return 10000; // Assume index scan if no estimate exists. - } - - - void quiesceAllFileHandles() - { - db2i_ileBridge* bridge = db2i_ileBridge::getBridgeForThread(); - if (dataHandle) - { - bridge->quiesceFileInstance(dataHandle); - } - - for (int idx = 0; idx < table_share->keys; ++idx) - { - if (indexHandles[idx] != 0) - { - bridge->quiesceFileInstance(indexHandles[idx]); - } - } - } - - int32 buildCreateIndexStatement(SqlStatementStream& sqlStream, - KEY& key, - bool isPrimary, - const char* db2LibName, - const char* db2FileName); - - int32 buildIndexFieldList(String& appendHere, - const KEY& key, - bool isPrimary, - char* fileSortSequenceType, - char* fileSortSequence, - char* fileSortSequenceLibrary); - - // Specify NULL for data when using the data pointed to by field - int32 convertMySQLtoDB2(Field* field, const DB2Field& db2Field, char* db2Buf, const uchar* data = NULL); - - int32 convertDB2toMySQL(const DB2Field& db2Field, Field* field, const char* buf); - int getFieldTypeMapping(Field* field, - String& mapping, - enum_TimeFormat timeFormate, - enum_BlobMapping blobMapping, - enum_ZeroDate zeroDateHandling, - bool propagateDefaults, - enum_YearFormat yearFormat); - - int getKeyFromName(const char* name, size_t len); - - void releaseActiveHandle() - { - if (activeHandle == dataHandle) - releaseDataFile(); - else - releaseIndexFile(active_index); - } - - - int32 finishBulkInsert(); - - void doInitialRead(char orientation, - uint32 rowsToBuffer, - ILEMemHandle key = 0, - int keyLength = 0, - int keyParts = 0); - - - int32 readFromBuffer(uchar* destination, char orientation) - { - char* row; - int32 rc = 0; - row = activeReadBuf->readNextRow(orientation, currentRRN); - - if (unlikely(!row)) - { - rc = activeReadBuf->lastrc(); - if (rc == QMY_ERR_LOB_SPACE_TOO_SMALL) - { - rc = handleLOBReadOverflow(); - if (rc == 0) - { - DBUG_ASSERT(activeReadBuf->rowCount() == 1); - row = activeReadBuf->readNextRow(orientation, currentRRN); - - if (unlikely(!row)) - rc = activeReadBuf->lastrc(); - } - } - } - - if (likely(rc == 0)) - { - rrnAssocHandle = activeHandle; - rc = mungeDB2row(destination, row, row+activeReadBuf->getRowNullOffset(), false); - } - return rc; - } - - int32 handleLOBReadOverflow(); - - char* getCharacterConversionBuffer(int fieldId, int length) - { - if (unlikely(!alloc_root_inited(&conversionBufferMemroot))) - init_alloc_root(&conversionBufferMemroot, 8192, 0); - - return (char*)alloc_root(&conversionBufferMemroot, length);; - } - - void resetCharacterConversionBuffers() - { - if (alloc_root_inited(&conversionBufferMemroot)) - { - free_root(&conversionBufferMemroot, MYF(MY_MARK_BLOCKS_FREE)); - } - } - - void tweakReadSet() - { - THD* thd = ha_thd(); - int command = thd_sql_command(thd); - if ((command == SQLCOM_UPDATE || - command == SQLCOM_UPDATE_MULTI) || - ((command == SQLCOM_DELETE || - command == SQLCOM_DELETE_MULTI) && - thd->options & OPTION_BIN_LOG)) - readAllColumns = TRUE; - else - readAllColumns = FALSE; - } - - /** - - */ - int useFileByHandle(char intent, - FILE_HANDLE handle) - { - DBUG_ENTER("ha_ibmdb2i::useFileByHandle"); - - const db2i_file* file; - if (handle == dataHandle) - file = db2Table->dataFile(); - else - { - for (uint i = 0; i < table_share->keys; ++i) - { - if (indexHandles[i] == handle) - { - file = db2Table->indexFile(i); - active_index = i; - } - } - } - - int rc = file->obtainRowFormat(handle, intent, getCommitLevel(), &activeFormat); - if (likely(rc == 0)) - { - activeHandle = handle; - bumpInUseCounter(1); - } - - DBUG_RETURN(rc); - } - - const db2i_file* getFileForActiveHandle() const - { - if (activeHandle == dataHandle) - return db2Table->dataFile(); - else - for (uint i = 0; i < table_share->keys; ++i) - if (indexHandles[i] == activeHandle) - return db2Table->indexFile(i); - DBUG_ASSERT(0); - return NULL; - } - - int prepReadBuffer(ha_rows rowsToRead, const db2i_file* file, char intent); - int prepWriteBuffer(ha_rows rowsToWrite, const db2i_file* file); - - void invalidateCachedStats() - { - share->cachedStats.invalidate(rowCount | deletedRowCount | objLength | - meanRowLen | ioCount); - } - - void warnIfInvalidData() - { - if (unlikely(invalidDataFound)) - { - warning(ha_thd(), DB2I_ERR_INVALID_DATA, table->alias); - } - } - - /** - Calculate the maximum value that a particular field can hold. - - This is used to anticipate overflows in the auto_increment processing. - - @param field The Field to be analyzed - - @return The maximum value - */ - static uint64 maxValueForField(const Field* field) - { - uint64 maxValue=0; - switch (field->type()) - { - case MYSQL_TYPE_TINY: - if (((const Field_num*)field)->unsigned_flag) - maxValue = (1 << 8) - 1; - else - maxValue = (1 << 7) - 1; - break; - case MYSQL_TYPE_SHORT: - if (((const Field_num*)field)->unsigned_flag) - maxValue = (1 << 16) - 1; - else - maxValue = (1 << 15) - 1; - break; - case MYSQL_TYPE_INT24: - if (((const Field_num*)field)->unsigned_flag) - maxValue = (1 << 24) - 1; - else - maxValue = (1 << 23) - 1; - break; - case MYSQL_TYPE_LONG: - if (((const Field_num*)field)->unsigned_flag) - maxValue = (1LL << 32) - 1; - else - maxValue = (1 << 31) - 1; - break; - case MYSQL_TYPE_LONGLONG: - if (((const Field_num*)field)->unsigned_flag) - maxValue = ~(0LL); - else - maxValue = 1 << 63 - 1; - break; - } - - return maxValue; - } - - void cleanupBuffers() - { - if (blobReadBuffers) - { - delete blobReadBuffers; - blobReadBuffers = NULL; - } - if (blobWriteBuffers) - { - delete[] blobWriteBuffers; - blobWriteBuffers = NULL; - } - if (alloc_root_inited(&conversionBufferMemroot)) - { - free_root(&conversionBufferMemroot, MYF(0)); - } - } - - -/** - Generate a valid RCDFMT name based on the name of the table. - - The RCDFMT name is devised by munging the name of the table, - uppercasing all ascii alpha-numeric characters and replacing all other - characters with underscores until up to ten characters have been generated. - - @param tableName The name of the table, as given on the MySQL - CREATE TABLE statement - @param[out] query The string to receive the generated RCDFMT name -*/ - static void generateAndAppendRCDFMT(const char* tableName, String& query) - { - char rcdfmt[11]; - - // The RCDFMT name must begin with an alpha character. - // We enforce this by skipping to the first alpha character in the table - // name. If no alpha character exists, we use 'X' for the RCDFMT name; - - while (*tableName && - (!my_isascii(*tableName) || - !my_isalpha(system_charset_info, *tableName))) - { - tableName += my_mbcharlen(system_charset_info, *tableName); - } - - if (unlikely(!(*tableName))) - { - rcdfmt[0]= 'X'; - rcdfmt[1]= 0; - } - else - { - int r= 0; - while ((r < sizeof(rcdfmt)-1) && *tableName) - { - if (my_isascii(*tableName) && - my_isalnum(system_charset_info, *tableName)) - rcdfmt[r] = my_toupper(system_charset_info, *tableName); - else - rcdfmt[r] = '_'; - - ++r; - tableName += my_mbcharlen(system_charset_info, *tableName); - } - rcdfmt[r]= 0; - } - query.append(STRING_WITH_LEN(" RCDFMT ")); - query.append(rcdfmt); - } - - int32 generateShadowIndex(SqlStatementStream& stream, - const KEY& key, - const char* libName, - const char* fileName, - const String& fieldDefinition); -}; diff --git a/storage/ibmdb2i/plug.in b/storage/ibmdb2i/plug.in deleted file mode 100644 index 0913d72aabf..00000000000 --- a/storage/ibmdb2i/plug.in +++ /dev/null @@ -1,12 +0,0 @@ -MYSQL_STORAGE_ENGINE([ibmdb2i], [], [IBM DB2 for i Storage Engine], - [IBM DB2 for i Storage Engine], [max,max-no-ndb]) -MYSQL_PLUGIN_DYNAMIC([ibmdb2i], [ha_ibmdb2i.la]) - -AC_CHECK_HEADER([qlgusr.h], - # qlgusr.h is just one of the headers from the i5/OS PASE environment; the - # EBCDIC headers are in /QIBM/include, and have to be converted to ASCII - # before cpp gets to them - [:], - # Missing PASE environment, can't build this engine - [mysql_plugin_ibmdb2i=no - with_plugin_ibmdb2i=no]) From 30a3e345a700483a2b044558343f80baa5f023da Mon Sep 17 00:00:00 2001 From: MySQL Build Team Date: Wed, 9 Feb 2011 21:28:45 +0100 Subject: [PATCH 093/202] Backport into build-201102032246-5.1.52sp1 > ------------------------------------------------------------ > revno: 3507.1.26 > revision-id: mattias.jonsson@oracle.com-20101201112046-2ugtweya0dltcrys > parent: nirbhay.choubey@sun.com-20101201065531-w2f0j3g5yzok8z9x > committer: Mattias Jonsson > branch nick: b56380-51-bt > timestamp: Wed 2010-12-01 12:20:46 +0100 > message: > Bug#56380: valgrind memory leak warning from partition tests > > There could be memory leaks if ALTER ... PARTITION command fails. > > Problem was that the list of items to free was not set in > the partition info structure when fix_partition_func call failed > during ALTER ... PARTITION. > > Solved by always setting the list in the partition info struct. --- sql/table.cc | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) diff --git a/sql/table.cc b/sql/table.cc index 18523f08551..b43d29294a8 100644 --- a/sql/table.cc +++ b/sql/table.cc @@ -1867,8 +1867,8 @@ int open_table_from_share(THD *thd, TABLE_SHARE *share, const char *alias, { if (work_part_info_used) tmp= fix_partition_func(thd, outparam, is_create_table); - outparam->part_info->item_free_list= part_func_arena.free_list; } + outparam->part_info->item_free_list= part_func_arena.free_list; partititon_err: if (tmp) { From 3eff3ea2420b8f4d8a4d5f70f2341e7bf27bd644 Mon Sep 17 00:00:00 2001 From: MySQL Build Team Date: Wed, 9 Feb 2011 21:30:48 +0100 Subject: [PATCH 094/202] Backport into build-201102032246-5.1.52sp1 > ------------------------------------------------------------ > revno: 3507.1.7 > revision-id: guilhem@mysql.com-20101122085759-53uuoyqyjkh4em2m > parent: davi.arnaut@oracle.com-20101120142951-l0f3bxmcwibcplxq > committer: Guilhem Bichot > branch nick: mysql-5.1-bugteam > timestamp: Mon 2010-11-22 09:57:59 +0100 > message: > Fix for Bug#56138 "valgrind errors about overlapping memory when double-assigning same variable", > and related small fixes. --- mysql-test/r/user_var.result | 3 +++ mysql-test/t/user_var.test | 7 +++++++ sql/field_conv.cc | 7 ++----- sql/item_func.cc | 2 +- sql/sql_select.cc | 8 ++++++-- 5 files changed, 19 insertions(+), 8 deletions(-) diff --git a/mysql-test/r/user_var.result b/mysql-test/r/user_var.result index 56266a46e20..cf82a18ea83 100644 --- a/mysql-test/r/user_var.result +++ b/mysql-test/r/user_var.result @@ -447,4 +447,7 @@ IF( count(*), 1) 1 DROP TABLE t1; +select @v:=@v:=sum(1) from dual; +@v:=@v:=sum(1) +1 End of 5.1 tests diff --git a/mysql-test/t/user_var.test b/mysql-test/t/user_var.test index 4f27866de23..56217fe67d5 100644 --- a/mysql-test/t/user_var.test +++ b/mysql-test/t/user_var.test @@ -346,4 +346,11 @@ FROM t1 GROUP BY a LIMIT 1; DROP TABLE t1; +# +# BUG#56138 "valgrind errors about overlapping memory when +# double-assigning same variable" +# + +select @v:=@v:=sum(1) from dual; + --echo End of 5.1 tests diff --git a/sql/field_conv.cc b/sql/field_conv.cc index 0bffde9671a..a4fca6f8ad7 100644 --- a/sql/field_conv.cc +++ b/sql/field_conv.cc @@ -786,11 +786,8 @@ int field_conv(Field *to,Field *from) ((Field_varstring*)from)->length_bytes == ((Field_varstring*)to)->length_bytes)) { // Identical fields -#ifdef HAVE_purify - /* This may happen if one does 'UPDATE ... SET x=x' */ - if (to->ptr != from->ptr) -#endif - memcpy(to->ptr,from->ptr,to->pack_length()); + // to->ptr==from->ptr may happen if one does 'UPDATE ... SET x=x' + memmove(to->ptr, from->ptr, to->pack_length()); return 0; } } diff --git a/sql/item_func.cc b/sql/item_func.cc index eaf6a1b6d14..258ba0f01d5 100644 --- a/sql/item_func.cc +++ b/sql/item_func.cc @@ -3913,7 +3913,7 @@ update_hash(user_var_entry *entry, bool set_null, void *ptr, uint length, length--; // Fix length change above entry->value[length]= 0; // Store end \0 } - memcpy(entry->value,ptr,length); + memmove(entry->value, ptr, length); if (type == DECIMAL_RESULT) ((my_decimal*)entry->value)->fix_buffer_pointer(); entry->length= length; diff --git a/sql/sql_select.cc b/sql/sql_select.cc index 08bd0c28738..9bf0a236e1b 100644 --- a/sql/sql_select.cc +++ b/sql/sql_select.cc @@ -4034,8 +4034,12 @@ update_ref_and_keys(THD *thd, DYNAMIC_ARRAY *keyuse,JOIN_TAB *join_tab, continue; } -#ifdef HAVE_purify - /* Valgrind complains about overlapped memcpy when save_pos==use. */ +#if defined(__GNUC__) && !MY_GNUC_PREREQ(4,4) + /* + Old gcc used a memcpy(), which is undefined if save_pos==use: + http://gcc.gnu.org/bugzilla/show_bug.cgi?id=19410 + http://gcc.gnu.org/bugzilla/show_bug.cgi?id=39480 + */ if (save_pos != use) #endif *save_pos= *use; From 00447eadd597a9f434330f5ccb1c9d8178c79602 Mon Sep 17 00:00:00 2001 From: MySQL Build Team Date: Wed, 9 Feb 2011 21:37:36 +0100 Subject: [PATCH 095/202] Backport into build-201102032246-5.1.52sp1 > ------------------------------------------------------------ > revno: 3517 > revision-id: sergey.glukhov@oracle.com-20101213103926-okypkn10adeeyns8 > parent: davi.arnaut@oracle.com-20101207150620-s49dstok48oy585o > committer: Sergey Glukhov > branch nick: mysql-5.1-bugteam > timestamp: Mon 2010-12-13 13:39:26 +0300 > message: > Bug#58396 group_concat and explain extended are still crashy > Explain fails at fix_fields stage and some items are left unfixed, > particulary Item_group_concat. Item_group_concat::orig_args field > is uninitialized in this case and Item_group_concat::print call > leads to crash. > The fix: > move the initialization of Item_group_concat::orig_args > into constructor. --- mysql-test/r/func_gconcat.result | 12 ++++++++++++ mysql-test/t/func_gconcat.test | 11 +++++++++++ sql/item_sum.cc | 2 +- 3 files changed, 24 insertions(+), 1 deletion(-) diff --git a/mysql-test/r/func_gconcat.result b/mysql-test/r/func_gconcat.result index ae48eb1e0ff..a4deaf4d90c 100644 --- a/mysql-test/r/func_gconcat.result +++ b/mysql-test/r/func_gconcat.result @@ -1029,4 +1029,16 @@ GROUP_CONCAT(t1.a ORDER BY t1.a) 1,1,2,2 DEALLOCATE PREPARE stmt; DROP TABLE t1; +# +# Bug#58396 group_concat and explain extended are still crashy +# +CREATE TABLE t1(a INT); +EXPLAIN EXTENDED SELECT UPDATEXML('1', a, '1') +FROM t1 ORDER BY (SELECT GROUP_CONCAT(1) FROM t1); +ERROR HY000: Only constant XPATH queries are supported +SHOW WARNINGS; +Level Code Message +Error 1105 Only constant XPATH queries are supported +Note 1003 select updatexml('1',`test`.`t1`.`a`,'1') AS `UPDATEXML('1', a, '1')` from `test`.`t1` order by (select group_concat(1 separator ',') from `test`.`t1`) +DROP TABLE t1; End of 5.1 tests diff --git a/mysql-test/t/func_gconcat.test b/mysql-test/t/func_gconcat.test index 926c1f92855..e8d66f120a3 100644 --- a/mysql-test/t/func_gconcat.test +++ b/mysql-test/t/func_gconcat.test @@ -734,4 +734,15 @@ EXECUTE stmt; DEALLOCATE PREPARE stmt; DROP TABLE t1; +--echo # +--echo # Bug#58396 group_concat and explain extended are still crashy +--echo # + +CREATE TABLE t1(a INT); +--error ER_UNKNOWN_ERROR +EXPLAIN EXTENDED SELECT UPDATEXML('1', a, '1') +FROM t1 ORDER BY (SELECT GROUP_CONCAT(1) FROM t1); +SHOW WARNINGS; +DROP TABLE t1; + --echo End of 5.1 tests diff --git a/sql/item_sum.cc b/sql/item_sum.cc index ae9e46e2abf..e479db7f7b9 100644 --- a/sql/item_sum.cc +++ b/sql/item_sum.cc @@ -3003,6 +3003,7 @@ Item_func_group_concat(Name_resolution_context *context_arg, order_item->item= arg_ptr++; } } + memcpy(orig_args, args, sizeof(Item*) * arg_count); } @@ -3233,7 +3234,6 @@ Item_func_group_concat::fix_fields(THD *thd, Item **ref) if (check_sum_func(thd, ref)) return TRUE; - memcpy (orig_args, args, sizeof (Item *) * arg_count); fixed= 1; return FALSE; } From c044b77aa9bc5563b2f26cf75e015d35b72d9160 Mon Sep 17 00:00:00 2001 From: MySQL Build Team Date: Wed, 9 Feb 2011 21:55:28 +0100 Subject: [PATCH 096/202] Backport into build-201102032246-5.1.52sp1 > ------------------------------------------------------------ > revno: 3518 > revision-id: sergey.glukhov@oracle.com-20101213114812-kaq7sh0s623128lv > parent: sergey.glukhov@oracle.com-20101213103926-okypkn10adeeyns8 > committer: Sergey Glukhov > branch nick: mysql-5.1-bugteam > timestamp: Mon 2010-12-13 14:48:12 +0300 > message: > Bug#39828 : Autoinc wraps around when offset and increment > 1 > Auto increment value wraps when performing a bulk insert with > auto_increment_increment and auto_increment_offset greater than > one. > The fix: > If overflow happened then return MAX_ULONGLONG value as an > indication of overflow and check this before storing the > value into the field in update_auto_increment(). --- mysql-test/r/auto_increment.result | 21 ++++++++ .../suite/innodb/r/innodb-autoinc.result | 18 +++---- mysql-test/suite/innodb/t/innodb-autoinc.test | 49 +++---------------- .../innodb_plugin/r/innodb-autoinc.result | 18 +++---- .../suite/innodb_plugin/t/innodb-autoinc.test | 49 +++---------------- mysql-test/t/auto_increment.test | 21 ++++++++ sql/handler.cc | 30 +++++++++--- 7 files changed, 88 insertions(+), 118 deletions(-) diff --git a/mysql-test/r/auto_increment.result b/mysql-test/r/auto_increment.result index 4a2e108f8c6..5fae14e2c07 100644 --- a/mysql-test/r/auto_increment.result +++ b/mysql-test/r/auto_increment.result @@ -476,3 +476,24 @@ SELECT a FROM t2; a 2 DROP TABLE t1, t2; +# +# Bug#39828 autoinc wraps around when offset and increment > 1 +# +CREATE TABLE t1 (c1 BIGINT UNSIGNED AUTO_INCREMENT, PRIMARY KEY(c1)) engine=MyISAM; +INSERT INTO t1 VALUES(1); +INSERT INTO t1 VALUES (18446744073709551601); +SET @@SESSION.AUTO_INCREMENT_INCREMENT=10; +SELECT @@SESSION.AUTO_INCREMENT_OFFSET; +@@SESSION.AUTO_INCREMENT_OFFSET +1 +INSERT INTO t1 VALUES (NULL), (NULL), (NULL); +ERROR 22003: Out of range value for column 't1' at row 167 +SELECT * FROM t1; +c1 +1 +18446744073709551601 +18446744073709551611 +SET @@SESSION.AUTO_INCREMENT_INCREMENT=default; +SET @@SESSION.AUTO_INCREMENT_OFFSET=default; +DROP TABLE t1; +End of 5.1 tests diff --git a/mysql-test/suite/innodb/r/innodb-autoinc.result b/mysql-test/suite/innodb/r/innodb-autoinc.result index 350c7ebd541..0c8d16f27fb 100644 --- a/mysql-test/suite/innodb/r/innodb-autoinc.result +++ b/mysql-test/suite/innodb/r/innodb-autoinc.result @@ -471,17 +471,12 @@ SHOW VARIABLES LIKE "%auto_inc%"; Variable_name Value auto_increment_increment 2 auto_increment_offset 10 -INSERT INTO t1 VALUES (NULL),(NULL),(NULL),(NULL),(NULL),(NULL); +INSERT INTO t1 VALUES (NULL),(NULL),(NULL),(NULL),(NULL),(NULL),(NULL); +ERROR HY000: Failed to read auto-increment value from storage engine SELECT * FROM t1; c1 1 18446744073709551603 -18446744073709551604 -18446744073709551606 -18446744073709551608 -18446744073709551610 -18446744073709551612 -18446744073709551614 DROP TABLE t1; SET @@SESSION.AUTO_INCREMENT_INCREMENT=1, @@SESSION.AUTO_INCREMENT_OFFSET=1; SET @@INSERT_ID=1; @@ -504,13 +499,12 @@ SHOW VARIABLES LIKE "%auto_inc%"; Variable_name Value auto_increment_increment 5 auto_increment_offset 7 -INSERT INTO t1 VALUES (NULL),(NULL); +INSERT INTO t1 VALUES (NULL),(NULL), (NULL); +ERROR HY000: Failed to read auto-increment value from storage engine SELECT * FROM t1; c1 1 18446744073709551603 -18446744073709551607 -18446744073709551612 DROP TABLE t1; SET @@SESSION.AUTO_INCREMENT_INCREMENT=1, @@SESSION.AUTO_INCREMENT_OFFSET=1; SET @@INSERT_ID=1; @@ -572,12 +566,12 @@ SHOW VARIABLES LIKE "%auto_inc%"; Variable_name Value auto_increment_increment 65535 auto_increment_offset 65535 -INSERT INTO t1 VALUES (NULL); +INSERT INTO t1 VALUES (NULL),(NULL); +ERROR 22003: Out of range value for column 't1' at row 167 SELECT * FROM t1; c1 1 18446744073709551610 -18446744073709551615 DROP TABLE t1; SET @@SESSION.AUTO_INCREMENT_INCREMENT=1, @@SESSION.AUTO_INCREMENT_OFFSET=1; SET @@INSERT_ID=1; diff --git a/mysql-test/suite/innodb/t/innodb-autoinc.test b/mysql-test/suite/innodb/t/innodb-autoinc.test index 10602499222..c3b64c7c963 100644 --- a/mysql-test/suite/innodb/t/innodb-autoinc.test +++ b/mysql-test/suite/innodb/t/innodb-autoinc.test @@ -291,21 +291,8 @@ INSERT INTO t1 VALUES (18446744073709551603); #-- 2^64 - 13 SELECT * FROM t1; SET @@SESSION.AUTO_INCREMENT_INCREMENT=2, @@SESSION.AUTO_INCREMENT_OFFSET=10; SHOW VARIABLES LIKE "%auto_inc%"; -# This should fail because of overflow but it doesn't, it seems to be -# a MySQL server bug. It wraps around to 0 for the last value. -# See MySQL Bug# 39828 -# -# Instead of wrapping around, it asserts when MySQL is compiled --with-debug -# (see sql/handler.cc:handler::update_auto_increment()). Don't test for -# overflow until Bug #39828 is fixed. -# -# Since this asserts when compiled --with-debug, we can't properly test this -# until Bug #39828 is fixed. For now, this test is meaningless. -#if Bug #39828 is fixed -#INSERT INTO t1 VALUES (NULL),(NULL),(NULL),(NULL),(NULL),(NULL),(NULL); -#else -INSERT INTO t1 VALUES (NULL),(NULL),(NULL),(NULL),(NULL),(NULL); -#endif +--error ER_AUTOINC_READ_FAILED +INSERT INTO t1 VALUES (NULL),(NULL),(NULL),(NULL),(NULL),(NULL),(NULL); SELECT * FROM t1; DROP TABLE t1; @@ -323,20 +310,8 @@ INSERT INTO t1 VALUES (18446744073709551603); #-- 2^64 - 13 SELECT * FROM t1; SET @@SESSION.AUTO_INCREMENT_INCREMENT=5, @@SESSION.AUTO_INCREMENT_OFFSET=7; SHOW VARIABLES LIKE "%auto_inc%"; -# This should fail because of overflow but it doesn't. It fails with -# a duplicate entry message because of a MySQL server bug, it wraps -# around. See MySQL Bug# 39828, once MySQL fix the bug we can replace -# the ER_DUP_ENTRY, 1062 below with the appropriate error message -# -# Since this asserts when compiled --with-debug, we can't properly test this -# until Bug #39828 is fixed. For now, this test is meaningless. -#if Bug #39828 is fixed -# Still need to fix this error code, error should mention overflow -#-- error ER_DUP_ENTRY,1062 -#INSERT INTO t1 VALUES (NULL),(NULL), (NULL); -#else -INSERT INTO t1 VALUES (NULL),(NULL); -#endif +--error ER_AUTOINC_READ_FAILED +INSERT INTO t1 VALUES (NULL),(NULL), (NULL); SELECT * FROM t1; DROP TABLE t1; @@ -374,20 +349,8 @@ INSERT INTO t1 VALUES (18446744073709551610); #-- 2^64 - 2 SELECT * FROM t1; SET @@SESSION.AUTO_INCREMENT_INCREMENT=1152921504606846976, @@SESSION.AUTO_INCREMENT_OFFSET=1152921504606846976; SHOW VARIABLES LIKE "%auto_inc%"; -# This should fail because of overflow but it doesn't. It wraps around -# and the autoinc values look bogus too. -# See MySQL Bug# 39828, once MySQL fix the bug we can enable the error -# code expected test. -# -- error ER_AUTOINC_READ_FAILED,1467 -# -# Since this asserts when compiled --with-debug, we can't properly test this -# until Bug #39828 is fixed. For now, this test is meaningless. -#if Bug #39828 is fixed -#-- error ER_AUTOINC_READ_FAILED,1467 -#INSERT INTO t1 VALUES (NULL),(NULL); -#else -INSERT INTO t1 VALUES (NULL); -#endif +--error ER_WARN_DATA_OUT_OF_RANGE +INSERT INTO t1 VALUES (NULL),(NULL); SELECT * FROM t1; DROP TABLE t1; diff --git a/mysql-test/suite/innodb_plugin/r/innodb-autoinc.result b/mysql-test/suite/innodb_plugin/r/innodb-autoinc.result index 350c7ebd541..0c8d16f27fb 100644 --- a/mysql-test/suite/innodb_plugin/r/innodb-autoinc.result +++ b/mysql-test/suite/innodb_plugin/r/innodb-autoinc.result @@ -471,17 +471,12 @@ SHOW VARIABLES LIKE "%auto_inc%"; Variable_name Value auto_increment_increment 2 auto_increment_offset 10 -INSERT INTO t1 VALUES (NULL),(NULL),(NULL),(NULL),(NULL),(NULL); +INSERT INTO t1 VALUES (NULL),(NULL),(NULL),(NULL),(NULL),(NULL),(NULL); +ERROR HY000: Failed to read auto-increment value from storage engine SELECT * FROM t1; c1 1 18446744073709551603 -18446744073709551604 -18446744073709551606 -18446744073709551608 -18446744073709551610 -18446744073709551612 -18446744073709551614 DROP TABLE t1; SET @@SESSION.AUTO_INCREMENT_INCREMENT=1, @@SESSION.AUTO_INCREMENT_OFFSET=1; SET @@INSERT_ID=1; @@ -504,13 +499,12 @@ SHOW VARIABLES LIKE "%auto_inc%"; Variable_name Value auto_increment_increment 5 auto_increment_offset 7 -INSERT INTO t1 VALUES (NULL),(NULL); +INSERT INTO t1 VALUES (NULL),(NULL), (NULL); +ERROR HY000: Failed to read auto-increment value from storage engine SELECT * FROM t1; c1 1 18446744073709551603 -18446744073709551607 -18446744073709551612 DROP TABLE t1; SET @@SESSION.AUTO_INCREMENT_INCREMENT=1, @@SESSION.AUTO_INCREMENT_OFFSET=1; SET @@INSERT_ID=1; @@ -572,12 +566,12 @@ SHOW VARIABLES LIKE "%auto_inc%"; Variable_name Value auto_increment_increment 65535 auto_increment_offset 65535 -INSERT INTO t1 VALUES (NULL); +INSERT INTO t1 VALUES (NULL),(NULL); +ERROR 22003: Out of range value for column 't1' at row 167 SELECT * FROM t1; c1 1 18446744073709551610 -18446744073709551615 DROP TABLE t1; SET @@SESSION.AUTO_INCREMENT_INCREMENT=1, @@SESSION.AUTO_INCREMENT_OFFSET=1; SET @@INSERT_ID=1; diff --git a/mysql-test/suite/innodb_plugin/t/innodb-autoinc.test b/mysql-test/suite/innodb_plugin/t/innodb-autoinc.test index 997c503d2d3..4967a6efbb9 100644 --- a/mysql-test/suite/innodb_plugin/t/innodb-autoinc.test +++ b/mysql-test/suite/innodb_plugin/t/innodb-autoinc.test @@ -293,21 +293,8 @@ INSERT INTO t1 VALUES (18446744073709551603); #-- 2^64 - 13 SELECT * FROM t1; SET @@SESSION.AUTO_INCREMENT_INCREMENT=2, @@SESSION.AUTO_INCREMENT_OFFSET=10; SHOW VARIABLES LIKE "%auto_inc%"; -# This should fail because of overflow but it doesn't, it seems to be -# a MySQL server bug. It wraps around to 0 for the last value. -# See MySQL Bug# 39828 -# -# Instead of wrapping around, it asserts when MySQL is compiled --with-debug -# (see sql/handler.cc:handler::update_auto_increment()). Don't test for -# overflow until Bug #39828 is fixed. -# -# Since this asserts when compiled --with-debug, we can't properly test this -# until Bug #39828 is fixed. For now, this test is meaningless. -#if Bug #39828 is fixed -#INSERT INTO t1 VALUES (NULL),(NULL),(NULL),(NULL),(NULL),(NULL),(NULL); -#else -INSERT INTO t1 VALUES (NULL),(NULL),(NULL),(NULL),(NULL),(NULL); -#endif +--error ER_AUTOINC_READ_FAILED +INSERT INTO t1 VALUES (NULL),(NULL),(NULL),(NULL),(NULL),(NULL),(NULL); SELECT * FROM t1; DROP TABLE t1; @@ -325,20 +312,8 @@ INSERT INTO t1 VALUES (18446744073709551603); #-- 2^64 - 13 SELECT * FROM t1; SET @@SESSION.AUTO_INCREMENT_INCREMENT=5, @@SESSION.AUTO_INCREMENT_OFFSET=7; SHOW VARIABLES LIKE "%auto_inc%"; -# This should fail because of overflow but it doesn't. It fails with -# a duplicate entry message because of a MySQL server bug, it wraps -# around. See MySQL Bug# 39828, once MySQL fix the bug we can replace -# the ER_DUP_ENTRY, 1062 below with the appropriate error message -# -# Since this asserts when compiled --with-debug, we can't properly test this -# until Bug #39828 is fixed. For now, this test is meaningless. -#if Bug #39828 is fixed -# Still need to fix this error code, error should mention overflow -#-- error ER_DUP_ENTRY,1062 -#INSERT INTO t1 VALUES (NULL),(NULL), (NULL); -#else -INSERT INTO t1 VALUES (NULL),(NULL); -#endif +--error ER_AUTOINC_READ_FAILED +INSERT INTO t1 VALUES (NULL),(NULL), (NULL); SELECT * FROM t1; DROP TABLE t1; @@ -376,20 +351,8 @@ INSERT INTO t1 VALUES (18446744073709551610); #-- 2^64 - 2 SELECT * FROM t1; SET @@SESSION.AUTO_INCREMENT_INCREMENT=1152921504606846976, @@SESSION.AUTO_INCREMENT_OFFSET=1152921504606846976; SHOW VARIABLES LIKE "%auto_inc%"; -# This should fail because of overflow but it doesn't. It wraps around -# and the autoinc values look bogus too. -# See MySQL Bug# 39828, once MySQL fix the bug we can enable the error -# code expected test. -# -- error ER_AUTOINC_READ_FAILED,1467 -# -# Since this asserts when compiled --with-debug, we can't properly test this -# until Bug #39828 is fixed. For now, this test is meaningless. -#if Bug #39828 is fixed -#-- error ER_AUTOINC_READ_FAILED,1467 -#INSERT INTO t1 VALUES (NULL),(NULL); -#else -INSERT INTO t1 VALUES (NULL); -#endif +--error ER_WARN_DATA_OUT_OF_RANGE +INSERT INTO t1 VALUES (NULL),(NULL); SELECT * FROM t1; DROP TABLE t1; diff --git a/mysql-test/t/auto_increment.test b/mysql-test/t/auto_increment.test index 076e32eb22c..8ab2e6fcf31 100644 --- a/mysql-test/t/auto_increment.test +++ b/mysql-test/t/auto_increment.test @@ -342,3 +342,24 @@ SELECT a FROM t2; DROP TABLE t1, t2; +--echo # +--echo # Bug#39828 autoinc wraps around when offset and increment > 1 +--echo # + +CREATE TABLE t1 (c1 BIGINT UNSIGNED AUTO_INCREMENT, PRIMARY KEY(c1)) engine=MyISAM; +INSERT INTO t1 VALUES(1); +INSERT INTO t1 VALUES (18446744073709551601); + +SET @@SESSION.AUTO_INCREMENT_INCREMENT=10; + +SELECT @@SESSION.AUTO_INCREMENT_OFFSET; +--error ER_WARN_DATA_OUT_OF_RANGE +INSERT INTO t1 VALUES (NULL), (NULL), (NULL); +SELECT * FROM t1; + +SET @@SESSION.AUTO_INCREMENT_INCREMENT=default; +SET @@SESSION.AUTO_INCREMENT_OFFSET=default; + +DROP TABLE t1; + +--echo End of 5.1 tests diff --git a/sql/handler.cc b/sql/handler.cc index 19f397ef09f..3286367e7a7 100644 --- a/sql/handler.cc +++ b/sql/handler.cc @@ -2166,7 +2166,8 @@ int handler::read_first_row(uchar * buf, uint primary_key) computes the lowest number - strictly greater than "nr" - of the form: auto_increment_offset + N * auto_increment_increment - + If overflow happened then return MAX_ULONGLONG value as an + indication of overflow. In most cases increment= offset= 1, in which case we get: @verbatim 1,2,3,4,5,... @endverbatim If increment=10 and offset=5 and previous number is 1, we get: @@ -2175,13 +2176,23 @@ int handler::read_first_row(uchar * buf, uint primary_key) inline ulonglong compute_next_insert_id(ulonglong nr,struct system_variables *variables) { + const ulonglong save_nr= nr; + if (variables->auto_increment_increment == 1) - return (nr+1); // optimization of the formula below - nr= (((nr+ variables->auto_increment_increment - - variables->auto_increment_offset)) / - (ulonglong) variables->auto_increment_increment); - return (nr* (ulonglong) variables->auto_increment_increment + - variables->auto_increment_offset); + nr= nr + 1; // optimization of the formula below + else + { + nr= (((nr+ variables->auto_increment_increment - + variables->auto_increment_offset)) / + (ulonglong) variables->auto_increment_increment); + nr= (nr* (ulonglong) variables->auto_increment_increment + + variables->auto_increment_offset); + } + + if (unlikely(nr <= save_nr)) + return ULONGLONG_MAX; + + return nr; } @@ -2392,7 +2403,7 @@ int handler::update_auto_increment() variables->auto_increment_increment, nb_desired_values, &nr, &nb_reserved_values); - if (nr == ~(ulonglong) 0) + if (nr == ULONGLONG_MAX) DBUG_RETURN(HA_ERR_AUTOINC_READ_FAILED); // Mark failure /* @@ -2423,6 +2434,9 @@ int handler::update_auto_increment() } } + if (unlikely(nr == ULONGLONG_MAX)) + DBUG_RETURN(HA_ERR_AUTOINC_ERANGE); + DBUG_PRINT("info",("auto_increment: %lu", (ulong) nr)); if (unlikely(table->next_number_field->store((longlong) nr, TRUE))) From 89b9934cdbd7397b6fadf32ebd719398a5080ada Mon Sep 17 00:00:00 2001 From: MySQL Build Team Date: Wed, 9 Feb 2011 21:57:57 +0100 Subject: [PATCH 097/202] Backport into build-201102032246-5.1.52sp1 > ------------------------------------------------------------ > revno: 3520 > revision-id: sergey.glukhov@oracle.com-20101214093303-wmo9mqcb8rz0wv9f > parent: tor.didriksen@oracle.com-20101213161301-81lprlbune7r98dl > committer: Sergey Glukhov > branch nick: mysql-5.1-bugteam > timestamp: Tue 2010-12-14 12:33:03 +0300 > message: > Fixed following problems: > --Bug#52157 various crashes and assertions with multi-table update, stored function > --Bug#54475 improper error handling causes cascading crashing failures in innodb/ndb > --Bug#57703 create view cause Assertion failed: 0, file .\item_subselect.cc, line 846 > --Bug#57352 valgrind warnings when creating view > --Recently discovered problem when a nested materialized derived table is used > before being populated and it leads to incorrect result > > We have several modes when we should disable subquery evaluation. > The reasons for disabling are different. It could be > uselessness of the evaluation as in case of 'CREATE VIEW' > or 'PREPARE stmt', or we should disable subquery evaluation > if tables are not locked yet as it happens in bug#54475, or > too early evaluation of subqueries can lead to wrong result > as it happened in Bug#19077. > Main problem is that if subquery items are treated as const > they are evaluated in ::fix_fields(), ::fix_length_and_dec() > of the parental items as a lot of these methods have > Item::val_...() calls inside. > We have to make subqueries non-const to prevent unnecessary > subquery evaluation. At the moment we have different methods > for this. Here is a list of these modes: > > 1. PREPARE stmt; > We use UNCACHEABLE_PREPARE flag. > It is set during parsing in sql_parse.cc, mysql_new_select() for > each SELECT_LEX object and cleared at the end of PREPARE in > sql_prepare.cc, init_stmt_after_parse(). If this flag is set > subquery becomes non-const and evaluation does not happen. > > 2. CREATE|ALTER VIEW, SHOW CREATE VIEW, I_S tables which > process FRM files > We use LEX::view_prepare_mode field. We set it before > view preparation and check this flag in > ::fix_fields(), ::fix_length_and_dec(). > Some bugs are fixed using this approach, > some are not(Bug#57352, Bug#57703). The problem here is > that we have a lot of ::fix_fields(), ::fix_length_and_dec() > where we use Item::val_...() calls for const items. > > 3. Derived tables with subquery = wrong result(Bug19077) > The reason of this bug is too early subquery evaluation. > It was fixed by adding Item::with_subselect field > The check of this field in appropriate places prevents > const item evaluation if the item have subquery. > The fix for Bug19077 fixes only the problem with > convert_constant_item() function and does not cover > other places(::fix_fields(), ::fix_length_and_dec() again) > where subqueries could be evaluated. > > Example: > CREATE TABLE t1 (i INT, j BIGINT); > INSERT INTO t1 VALUES (1, 2), (2, 2), (3, 2); > SELECT * FROM (SELECT MIN(i) FROM t1 > WHERE j = SUBSTRING('12', (SELECT * FROM (SELECT MIN(j) FROM t1) t2))) t3; > DROP TABLE t1; > > 4. Derived tables with subquery where subquery > is evaluated before table locking(Bug#54475, Bug#52157) > > Suggested solution is following: > > -Introduce new field LEX::context_analysis_only with the following > possible flags: > #define CONTEXT_ANALYSIS_ONLY_PREPARE 1 > #define CONTEXT_ANALYSIS_ONLY_VIEW 2 > #define CONTEXT_ANALYSIS_ONLY_DERIVED 4 > -Set/clean these flags when we perform > context analysis operation > -Item_subselect::const_item() returns > result depending on LEX::context_analysis_only. > If context_analysis_only is set then we return > FALSE that means that subquery is non-const. > As all subquery types are wrapped by Item_subselect > it allow as to make subquery non-const when > it's necessary. --- mysql-test/r/derived.result | 11 +++++++ mysql-test/r/multi_update.result | 11 +++++++ mysql-test/r/view.result | 13 ++++++++ .../suite/innodb/r/innodb_multi_update.result | 8 +++++ .../suite/innodb/t/innodb_multi_update.test | 11 +++++++ .../r/innodb_multi_update.result | 8 +++++ .../innodb_plugin/t/innodb_multi_update.test | 11 +++++++ mysql-test/t/derived.test | 11 +++++++ mysql-test/t/multi_update.test | 11 +++++++ mysql-test/t/view.test | 16 +++++++++ sql/item.cc | 11 +------ sql/item_cmpfunc.cc | 10 +++--- sql/item_func.cc | 2 +- sql/item_row.cc | 8 ++--- sql/item_subselect.cc | 20 +++-------- sql/item_subselect.h | 1 - sql/mysql_priv.h | 33 ++++++++++++++++--- sql/sql_class.h | 2 -- sql/sql_derived.cc | 3 +- sql/sql_lex.cc | 2 +- sql/sql_lex.h | 17 +++++----- sql/sql_parse.cc | 7 ---- sql/sql_prepare.cc | 18 ++-------- sql/sql_select.cc | 3 +- sql/sql_show.cc | 8 ++--- sql/sql_view.cc | 2 +- 26 files changed, 175 insertions(+), 83 deletions(-) diff --git a/mysql-test/r/derived.result b/mysql-test/r/derived.result index 80f04ffd455..61f1db9989f 100644 --- a/mysql-test/r/derived.result +++ b/mysql-test/r/derived.result @@ -400,4 +400,15 @@ SELECT 0 FROM (SELECT 0) t61; 0 0 +# +# A nested materialized derived table is used before being populated. +# (addon for bug#19077) +# +CREATE TABLE t1 (i INT, j BIGINT); +INSERT INTO t1 VALUES (1, 2), (2, 2), (3, 2); +SELECT * FROM (SELECT MIN(i) FROM t1 +WHERE j = SUBSTRING('12', (SELECT * FROM (SELECT MIN(j) FROM t1) t2))) t3; +MIN(i) +1 +DROP TABLE t1; # End of 5.0 tests diff --git a/mysql-test/r/multi_update.result b/mysql-test/r/multi_update.result index d77ad1d2953..df3d7be6714 100644 --- a/mysql-test/r/multi_update.result +++ b/mysql-test/r/multi_update.result @@ -659,4 +659,15 @@ Error 1242 Subquery returns more than 1 row Error 1242 Subquery returns more than 1 row DROP TABLE t1, t2, t3; SET SESSION sql_safe_updates = DEFAULT; +# +# Bug#52157 various crashes and assertions with multi-table update, stored function +# +CREATE FUNCTION f1 () RETURNS BLOB RETURN 1; +CREATE TABLE t1 (f1 DATE); +INSERT INTO t1 VALUES('2001-01-01'); +UPDATE (SELECT 1 FROM t1 WHERE f1 = (SELECT f1() FROM t1)) x, t1 SET f1 = 1; +Warnings: +Warning 1292 Truncated incorrect datetime value: '1' +DROP FUNCTION f1; +DROP TABLE t1; end of tests diff --git a/mysql-test/r/view.result b/mysql-test/r/view.result index 0aec44b70f1..3771a7a3e12 100644 --- a/mysql-test/r/view.result +++ b/mysql-test/r/view.result @@ -3882,6 +3882,19 @@ CREATE VIEW v1 AS SELECT 1 from t1 WHERE t1.b <=> (SELECT a FROM t1 WHERE a < SOME(SELECT '1')); DROP VIEW v1; DROP TABLE t1; +# +# Bug#57703 create view cause Assertion failed: 0, file .\item_subselect.cc, line 846 +# +CREATE TABLE t1(a int); +CREATE VIEW v1 AS SELECT 1 FROM t1 GROUP BY +SUBSTRING(1 FROM (SELECT 3 FROM t1 WHERE a >= ANY(SELECT 1))); +DROP VIEW v1; +DROP TABLE t1; +# +# Bug#57352 valgrind warnings when creating view +# +CREATE VIEW v1 AS SELECT 1 IN (1 LIKE 2,0) AS f; +DROP VIEW v1; # ----------------------------------------------------------------- # -- End of 5.1 tests. # ----------------------------------------------------------------- diff --git a/mysql-test/suite/innodb/r/innodb_multi_update.result b/mysql-test/suite/innodb/r/innodb_multi_update.result index 7af9b030d1f..558fc3938a8 100644 --- a/mysql-test/suite/innodb/r/innodb_multi_update.result +++ b/mysql-test/suite/innodb/r/innodb_multi_update.result @@ -74,3 +74,11 @@ a b 4 14 5 15 drop table bug38999_1,bug38999_2; +# +# Bug#54475 improper error handling causes cascading crashing failures in innodb/ndb +# +CREATE TABLE t1(f1 INT) ENGINE=INNODB; +INSERT INTO t1 VALUES(1); +UPDATE (SELECT ((SELECT 1 FROM t1), 1) FROM t1 WHERE (SELECT 1 FROM t1)) x, (SELECT 1) AS d SET d.f1 = 1; +ERROR 21000: Operand should contain 1 column(s) +DROP TABLE t1; diff --git a/mysql-test/suite/innodb/t/innodb_multi_update.test b/mysql-test/suite/innodb/t/innodb_multi_update.test index 7ab17ccf70a..8356c20c88f 100644 --- a/mysql-test/suite/innodb/t/innodb_multi_update.test +++ b/mysql-test/suite/innodb/t/innodb_multi_update.test @@ -27,3 +27,14 @@ select * from bug38999_1; select * from bug38999_2; drop table bug38999_1,bug38999_2; + + +--echo # +--echo # Bug#54475 improper error handling causes cascading crashing failures in innodb/ndb +--echo # +CREATE TABLE t1(f1 INT) ENGINE=INNODB; +INSERT INTO t1 VALUES(1); +--error ER_OPERAND_COLUMNS +UPDATE (SELECT ((SELECT 1 FROM t1), 1) FROM t1 WHERE (SELECT 1 FROM t1)) x, (SELECT 1) AS d SET d.f1 = 1; +DROP TABLE t1; + diff --git a/mysql-test/suite/innodb_plugin/r/innodb_multi_update.result b/mysql-test/suite/innodb_plugin/r/innodb_multi_update.result index 7af9b030d1f..558fc3938a8 100644 --- a/mysql-test/suite/innodb_plugin/r/innodb_multi_update.result +++ b/mysql-test/suite/innodb_plugin/r/innodb_multi_update.result @@ -74,3 +74,11 @@ a b 4 14 5 15 drop table bug38999_1,bug38999_2; +# +# Bug#54475 improper error handling causes cascading crashing failures in innodb/ndb +# +CREATE TABLE t1(f1 INT) ENGINE=INNODB; +INSERT INTO t1 VALUES(1); +UPDATE (SELECT ((SELECT 1 FROM t1), 1) FROM t1 WHERE (SELECT 1 FROM t1)) x, (SELECT 1) AS d SET d.f1 = 1; +ERROR 21000: Operand should contain 1 column(s) +DROP TABLE t1; diff --git a/mysql-test/suite/innodb_plugin/t/innodb_multi_update.test b/mysql-test/suite/innodb_plugin/t/innodb_multi_update.test index 890889301e6..3d9a9a53193 100644 --- a/mysql-test/suite/innodb_plugin/t/innodb_multi_update.test +++ b/mysql-test/suite/innodb_plugin/t/innodb_multi_update.test @@ -27,3 +27,14 @@ select * from bug38999_1; select * from bug38999_2; drop table bug38999_1,bug38999_2; + + +--echo # +--echo # Bug#54475 improper error handling causes cascading crashing failures in innodb/ndb +--echo # +CREATE TABLE t1(f1 INT) ENGINE=INNODB; +INSERT INTO t1 VALUES(1); +--error ER_OPERAND_COLUMNS +UPDATE (SELECT ((SELECT 1 FROM t1), 1) FROM t1 WHERE (SELECT 1 FROM t1)) x, (SELECT 1) AS d SET d.f1 = 1; +DROP TABLE t1; + diff --git a/mysql-test/t/derived.test b/mysql-test/t/derived.test index d28c19bbd18..5ce6b52b74f 100644 --- a/mysql-test/t/derived.test +++ b/mysql-test/t/derived.test @@ -301,4 +301,15 @@ SELECT 0 FROM (SELECT 0) t56, (SELECT 0) t57, (SELECT 0) t58, (SELECT 0) t59, (SELECT 0) t60, (SELECT 0) t61; # 61 == MAX_TABLES +--echo # +--echo # A nested materialized derived table is used before being populated. +--echo # (addon for bug#19077) +--echo # + +CREATE TABLE t1 (i INT, j BIGINT); +INSERT INTO t1 VALUES (1, 2), (2, 2), (3, 2); +SELECT * FROM (SELECT MIN(i) FROM t1 +WHERE j = SUBSTRING('12', (SELECT * FROM (SELECT MIN(j) FROM t1) t2))) t3; +DROP TABLE t1; + --echo # End of 5.0 tests diff --git a/mysql-test/t/multi_update.test b/mysql-test/t/multi_update.test index 85d2ed19fda..5298701d790 100644 --- a/mysql-test/t/multi_update.test +++ b/mysql-test/t/multi_update.test @@ -673,4 +673,15 @@ SET t3.a = 0; DROP TABLE t1, t2, t3; SET SESSION sql_safe_updates = DEFAULT; +--echo # +--echo # Bug#52157 various crashes and assertions with multi-table update, stored function +--echo # + +CREATE FUNCTION f1 () RETURNS BLOB RETURN 1; +CREATE TABLE t1 (f1 DATE); +INSERT INTO t1 VALUES('2001-01-01'); +UPDATE (SELECT 1 FROM t1 WHERE f1 = (SELECT f1() FROM t1)) x, t1 SET f1 = 1; +DROP FUNCTION f1; +DROP TABLE t1; + --echo end of tests diff --git a/mysql-test/t/view.test b/mysql-test/t/view.test index 3736f53b288..b1b3b5f2a83 100644 --- a/mysql-test/t/view.test +++ b/mysql-test/t/view.test @@ -3925,6 +3925,22 @@ WHERE t1.b <=> (SELECT a FROM t1 WHERE a < SOME(SELECT '1')); DROP VIEW v1; DROP TABLE t1; +--echo # +--echo # Bug#57703 create view cause Assertion failed: 0, file .\item_subselect.cc, line 846 +--echo # + +CREATE TABLE t1(a int); +CREATE VIEW v1 AS SELECT 1 FROM t1 GROUP BY +SUBSTRING(1 FROM (SELECT 3 FROM t1 WHERE a >= ANY(SELECT 1))); +DROP VIEW v1; +DROP TABLE t1; + +--echo # +--echo # Bug#57352 valgrind warnings when creating view +--echo # +CREATE VIEW v1 AS SELECT 1 IN (1 LIKE 2,0) AS f; +DROP VIEW v1; + --echo # ----------------------------------------------------------------- --echo # -- End of 5.1 tests. --echo # ----------------------------------------------------------------- diff --git a/sql/item.cc b/sql/item.cc index 61dd8a97dcb..c782b25f127 100644 --- a/sql/item.cc +++ b/sql/item.cc @@ -1712,16 +1712,7 @@ bool agg_item_set_converter(DTCollation &coll, const char *fname, if (!(conv= (*arg)->safe_charset_converter(coll.collation)) && ((*arg)->collation.repertoire == MY_REPERTOIRE_ASCII)) - { - /* - We should disable const subselect item evaluation because - subselect transformation does not happen in view_prepare_mode - and thus val_...() methods can not be called for const items. - */ - bool resolve_const= ((*arg)->type() == Item::SUBSELECT_ITEM && - thd->lex->view_prepare_mode) ? FALSE : TRUE; - conv= new Item_func_conv_charset(*arg, coll.collation, resolve_const); - } + conv= new Item_func_conv_charset(*arg, coll.collation, 1); if (!conv) { diff --git a/sql/item_cmpfunc.cc b/sql/item_cmpfunc.cc index 8b8ee4a0054..ce65975f4ea 100644 --- a/sql/item_cmpfunc.cc +++ b/sql/item_cmpfunc.cc @@ -401,7 +401,7 @@ static bool convert_constant_item(THD *thd, Item_field *field_item, Field *field= field_item->field; int result= 0; - if (!(*item)->with_subselect && (*item)->const_item()) + if ((*item)->const_item()) { TABLE *table= field->table; ulong orig_sql_mode= thd->variables.sql_mode; @@ -497,7 +497,7 @@ void Item_bool_func2::fix_length_and_dec() } thd= current_thd; - if (!thd->is_context_analysis_only()) + if (!thd->lex->is_ps_or_view_context_analysis()) { if (args[0]->real_item()->type() == FIELD_ITEM) { @@ -801,7 +801,7 @@ Arg_comparator::can_compare_as_dates(Item *a, Item *b, ulonglong *const_value) confuse storage engines since in context analysis mode tables aren't locked. */ - if (!thd->is_context_analysis_only() && + if (!thd->lex->is_ps_or_view_context_analysis() && cmp_type != CMP_DATE_WITH_DATE && str_arg->const_item() && (str_arg->type() != Item::FUNC_ITEM || ((Item_func*)str_arg)->functype() != Item_func::GUSERVAR_FUNC)) @@ -1027,7 +1027,7 @@ Item** Arg_comparator::cache_converted_constant(THD *thd_arg, Item **value, Item_result type) { /* Don't need cache if doing context analysis only. */ - if (!thd_arg->is_context_analysis_only() && + if (!thd->lex->is_ps_or_view_context_analysis() && (*value)->const_item() && type != (*value)->result_type()) { Item_cache *cache= Item_cache::get_cache(*value, type); @@ -4689,7 +4689,7 @@ bool Item_func_like::fix_fields(THD *thd, Item **ref) return TRUE; } - if (escape_item->const_item() && !thd->lex->view_prepare_mode) + if (escape_item->const_item()) { /* If we are on execution stage */ String *escape_str= escape_item->val_str(&cmp.value1); diff --git a/sql/item_func.cc b/sql/item_func.cc index 258ba0f01d5..e121e9ed3c6 100644 --- a/sql/item_func.cc +++ b/sql/item_func.cc @@ -6045,7 +6045,7 @@ Item_func_sp::fix_fields(THD *thd, Item **ref) if (res) DBUG_RETURN(res); - if (thd->lex->view_prepare_mode) + if (thd->lex->context_analysis_only & CONTEXT_ANALYSIS_ONLY_VIEW) { /* Here we check privileges of the stored routine only during view diff --git a/sql/item_row.cc b/sql/item_row.cc index 7535c1fa80b..408bc11eb9b 100644 --- a/sql/item_row.cc +++ b/sql/item_row.cc @@ -73,12 +73,8 @@ bool Item_row::fix_fields(THD *thd, Item **ref) used_tables_cache |= item->used_tables(); const_item_cache&= item->const_item() && !with_null; not_null_tables_cache|= item->not_null_tables(); - /* - Some subqueries transformations aren't done in the view_prepare_mode thus - is_null() will fail. So we skip is_null() calculation for CREATE VIEW as - not necessary. - */ - if (const_item_cache && !thd->lex->view_prepare_mode) + + if (const_item_cache) { if (item->cols() > 1) with_null|= item->null_inside(); diff --git a/sql/item_subselect.cc b/sql/item_subselect.cc index 1ed36ce7656..9bad6728076 100644 --- a/sql/item_subselect.cc +++ b/sql/item_subselect.cc @@ -123,20 +123,6 @@ void Item_subselect::cleanup() } -/* - We cannot use generic Item::safe_charset_converter() because - Subselect transformation does not happen in view_prepare_mode - and thus we can not evaluate val_...() for const items. -*/ - -Item *Item_subselect::safe_charset_converter(CHARSET_INFO *tocs) -{ - Item_func_conv_charset *conv= - new Item_func_conv_charset(this, tocs, thd->lex->view_prepare_mode ? 0 : 1); - return conv->safe ? conv : NULL; -} - - void Item_singlerow_subselect::cleanup() { DBUG_ENTER("Item_singlerow_subselect::cleanup"); @@ -271,6 +257,7 @@ bool Item_subselect::exec() if (thd->is_error() || thd->killed) return 1; + DBUG_ASSERT(!thd->lex->context_analysis_only); /* Simulate a failure in sub-query execution. Used to test e.g. out of memory or query being killed conditions. @@ -307,7 +294,7 @@ table_map Item_subselect::used_tables() const bool Item_subselect::const_item() const { - return const_item_cache; + return thd->lex->context_analysis_only ? FALSE : const_item_cache; } Item *Item_subselect::get_tmp_table_item(THD *thd_arg) @@ -1638,7 +1625,8 @@ bool Item_in_subselect::fix_fields(THD *thd_arg, Item **ref) { bool result = 0; - if (thd_arg->lex->view_prepare_mode && left_expr && !left_expr->fixed) + if ((thd_arg->lex->context_analysis_only & CONTEXT_ANALYSIS_ONLY_VIEW) && + left_expr && !left_expr->fixed) result = left_expr->fix_fields(thd_arg, &left_expr); return result || Item_subselect::fix_fields(thd_arg, ref); diff --git a/sql/item_subselect.h b/sql/item_subselect.h index 3806e68e377..467e9b22637 100644 --- a/sql/item_subselect.h +++ b/sql/item_subselect.h @@ -126,7 +126,6 @@ public: virtual void reset_value_registration() {} enum_parsing_place place() { return parsing_place; } bool walk(Item_processor processor, bool walk_subquery, uchar *arg); - Item *safe_charset_converter(CHARSET_INFO *tocs); /** Get the SELECT_LEX structure associated with this Item. diff --git a/sql/mysql_priv.h b/sql/mysql_priv.h index 9f2c0b04f2c..c8b923e0d61 100644 --- a/sql/mysql_priv.h +++ b/sql/mysql_priv.h @@ -566,17 +566,42 @@ protected: #define MY_CHARSET_BIN_MB_MAXLEN 1 +/* + Flags below are set when we perform + context analysis of the statement and make + subqueries non-const. It prevents subquery + evaluation at context analysis stage. +*/ + +/* + Don't evaluate this subquery during statement prepare even if + it's a constant one. The flag is switched off in the end of + mysqld_stmt_prepare. +*/ +#define CONTEXT_ANALYSIS_ONLY_PREPARE 1 +/* + Special JOIN::prepare mode: changing of query is prohibited. + When creating a view, we need to just check its syntax omitting + any optimizations: afterwards definition of the view will be + reconstructed by means of ::print() methods and written to + to an .frm file. We need this definition to stay untouched. +*/ +#define CONTEXT_ANALYSIS_ONLY_VIEW 2 +/* + Don't evaluate this subquery during derived table prepare even if + it's a constant one. +*/ +#define CONTEXT_ANALYSIS_ONLY_DERIVED 4 + // uncachable cause #define UNCACHEABLE_DEPENDENT 1 #define UNCACHEABLE_RAND 2 #define UNCACHEABLE_SIDEEFFECT 4 /// forcing to save JOIN for explain #define UNCACHEABLE_EXPLAIN 8 -/** Don't evaluate subqueries in prepare even if they're not correlated */ -#define UNCACHEABLE_PREPARE 16 /* For uncorrelated SELECT in an UNION with some correlated SELECTs */ -#define UNCACHEABLE_UNITED 32 -#define UNCACHEABLE_CHECKOPTION 64 +#define UNCACHEABLE_UNITED 16 +#define UNCACHEABLE_CHECKOPTION 32 /* Used to check GROUP BY list in the MODE_ONLY_FULL_GROUP_BY mode */ #define UNDEF_POS (-1) diff --git a/sql/sql_class.h b/sql/sql_class.h index 42c873e9fc3..0af28171160 100644 --- a/sql/sql_class.h +++ b/sql/sql_class.h @@ -2180,8 +2180,6 @@ public: (variables.sql_mode & MODE_STRICT_ALL_TABLES))); } void set_status_var_init(); - bool is_context_analysis_only() - { return stmt_arena->is_stmt_prepare() || lex->view_prepare_mode; } void reset_n_backup_open_tables_state(Open_tables_state *backup); void restore_backup_open_tables_state(Open_tables_state *backup); void reset_sub_statement_state(Sub_statement_state *backup, uint new_state); diff --git a/sql/sql_derived.cc b/sql/sql_derived.cc index 782589f7d0f..3214c756bc7 100644 --- a/sql/sql_derived.cc +++ b/sql/sql_derived.cc @@ -147,10 +147,11 @@ bool mysql_derived_prepare(THD *thd, LEX *lex, TABLE_LIST *orig_table_list) if (!(derived_result= new select_union)) DBUG_RETURN(TRUE); // out of memory + lex->context_analysis_only|= CONTEXT_ANALYSIS_ONLY_DERIVED; // st_select_lex_unit::prepare correctly work for single select if ((res= unit->prepare(thd, derived_result, 0))) goto exit; - + lex->context_analysis_only&= ~CONTEXT_ANALYSIS_ONLY_DERIVED; if ((res= check_duplicate_names(unit->types, 0))) goto exit; diff --git a/sql/sql_lex.cc b/sql/sql_lex.cc index 24c51be2512..9ea144df9bc 100644 --- a/sql/sql_lex.cc +++ b/sql/sql_lex.cc @@ -305,7 +305,7 @@ void lex_start(THD *thd) lex->select_lex.group_list.empty(); lex->describe= 0; lex->subqueries= FALSE; - lex->view_prepare_mode= FALSE; + lex->context_analysis_only= 0; lex->derived_tables= 0; lex->lock_option= TL_READ; lex->safe_to_cache_query= 1; diff --git a/sql/sql_lex.h b/sql/sql_lex.h index 9131cec9d04..b1f30b07824 100644 --- a/sql/sql_lex.h +++ b/sql/sql_lex.h @@ -1715,14 +1715,8 @@ typedef struct st_lex : public Query_tables_list bool verbose, no_write_to_binlog; bool tx_chain, tx_release; - /* - Special JOIN::prepare mode: changing of query is prohibited. - When creating a view, we need to just check its syntax omitting - any optimizations: afterwards definition of the view will be - reconstructed by means of ::print() methods and written to - to an .frm file. We need this definition to stay untouched. - */ - bool view_prepare_mode; + + uint8 context_analysis_only; bool safe_to_cache_query; bool subqueries, ignore; st_parsing_options parsing_options; @@ -1843,6 +1837,13 @@ typedef struct st_lex : public Query_tables_list delete_dynamic(&plugins); } + inline bool is_ps_or_view_context_analysis() + { + return (context_analysis_only & + (CONTEXT_ANALYSIS_ONLY_PREPARE | + CONTEXT_ANALYSIS_ONLY_VIEW)); + } + inline void uncacheable(uint8 cause) { safe_to_cache_query= 0; diff --git a/sql/sql_parse.cc b/sql/sql_parse.cc index fbe9c9753d9..169cea3a3ed 100644 --- a/sql/sql_parse.cc +++ b/sql/sql_parse.cc @@ -5848,13 +5848,6 @@ mysql_new_select(LEX *lex, bool move_down) DBUG_RETURN(1); } select_lex->nest_level= lex->nest_level; - /* - Don't evaluate this subquery during statement prepare even if - it's a constant one. The flag is switched off in the end of - mysqld_stmt_prepare. - */ - if (thd->stmt_arena->is_stmt_prepare()) - select_lex->uncacheable|= UNCACHEABLE_PREPARE; if (move_down) { SELECT_LEX_UNIT *unit; diff --git a/sql/sql_prepare.cc b/sql/sql_prepare.cc index 5ba375f9710..aadfb831087 100644 --- a/sql/sql_prepare.cc +++ b/sql/sql_prepare.cc @@ -1688,7 +1688,7 @@ static bool mysql_test_create_view(Prepared_statement *stmt) if (open_normal_and_derived_tables(thd, tables, 0)) goto err; - lex->view_prepare_mode= 1; + lex->context_analysis_only|= CONTEXT_ANALYSIS_ONLY_VIEW; res= select_like_stmt_test(stmt, 0, 0); err: @@ -2234,19 +2234,6 @@ end: } -/** Init PS/SP specific parse tree members. */ - -static void init_stmt_after_parse(LEX *lex) -{ - SELECT_LEX *sl= lex->all_selects_list; - /* - Switch off a temporary flag that prevents evaluation of - subqueries in statement prepare. - */ - for (; sl; sl= sl->next_select_in_list()) - sl->uncacheable&= ~UNCACHEABLE_PREPARE; -} - /** SQLCOM_PREPARE implementation. @@ -3080,6 +3067,7 @@ bool Prepared_statement::prepare(const char *packet, uint packet_len) parser_state.m_lip.stmt_prepare_mode= TRUE; lex_start(thd); + lex->context_analysis_only|= CONTEXT_ANALYSIS_ONLY_PREPARE; error= parse_sql(thd, & parser_state, NULL) || thd->is_error() || @@ -3132,7 +3120,7 @@ bool Prepared_statement::prepare(const char *packet, uint packet_len) if (error == 0) { setup_set_params(); - init_stmt_after_parse(lex); + lex->context_analysis_only&= ~CONTEXT_ANALYSIS_ONLY_PREPARE; state= Query_arena::PREPARED; flags&= ~ (uint) IS_IN_USE; /* diff --git a/sql/sql_select.cc b/sql/sql_select.cc index 9bf0a236e1b..224fa43d0ef 100644 --- a/sql/sql_select.cc +++ b/sql/sql_select.cc @@ -538,7 +538,8 @@ JOIN::prepare(Item ***rref_pointer_array, thd->lex->allow_sum_func= save_allow_sum_func; } - if (!thd->lex->view_prepare_mode && !(select_options & SELECT_DESCRIBE)) + if (!(thd->lex->context_analysis_only & CONTEXT_ANALYSIS_ONLY_VIEW) && + !(select_options & SELECT_DESCRIBE)) { Item_subselect *subselect; /* Is it subselect? */ diff --git a/sql/sql_show.cc b/sql/sql_show.cc index e074461b452..55d65a59536 100644 --- a/sql/sql_show.cc +++ b/sql/sql_show.cc @@ -724,7 +724,7 @@ mysqld_show_create(THD *thd, TABLE_LIST *table_list) table_list->table_name)); /* We want to preserve the tree for views. */ - thd->lex->view_prepare_mode= TRUE; + thd->lex->context_analysis_only|= CONTEXT_ANALYSIS_ONLY_VIEW; { Show_create_error_handler view_error_suppressor(thd, table_list); @@ -3321,7 +3321,7 @@ int get_all_tables(THD *thd, TABLE_LIST *tables, COND *cond) uint derived_tables= lex->derived_tables; int error= 1; Open_tables_state open_tables_state_backup; - bool save_view_prepare_mode= lex->view_prepare_mode; + uint8 save_context_analysis_only= lex->context_analysis_only; Query_tables_list query_tables_list_backup; #ifndef NO_EMBEDDED_ACCESS_CHECKS Security_context *sctx= thd->security_ctx; @@ -3329,7 +3329,7 @@ int get_all_tables(THD *thd, TABLE_LIST *tables, COND *cond) uint table_open_method; DBUG_ENTER("get_all_tables"); - lex->view_prepare_mode= TRUE; + lex->context_analysis_only|= CONTEXT_ANALYSIS_ONLY_VIEW; lex->reset_n_backup_query_tables_list(&query_tables_list_backup); /* @@ -3546,7 +3546,7 @@ err: lex->restore_backup_query_tables_list(&query_tables_list_backup); lex->derived_tables= derived_tables; lex->all_selects_list= old_all_select_lex; - lex->view_prepare_mode= save_view_prepare_mode; + lex->context_analysis_only= save_context_analysis_only; lex->sql_command= save_sql_command; DBUG_RETURN(error); } diff --git a/sql/sql_view.cc b/sql/sql_view.cc index 133574089aa..6cb4f590ae0 100644 --- a/sql/sql_view.cc +++ b/sql/sql_view.cc @@ -545,7 +545,7 @@ bool mysql_create_view(THD *thd, TABLE_LIST *views, } /* prepare select to resolve all fields */ - lex->view_prepare_mode= 1; + lex->context_analysis_only|= CONTEXT_ANALYSIS_ONLY_VIEW; if (unit->prepare(thd, 0, 0)) { /* From e4f23ff5810547d3efdec9da883f4c8d48c618e6 Mon Sep 17 00:00:00 2001 From: MySQL Build Team Date: Wed, 9 Feb 2011 21:59:29 +0100 Subject: [PATCH 098/202] Backport into build-201102032246-5.1.52sp1 > ------------------------------------------------------------ > revno: 3527.3.1 > revision-id: mattias.jonsson@oracle.com-20101222095036-2lpx0gqu4i45jtkz > parent: sven.sandberg@oracle.com-20101220090735-psae11j9nwuj8vzl > committer: Mattias Jonsson > branch nick: b54483-51-bt_2 > timestamp: Wed 2010-12-22 10:50:36 +0100 > message: > Bug#54483: valgrind errors when making warnings for multiline inserts into partition > Bug#57071: EXTRACT(WEEK from date_col) cannot be allowed as partitioning function > > There were functions allowed as partitioning functions > that implicit allowed cast. That could result in unacceptable > behaviour. > > Solution was to check that the arguments of date and time functions > have allowed types (field and date/datetime/time depending on function). --- mysql-test/r/partition.result | 2 +- mysql-test/r/partition_error.result | 638 +++++ .../inc/part_supported_sql_funcs_main.inc | 48 +- .../r/part_supported_sql_func_innodb.result | 2044 ----------------- .../r/part_supported_sql_func_myisam.result | 2044 ----------------- mysql-test/t/partition.test | 5 +- mysql-test/t/partition_error.test | 664 ++++++ sql/item.h | 8 +- sql/item_func.h | 42 +- sql/item_timefunc.h | 94 +- sql/sql_partition.cc | 2 +- 11 files changed, 1471 insertions(+), 4120 deletions(-) diff --git a/mysql-test/r/partition.result b/mysql-test/r/partition.result index 8e65557d690..27ada9d1129 100644 --- a/mysql-test/r/partition.result +++ b/mysql-test/r/partition.result @@ -1778,7 +1778,7 @@ c1 bigint, c2 set('sweet'), key (c2,c1,c0), key(c0) -) engine=myisam partition by hash (month(c0)) partitions 5; +) engine=myisam partition by hash (c0) partitions 5; insert ignore into t1 set c0 = -6502262, c1 = 3992917, c2 = 35019; insert ignore into t1 set c0 = 241221, c1 = -6862346, c2 = 56644; select c1 from t1 group by (select c0 from t1 limit 1); diff --git a/mysql-test/r/partition_error.result b/mysql-test/r/partition_error.result index ea74f476ceb..0426ce42071 100644 --- a/mysql-test/r/partition_error.result +++ b/mysql-test/r/partition_error.result @@ -1,5 +1,643 @@ drop table if exists t1; # +# Bug#54483: valgrind errors when making warnings for multiline inserts +# into partition +# +CREATE TABLE t1 (a VARBINARY(10)) +PARTITION BY RANGE (DAYOFWEEK(a)) +(PARTITION a1 VALUES LESS THAN (60)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a CHAR(10)) +PARTITION BY RANGE (DAYOFWEEK(a)) +(PARTITION a1 VALUES LESS THAN (60)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY RANGE (DAYOFWEEK(a)) +(PARTITION a1 VALUES LESS THAN (60)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a TIMESTAMP) +PARTITION BY RANGE (DAYOFWEEK(a)) +(PARTITION a1 VALUES LESS THAN (60)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a DATE) +PARTITION BY RANGE (DAYOFWEEK(a)) +(PARTITION a1 VALUES LESS THAN (60)); +INSERT INTO t1 VALUES ('test'),('a'),('5'); +Warnings: +Warning 1265 Data truncated for column 'a' at row 1 +Warning 1265 Data truncated for column 'a' at row 2 +Warning 1265 Data truncated for column 'a' at row 3 +SHOW WARNINGS; +Level Code Message +Warning 1265 Data truncated for column 'a' at row 1 +Warning 1265 Data truncated for column 'a' at row 2 +Warning 1265 Data truncated for column 'a' at row 3 +DROP TABLE t1; +CREATE TABLE t1 (a DATETIME) +PARTITION BY RANGE (DAYOFWEEK(a)) +(PARTITION a1 VALUES LESS THAN (60)); +INSERT INTO t1 VALUES ('test'),('a'),('5'); +Warnings: +Warning 1264 Out of range value for column 'a' at row 1 +Warning 1264 Out of range value for column 'a' at row 2 +Warning 1264 Out of range value for column 'a' at row 3 +SHOW WARNINGS; +Level Code Message +Warning 1264 Out of range value for column 'a' at row 1 +Warning 1264 Out of range value for column 'a' at row 2 +Warning 1264 Out of range value for column 'a' at row 3 +DROP TABLE t1; +CREATE TABLE t1 (a TIME) +PARTITION BY RANGE (DAYOFWEEK(a)) +(PARTITION a1 VALUES LESS THAN (60)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +SHOW WARNINGS; +Level Code Message +Error 1486 Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (TO_DAYS(a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (TO_DAYS(a)); +DROP TABLE t1; +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (TO_DAYS(a)); +DROP TABLE t1; +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (TO_DAYS(a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a INT) +PARTITION BY HASH (TO_DAYS(a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (DAYOFMONTH(a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (DAYOFMONTH(a)); +DROP TABLE t1; +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (DAYOFMONTH(a)); +DROP TABLE t1; +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (DAYOFMONTH(a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a INT) +PARTITION BY HASH (DAYOFMONTH(a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (MONTH(a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (MONTH(a)); +DROP TABLE t1; +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (MONTH(a)); +DROP TABLE t1; +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (MONTH(a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a INT) +PARTITION BY HASH (MONTH(a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (DAYOFYEAR(a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (DAYOFYEAR(a)); +DROP TABLE t1; +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (DAYOFYEAR(a)); +DROP TABLE t1; +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (DAYOFYEAR(a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a INT) +PARTITION BY HASH (DAYOFYEAR(a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (HOUR(a)); +DROP TABLE t1; +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (HOUR(a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (HOUR(a)); +DROP TABLE t1; +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (HOUR(a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a INT) +PARTITION BY HASH (HOUR(a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (MINUTE(a)); +DROP TABLE t1; +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (MINUTE(a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (MINUTE(a)); +DROP TABLE t1; +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (MINUTE(a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a INT) +PARTITION BY HASH (MINUTE(a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (QUARTER(a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (QUARTER(a)); +DROP TABLE t1; +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (QUARTER(a)); +DROP TABLE t1; +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (QUARTER(a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a INT) +PARTITION BY HASH (QUARTER(a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (SECOND(a)); +DROP TABLE t1; +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (SECOND(a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (SECOND(a)); +DROP TABLE t1; +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (SECOND(a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a INT) +PARTITION BY HASH (SECOND(a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (YEARWEEK(a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (YEARWEEK(a)); +DROP TABLE t1; +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (YEARWEEK(a)); +DROP TABLE t1; +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (YEARWEEK(a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a INT) +PARTITION BY HASH (YEARWEEK(a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (WEEKDAY(a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (WEEKDAY(a)); +DROP TABLE t1; +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (WEEKDAY(a)); +DROP TABLE t1; +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (WEEKDAY(a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a INT) +PARTITION BY HASH (WEEKDAY(a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +# TO_SECONDS() is added in 5.5. +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (TO_SECONDS(a)); +ERROR 42000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed near ')' at line 2 +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (TIME_TO_SEC(a)); +DROP TABLE t1; +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (TIME_TO_SEC(a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (TIME_TO_SEC(a)); +DROP TABLE t1; +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (TIME_TO_SEC(a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a INT) +PARTITION BY HASH (TIME_TO_SEC(a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (FROM_DAYS(a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (FROM_DAYS(a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (FROM_DAYS(a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (TO_DAYS(FROM_DAYS(a))); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (FROM_DAYS(a)); +ERROR HY000: The PARTITION function returns the wrong type +CREATE TABLE t1 (a INT) +PARTITION BY HASH (TO_DAYS(FROM_DAYS(a))); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a INT) +PARTITION BY HASH (FROM_DAYS(a)); +ERROR HY000: The PARTITION function returns the wrong type +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (MICROSECOND(a)); +DROP TABLE t1; +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (MICROSECOND(a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (MICROSECOND(a)); +DROP TABLE t1; +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (MICROSECOND(a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a INT) +PARTITION BY HASH (MICROSECOND(a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +# Bug#57071 +CREATE TABLE t1 +(`date` date, +`extracted_week` int, +`yearweek` int, +`week` int, +`default_week_format` int) +PARTITION BY LIST (EXTRACT(WEEK FROM date) % 3) +(PARTITION p0 VALUES IN (0), +PARTITION p1 VALUES IN (1), +PARTITION p2 VALUES IN (2)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 +(`date` date, +`extracted_week` int, +`yearweek` int, +`week` int, +`default_week_format` int); +SET @old_default_week_format := @@default_week_format; +SET default_week_format = 0; +INSERT INTO t1 VALUES ('2000-01-01', EXTRACT(WEEK FROM '2000-01-01'), YEARWEEK('2000-01-01'), WEEK('2000-01-01'), @@default_week_format); +SET default_week_format = 1; +INSERT INTO t1 VALUES ('2000-01-01', EXTRACT(WEEK FROM '2000-01-01'), YEARWEEK('2000-01-01'), WEEK('2000-01-01'), @@default_week_format); +SET default_week_format = 2; +INSERT INTO t1 VALUES ('2000-01-01', EXTRACT(WEEK FROM '2000-01-01'), YEARWEEK('2000-01-01'), WEEK('2000-01-01'), @@default_week_format); +SET default_week_format = 3; +INSERT INTO t1 VALUES ('2000-01-01', EXTRACT(WEEK FROM '2000-01-01'), YEARWEEK('2000-01-01'), WEEK('2000-01-01'), @@default_week_format); +SET default_week_format = 4; +INSERT INTO t1 VALUES ('2000-01-01', EXTRACT(WEEK FROM '2000-01-01'), YEARWEEK('2000-01-01'), WEEK('2000-01-01'), @@default_week_format); +SET default_week_format = 5; +INSERT INTO t1 VALUES ('2000-01-01', EXTRACT(WEEK FROM '2000-01-01'), YEARWEEK('2000-01-01'), WEEK('2000-01-01'), @@default_week_format); +SET default_week_format = 6; +INSERT INTO t1 VALUES ('2000-01-01', EXTRACT(WEEK FROM '2000-01-01'), YEARWEEK('2000-01-01'), WEEK('2000-01-01'), @@default_week_format); +SET default_week_format = 7; +INSERT INTO t1 VALUES ('2000-01-01', EXTRACT(WEEK FROM '2000-01-01'), YEARWEEK('2000-01-01'), WEEK('2000-01-01'), @@default_week_format); +SELECT * FROM t1; +date extracted_week yearweek week default_week_format +2000-01-01 0 199952 0 0 +2000-01-01 0 199952 0 1 +2000-01-01 52 199952 52 2 +2000-01-01 52 199952 52 3 +2000-01-01 0 199952 0 4 +2000-01-01 0 199952 0 5 +2000-01-01 52 199952 52 6 +2000-01-01 52 199952 52 7 +SET default_week_format = @old_default_week_format; +DROP TABLE t1; +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (EXTRACT(YEAR FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (EXTRACT(YEAR FROM a)); +DROP TABLE t1; +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (EXTRACT(YEAR FROM a)); +DROP TABLE t1; +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (EXTRACT(YEAR FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a INT) +PARTITION BY HASH (EXTRACT(YEAR FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (EXTRACT(YEAR_MONTH FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (EXTRACT(YEAR_MONTH FROM a)); +DROP TABLE t1; +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (EXTRACT(YEAR_MONTH FROM a)); +DROP TABLE t1; +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (EXTRACT(YEAR_MONTH FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a INT) +PARTITION BY HASH (EXTRACT(YEAR_MONTH FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (EXTRACT(QUARTER FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (EXTRACT(QUARTER FROM a)); +DROP TABLE t1; +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (EXTRACT(QUARTER FROM a)); +DROP TABLE t1; +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (EXTRACT(QUARTER FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a INT) +PARTITION BY HASH (EXTRACT(QUARTER FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (EXTRACT(MONTH FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (EXTRACT(MONTH FROM a)); +DROP TABLE t1; +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (EXTRACT(MONTH FROM a)); +DROP TABLE t1; +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (EXTRACT(MONTH FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a INT) +PARTITION BY HASH (EXTRACT(MONTH FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +# EXTRACT(WEEK...) is disallowed, see bug#57071. +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (EXTRACT(WEEK FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (EXTRACT(WEEK FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (EXTRACT(WEEK FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (EXTRACT(WEEK FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a INT) +PARTITION BY HASH (EXTRACT(WEEK FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (EXTRACT(DAY FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (EXTRACT(DAY FROM a)); +DROP TABLE t1; +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (EXTRACT(DAY FROM a)); +DROP TABLE t1; +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (EXTRACT(DAY FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a INT) +PARTITION BY HASH (EXTRACT(DAY FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (EXTRACT(DAY_HOUR FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (EXTRACT(DAY_HOUR FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (EXTRACT(DAY_HOUR FROM a)); +DROP TABLE t1; +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (EXTRACT(DAY_HOUR FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a INT) +PARTITION BY HASH (EXTRACT(DAY_HOUR FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (EXTRACT(DAY_MINUTE FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (EXTRACT(DAY_MINUTE FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (EXTRACT(DAY_MINUTE FROM a)); +DROP TABLE t1; +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (EXTRACT(DAY_MINUTE FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a INT) +PARTITION BY HASH (EXTRACT(DAY_MINUTE FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (EXTRACT(DAY_SECOND FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (EXTRACT(DAY_SECOND FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (EXTRACT(DAY_SECOND FROM a)); +DROP TABLE t1; +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (EXTRACT(DAY_SECOND FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a INT) +PARTITION BY HASH (EXTRACT(DAY_SECOND FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (EXTRACT(HOUR FROM a)); +DROP TABLE t1; +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (EXTRACT(HOUR FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (EXTRACT(HOUR FROM a)); +DROP TABLE t1; +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (EXTRACT(HOUR FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a INT) +PARTITION BY HASH (EXTRACT(HOUR FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (EXTRACT(HOUR_MINUTE FROM a)); +DROP TABLE t1; +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (EXTRACT(HOUR_MINUTE FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (EXTRACT(HOUR_MINUTE FROM a)); +DROP TABLE t1; +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (EXTRACT(HOUR_MINUTE FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a INT) +PARTITION BY HASH (EXTRACT(HOUR_MINUTE FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (EXTRACT(HOUR_SECOND FROM a)); +DROP TABLE t1; +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (EXTRACT(HOUR_SECOND FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (EXTRACT(HOUR_SECOND FROM a)); +DROP TABLE t1; +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (EXTRACT(HOUR_SECOND FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a INT) +PARTITION BY HASH (EXTRACT(HOUR_SECOND FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (EXTRACT(MINUTE FROM a)); +DROP TABLE t1; +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (EXTRACT(MINUTE FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (EXTRACT(MINUTE FROM a)); +DROP TABLE t1; +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (EXTRACT(MINUTE FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a INT) +PARTITION BY HASH (EXTRACT(MINUTE FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (EXTRACT(MINUTE_SECOND FROM a)); +DROP TABLE t1; +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (EXTRACT(MINUTE_SECOND FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (EXTRACT(MINUTE_SECOND FROM a)); +DROP TABLE t1; +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (EXTRACT(MINUTE_SECOND FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a INT) +PARTITION BY HASH (EXTRACT(MINUTE_SECOND FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (EXTRACT(SECOND FROM a)); +DROP TABLE t1; +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (EXTRACT(SECOND FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (EXTRACT(SECOND FROM a)); +DROP TABLE t1; +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (EXTRACT(SECOND FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a INT) +PARTITION BY HASH (EXTRACT(SECOND FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (EXTRACT(MICROSECOND FROM a)); +DROP TABLE t1; +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (EXTRACT(MICROSECOND FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (EXTRACT(MICROSECOND FROM a)); +DROP TABLE t1; +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (EXTRACT(MICROSECOND FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a INT) +PARTITION BY HASH (EXTRACT(MICROSECOND FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (EXTRACT(DAY_MICROSECOND FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (EXTRACT(DAY_MICROSECOND FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (EXTRACT(DAY_MICROSECOND FROM a)); +DROP TABLE t1; +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (EXTRACT(DAY_MICROSECOND FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a INT) +PARTITION BY HASH (EXTRACT(DAY_MICROSECOND FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (EXTRACT(HOUR_MICROSECOND FROM a)); +DROP TABLE t1; +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (EXTRACT(HOUR_MICROSECOND FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (EXTRACT(HOUR_MICROSECOND FROM a)); +DROP TABLE t1; +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (EXTRACT(HOUR_MICROSECOND FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a INT) +PARTITION BY HASH (EXTRACT(HOUR_MICROSECOND FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (EXTRACT(MINUTE_MICROSECOND FROM a)); +DROP TABLE t1; +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (EXTRACT(MINUTE_MICROSECOND FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (EXTRACT(MINUTE_MICROSECOND FROM a)); +DROP TABLE t1; +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (EXTRACT(MINUTE_MICROSECOND FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a INT) +PARTITION BY HASH (EXTRACT(MINUTE_MICROSECOND FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (EXTRACT(SECOND_MICROSECOND FROM a)); +DROP TABLE t1; +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (EXTRACT(SECOND_MICROSECOND FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (EXTRACT(SECOND_MICROSECOND FROM a)); +DROP TABLE t1; +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (EXTRACT(SECOND_MICROSECOND FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a INT) +PARTITION BY HASH (EXTRACT(SECOND_MICROSECOND FROM a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a TIME, b DATE) +PARTITION BY HASH (DATEDIFF(a, b)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a DATE, b DATETIME) +PARTITION BY HASH (DATEDIFF(a, b)); +DROP TABLE t1; +CREATE TABLE t1 (a DATETIME, b DATE) +PARTITION BY HASH (DATEDIFF(a, b)); +DROP TABLE t1; +CREATE TABLE t1 (a DATE, b VARCHAR(10)) +PARTITION BY HASH (DATEDIFF(a, b)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a INT, b DATETIME) +PARTITION BY HASH (DATEDIFF(a, b)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (TIME_TO_SEC(a)); +DROP TABLE t1; +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (TIME_TO_SEC(a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (TIME_TO_SEC(a)); +DROP TABLE t1; +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (TIME_TO_SEC(a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +CREATE TABLE t1 (a INT) +PARTITION BY HASH (TIME_TO_SEC(a)); +ERROR HY000: Constant, random or timezone-dependent expressions in (sub)partitioning function are not allowed +# # Bug#49161: Out of memory; restart server and try again (needed 2 bytes) # CREATE TABLE t1 (a INT) PARTITION BY HASH (a); diff --git a/mysql-test/suite/parts/inc/part_supported_sql_funcs_main.inc b/mysql-test/suite/parts/inc/part_supported_sql_funcs_main.inc index 25a9774d2a1..f5c9d09f067 100644 --- a/mysql-test/suite/parts/inc/part_supported_sql_funcs_main.inc +++ b/mysql-test/suite/parts/inc/part_supported_sql_funcs_main.inc @@ -111,8 +111,9 @@ let $val2 = '2006-01-17'; let $val3 = '2006-02-25'; let $val4 = '2006-02-05'; --source suite/parts/inc/partition_supported_sql_funcs.inc -let $coltype = char(30); ---source suite/parts/inc/partition_supported_sql_funcs.inc +# Disabled after fixing bug#54483. +#let $coltype = char(30); +#--source suite/parts/inc/partition_supported_sql_funcs.inc let $sqlfunc = extract(month from col1); let $valsqlfunc = extract(year from '1998-11-23'); @@ -162,8 +163,9 @@ let $val2 = '14:30:20'; let $val3 = '21:59:22'; let $val4 = '10:22:33'; --source suite/parts/inc/partition_supported_sql_funcs.inc -let $coltype = char(30); ---source suite/parts/inc/partition_supported_sql_funcs.inc +# second(non_time_col) is disabled after bug#54483. +#let $coltype = char(30); +#--source suite/parts/inc/partition_supported_sql_funcs.inc let $sqlfunc = month(col1); let $valsqlfunc = month('2006-10-14'); @@ -195,26 +197,28 @@ let $val3 = '21:59:22'; let $val4 = '10:33:11'; --source suite/parts/inc/partition_supported_sql_funcs.inc -let $sqlfunc = to_days(col1)-to_days('2006-01-01'); -let $valsqlfunc = to_days('2006-02-02')-to_days('2006-01-01'); -let $coltype = date; -let $infile = part_supported_sql_funcs_int_date.inc; -let $val1 = '2006-02-03'; -let $val2 = '2006-01-17'; -let $val3 = '2006-01-25'; -let $val4 = '2006-02-06'; ---source suite/parts/inc/partition_supported_sql_funcs.inc +# to_days(non_date_col) is disabled after bug#54483. +#let $sqlfunc = to_days(col1)-to_days('2006-01-01'); +#let $valsqlfunc = to_days('2006-02-02')-to_days('2006-01-01'); +#let $coltype = date; +#let $infile = part_supported_sql_funcs_int_date.inc; +#let $val1 = '2006-02-03'; +#let $val2 = '2006-01-17'; +#let $val3 = '2006-01-25'; +#let $val4 = '2006-02-06'; +#--source suite/parts/inc/partition_supported_sql_funcs.inc +# to_days(non_date_col) is disabled after bug#54483. # DATEDIFF() is implemented as (TO_DAYS(d1) - TO_DAYS(d2)) -let $sqlfunc = datediff(col1, '2006-01-01'); -let $valsqlfunc = datediff('2006-02-02', '2006-01-01'); -let $coltype = date; -let $infile = part_supported_sql_funcs_int_date.inc; -let $val1 = '2006-02-03'; -let $val2 = '2006-01-17'; -let $val3 = '2006-01-25'; -let $val4 = '2006-02-06'; ---source suite/parts/inc/partition_supported_sql_funcs.inc +#let $sqlfunc = datediff(col1, '2006-01-01'); +#let $valsqlfunc = datediff('2006-02-02', '2006-01-01'); +#let $coltype = date; +#let $infile = part_supported_sql_funcs_int_date.inc; +#let $val1 = '2006-02-03'; +#let $val2 = '2006-01-17'; +#let $val3 = '2006-01-25'; +#let $val4 = '2006-02-06'; +#--source suite/parts/inc/partition_supported_sql_funcs.inc let $sqlfunc = weekday(col1); let $valsqlfunc = weekday('2006-10-14'); diff --git a/mysql-test/suite/parts/r/part_supported_sql_func_innodb.result b/mysql-test/suite/parts/r/part_supported_sql_func_innodb.result index 79462c25050..c5b4e0a8665 100644 --- a/mysql-test/suite/parts/r/part_supported_sql_func_innodb.result +++ b/mysql-test/suite/parts/r/part_supported_sql_func_innodb.result @@ -5425,513 +5425,6 @@ drop table if exists t44 ; drop table if exists t55 ; drop table if exists t66 ; ------------------------------------------------------------------------- ---- dayofyear(col1) in partition with coltype char(30) -------------------------------------------------------------------------- -drop table if exists t1 ; -drop table if exists t2 ; -drop table if exists t3 ; -drop table if exists t4 ; -drop table if exists t5 ; -drop table if exists t6 ; -------------------------------------------------------------------------- ---- Create tables with dayofyear(col1) -------------------------------------------------------------------------- -create table t1 (col1 char(30)) engine='INNODB' -partition by range(dayofyear(col1)) -(partition p0 values less than (15), -partition p1 values less than maxvalue); -create table t2 (col1 char(30)) engine='INNODB' -partition by list(dayofyear(col1)) -(partition p0 values in (0,1,2,3,4,5,6,7,8,9,10), -partition p1 values in (11,12,13,14,15,16,17,18,19,20), -partition p2 values in (21,22,23,24,25,26,27,28,29,30), -partition p3 values in (31,32,33,34,35,36,37,38,39,40), -partition p4 values in (41,42,43,44,45,46,47,48,49,50), -partition p5 values in (51,52,53,54,55,56,57,58,59,60) -); -create table t3 (col1 char(30)) engine='INNODB' -partition by hash(dayofyear(col1)); -create table t4 (colint int, col1 char(30)) engine='INNODB' -partition by range(colint) -subpartition by hash(dayofyear(col1)) subpartitions 2 -(partition p0 values less than (15), -partition p1 values less than maxvalue); -create table t5 (colint int, col1 char(30)) engine='INNODB' -partition by list(colint) -subpartition by hash(dayofyear(col1)) subpartitions 2 -(partition p0 values in (1,2,3,4,5,6,7,8,9,10), -partition p1 values in (11,12,13,14,15,16,17,18,19,20), -partition p2 values in (21,22,23,24,25,26,27,28,29,30), -partition p3 values in (31,32,33,34,35,36,37,38,39,40), -partition p4 values in (41,42,43,44,45,46,47,48,49,50), -partition p5 values in (51,52,53,54,55,56,57,58,59,60) -); -create table t6 (colint int, col1 char(30)) engine='INNODB' -partition by range(colint) -(partition p0 values less than (dayofyear('2006-12-25')), -partition p1 values less than maxvalue); -------------------------------------------------------------------------- ---- Access tables with dayofyear(col1) -------------------------------------------------------------------------- -insert into t1 values ('2006-01-03'); -insert into t1 values ('2006-01-17'); -insert into t2 values ('2006-01-03'); -insert into t2 values ('2006-01-17'); -insert into t2 values ('2006-02-25'); -insert into t3 values ('2006-01-03'); -insert into t3 values ('2006-01-17'); -insert into t3 values ('2006-02-25'); -load data infile 'MYSQLTEST_VARDIR/std_data/parts/part_supported_sql_funcs_int_date.inc' into table t4; -load data infile 'MYSQLTEST_VARDIR/std_data/parts/part_supported_sql_funcs_int_date.inc' into table t5; -load data infile 'MYSQLTEST_VARDIR/std_data/parts/part_supported_sql_funcs_int_date.inc' into table t6; -select dayofyear(col1) from t1 order by col1; -dayofyear(col1) -3 -17 -select * from t1 order by col1; -col1 -2006-01-03 -2006-01-17 -select * from t2 order by col1; -col1 -2006-01-03 -2006-01-17 -2006-02-25 -select * from t3 order by col1; -col1 -2006-01-03 -2006-01-17 -2006-02-25 -select * from t4 order by colint; -colint col1 -1 2006-02-03 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -select * from t5 order by colint; -colint col1 -1 2006-02-03 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -select * from t6 order by colint; -colint col1 -1 2006-02-03 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -update t1 set col1='2006-02-05' where col1='2006-01-03'; -update t2 set col1='2006-02-05' where col1='2006-01-03'; -update t3 set col1='2006-02-05' where col1='2006-01-03'; -update t4 set col1='2006-02-05' where col1='2006-01-03'; -update t5 set col1='2006-02-05' where col1='2006-01-03'; -update t6 set col1='2006-02-05' where col1='2006-01-03'; -select * from t1 order by col1; -col1 -2006-01-17 -2006-02-05 -select * from t2 order by col1; -col1 -2006-01-17 -2006-02-05 -2006-02-25 -select * from t3 order by col1; -col1 -2006-01-17 -2006-02-05 -2006-02-25 -select * from t4 order by colint; -colint col1 -1 2006-02-03 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -select * from t5 order by colint; -colint col1 -1 2006-02-03 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -select * from t6 order by colint; -colint col1 -1 2006-02-03 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -------------------------------------------------------------------------- ---- Alter tables with dayofyear(col1) -------------------------------------------------------------------------- -drop table if exists t11 ; -drop table if exists t22 ; -drop table if exists t33 ; -drop table if exists t44 ; -drop table if exists t55 ; -drop table if exists t66 ; -create table t11 engine='INNODB' as select * from t1; -create table t22 engine='INNODB' as select * from t2; -create table t33 engine='INNODB' as select * from t3; -create table t44 engine='INNODB' as select * from t4; -create table t55 engine='INNODB' as select * from t5; -create table t66 engine='INNODB' as select * from t6; -alter table t11 -partition by range(dayofyear(col1)) -(partition p0 values less than (15), -partition p1 values less than maxvalue); -alter table t22 -partition by list(dayofyear(col1)) -(partition p0 values in (0,1,2,3,4,5,6,7,8,9,10), -partition p1 values in (11,12,13,14,15,16,17,18,19,20), -partition p2 values in (21,22,23,24,25,26,27,28,29,30), -partition p3 values in (31,32,33,34,35,36,37,38,39,40), -partition p4 values in (41,42,43,44,45,46,47,48,49,50), -partition p5 values in (51,52,53,54,55,56,57,58,59,60) -); -alter table t33 -partition by hash(dayofyear(col1)); -alter table t44 -partition by range(colint) -subpartition by hash(dayofyear(col1)) subpartitions 2 -(partition p0 values less than (15), -partition p1 values less than maxvalue); -alter table t55 -partition by list(colint) -subpartition by hash(dayofyear(col1)) subpartitions 2 -(partition p0 values in (1,2,3,4,5,6,7,8,9,10), -partition p1 values in (11,12,13,14,15,16,17,18,19,20), -partition p2 values in (21,22,23,24,25,26,27,28,29,30), -partition p3 values in (31,32,33,34,35,36,37,38,39,40), -partition p4 values in (41,42,43,44,45,46,47,48,49,50), -partition p5 values in (51,52,53,54,55,56,57,58,59,60) -); -alter table t66 -partition by range(colint) -(partition p0 values less than (dayofyear('2006-12-25')), -partition p1 values less than maxvalue); -select * from t11 order by col1; -col1 -2006-01-17 -2006-02-05 -select * from t22 order by col1; -col1 -2006-01-17 -2006-02-05 -2006-02-25 -select * from t33 order by col1; -col1 -2006-01-17 -2006-02-05 -2006-02-25 -select * from t44 order by colint; -colint col1 -1 2006-02-03 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -select * from t55 order by colint; -colint col1 -1 2006-02-03 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -select * from t66 order by colint; -colint col1 -1 2006-02-03 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 ---------------------------- ----- some alter table begin ---------------------------- -alter table t11 -reorganize partition p0,p1 into -(partition s1 values less than maxvalue); -select * from t11 order by col1; -col1 -2006-01-17 -2006-02-05 -alter table t11 -reorganize partition s1 into -(partition p0 values less than (15), -partition p1 values less than maxvalue); -select * from t11 order by col1; -col1 -2006-01-17 -2006-02-05 -alter table t55 -partition by list(colint) -subpartition by hash(dayofyear(col1)) subpartitions 5 -(partition p0 values in (1,2,3,4,5,6,7,8,9,10), -partition p1 values in (11,12,13,14,15,16,17,18,19,20), -partition p2 values in (21,22,23,24,25,26,27,28,29,30), -partition p3 values in (31,32,33,34,35,36,37,38,39,40), -partition p4 values in (41,42,43,44,45,46,47,48,49,50), -partition p5 values in (51,52,53,54,55,56,57,58,59,60) -); -show create table t55; -Table Create Table -t55 CREATE TABLE `t55` ( - `colint` int(11) DEFAULT NULL, - `col1` char(30) DEFAULT NULL -) ENGINE=InnoDB DEFAULT CHARSET=latin1 -/*!50100 PARTITION BY LIST (colint) -SUBPARTITION BY HASH (dayofyear(col1)) -SUBPARTITIONS 5 -(PARTITION p0 VALUES IN (1,2,3,4,5,6,7,8,9,10) ENGINE = InnoDB, - PARTITION p1 VALUES IN (11,12,13,14,15,16,17,18,19,20) ENGINE = InnoDB, - PARTITION p2 VALUES IN (21,22,23,24,25,26,27,28,29,30) ENGINE = InnoDB, - PARTITION p3 VALUES IN (31,32,33,34,35,36,37,38,39,40) ENGINE = InnoDB, - PARTITION p4 VALUES IN (41,42,43,44,45,46,47,48,49,50) ENGINE = InnoDB, - PARTITION p5 VALUES IN (51,52,53,54,55,56,57,58,59,60) ENGINE = InnoDB) */ -select * from t55 order by colint; -colint col1 -1 2006-02-03 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -alter table t66 -reorganize partition p0,p1 into -(partition s1 values less than maxvalue); -select * from t66 order by colint; -colint col1 -1 2006-02-03 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -alter table t66 -reorganize partition s1 into -(partition p0 values less than (dayofyear('2006-12-25')), -partition p1 values less than maxvalue); -select * from t66 order by colint; -colint col1 -1 2006-02-03 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -alter table t66 -reorganize partition p0,p1 into -(partition s1 values less than maxvalue); -select * from t66 order by colint; -colint col1 -1 2006-02-03 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -alter table t66 -reorganize partition s1 into -(partition p0 values less than (dayofyear('2006-12-25')), -partition p1 values less than maxvalue); -select * from t66 order by colint; -colint col1 -1 2006-02-03 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -------------------------------------------------------------------------- ---- Delete rows and partitions of tables with dayofyear(col1) -------------------------------------------------------------------------- -delete from t1 where col1='2006-01-17'; -delete from t2 where col1='2006-01-17'; -delete from t3 where col1='2006-01-17'; -delete from t4 where col1='2006-01-17'; -delete from t5 where col1='2006-01-17'; -delete from t6 where col1='2006-01-17'; -select * from t1 order by col1; -col1 -2006-02-05 -select * from t2 order by col1; -col1 -2006-02-05 -2006-02-25 -select * from t3 order by col1; -col1 -2006-02-05 -2006-02-25 -select * from t4 order by colint; -colint col1 -1 2006-02-03 -3 2006-01-25 -4 2006-02-05 -select * from t5 order by colint; -colint col1 -1 2006-02-03 -3 2006-01-25 -4 2006-02-05 -insert into t1 values ('2006-01-17'); -insert into t2 values ('2006-01-17'); -insert into t3 values ('2006-01-17'); -insert into t4 values (60,'2006-01-17'); -insert into t5 values (60,'2006-01-17'); -insert into t6 values (60,'2006-01-17'); -select * from t1 order by col1; -col1 -2006-01-17 -2006-02-05 -select * from t2 order by col1; -col1 -2006-01-17 -2006-02-05 -2006-02-25 -select * from t3 order by col1; -col1 -2006-01-17 -2006-02-05 -2006-02-25 -select * from t4 order by colint; -colint col1 -1 2006-02-03 -3 2006-01-25 -4 2006-02-05 -60 2006-01-17 -select * from t5 order by colint; -colint col1 -1 2006-02-03 -3 2006-01-25 -4 2006-02-05 -60 2006-01-17 -select * from t6 order by colint; -colint col1 -1 2006-02-03 -3 2006-01-25 -4 2006-02-05 -60 2006-01-17 -alter table t1 drop partition p0; -alter table t2 drop partition p0; -alter table t4 drop partition p0; -alter table t5 drop partition p0; -alter table t6 drop partition p0; -select * from t1 order by col1; -col1 -2006-01-17 -2006-02-05 -select * from t2 order by col1; -col1 -2006-01-17 -2006-02-05 -2006-02-25 -select * from t3 order by col1; -col1 -2006-01-17 -2006-02-05 -2006-02-25 -select * from t4 order by colint; -colint col1 -60 2006-01-17 -select * from t5 order by colint; -colint col1 -60 2006-01-17 -select * from t6 order by colint; -colint col1 -------------------------------------------------------------------------- ---- Delete rows and partitions of tables with dayofyear(col1) -------------------------------------------------------------------------- -delete from t11 where col1='2006-01-17'; -delete from t22 where col1='2006-01-17'; -delete from t33 where col1='2006-01-17'; -delete from t44 where col1='2006-01-17'; -delete from t55 where col1='2006-01-17'; -delete from t66 where col1='2006-01-17'; -select * from t11 order by col1; -col1 -2006-02-05 -select * from t22 order by col1; -col1 -2006-02-05 -2006-02-25 -select * from t33 order by col1; -col1 -2006-02-05 -2006-02-25 -select * from t44 order by colint; -colint col1 -1 2006-02-03 -3 2006-01-25 -4 2006-02-05 -select * from t55 order by colint; -colint col1 -1 2006-02-03 -3 2006-01-25 -4 2006-02-05 -insert into t11 values ('2006-01-17'); -insert into t22 values ('2006-01-17'); -insert into t33 values ('2006-01-17'); -insert into t44 values (60,'2006-01-17'); -insert into t55 values (60,'2006-01-17'); -insert into t66 values (60,'2006-01-17'); -select * from t11 order by col1; -col1 -2006-01-17 -2006-02-05 -select * from t22 order by col1; -col1 -2006-01-17 -2006-02-05 -2006-02-25 -select * from t33 order by col1; -col1 -2006-01-17 -2006-02-05 -2006-02-25 -select * from t44 order by colint; -colint col1 -1 2006-02-03 -3 2006-01-25 -4 2006-02-05 -60 2006-01-17 -select * from t55 order by colint; -colint col1 -1 2006-02-03 -3 2006-01-25 -4 2006-02-05 -60 2006-01-17 -select * from t66 order by colint; -colint col1 -1 2006-02-03 -3 2006-01-25 -4 2006-02-05 -60 2006-01-17 -alter table t11 drop partition p0; -alter table t22 drop partition p0; -alter table t44 drop partition p0; -alter table t55 drop partition p0; -alter table t66 drop partition p0; -select * from t11 order by col1; -col1 -2006-01-17 -2006-02-05 -select * from t22 order by col1; -col1 -2006-01-17 -2006-02-05 -2006-02-25 -select * from t33 order by col1; -col1 -2006-01-17 -2006-02-05 -2006-02-25 -select * from t44 order by colint; -colint col1 -60 2006-01-17 -select * from t55 order by colint; -colint col1 -60 2006-01-17 -select * from t66 order by colint; -colint col1 -------------------------- ----- some alter table end -------------------------- -drop table if exists t1 ; -drop table if exists t2 ; -drop table if exists t3 ; -drop table if exists t4 ; -drop table if exists t5 ; -drop table if exists t6 ; -drop table if exists t11 ; -drop table if exists t22 ; -drop table if exists t33 ; -drop table if exists t44 ; -drop table if exists t55 ; -drop table if exists t66 ; -------------------------------------------------------------------------- --- extract(month from col1) in partition with coltype date ------------------------------------------------------------------------- drop table if exists t1 ; @@ -8489,525 +7982,6 @@ drop table if exists t44 ; drop table if exists t55 ; drop table if exists t66 ; ------------------------------------------------------------------------- ---- second(col1) in partition with coltype char(30) -------------------------------------------------------------------------- -drop table if exists t1 ; -drop table if exists t2 ; -drop table if exists t3 ; -drop table if exists t4 ; -drop table if exists t5 ; -drop table if exists t6 ; -------------------------------------------------------------------------- ---- Create tables with second(col1) -------------------------------------------------------------------------- -create table t1 (col1 char(30)) engine='INNODB' -partition by range(second(col1)) -(partition p0 values less than (15), -partition p1 values less than maxvalue); -create table t2 (col1 char(30)) engine='INNODB' -partition by list(second(col1)) -(partition p0 values in (0,1,2,3,4,5,6,7,8,9,10), -partition p1 values in (11,12,13,14,15,16,17,18,19,20), -partition p2 values in (21,22,23,24,25,26,27,28,29,30), -partition p3 values in (31,32,33,34,35,36,37,38,39,40), -partition p4 values in (41,42,43,44,45,46,47,48,49,50), -partition p5 values in (51,52,53,54,55,56,57,58,59,60) -); -create table t3 (col1 char(30)) engine='INNODB' -partition by hash(second(col1)); -create table t4 (colint int, col1 char(30)) engine='INNODB' -partition by range(colint) -subpartition by hash(second(col1)) subpartitions 2 -(partition p0 values less than (15), -partition p1 values less than maxvalue); -create table t5 (colint int, col1 char(30)) engine='INNODB' -partition by list(colint) -subpartition by hash(second(col1)) subpartitions 2 -(partition p0 values in (1,2,3,4,5,6,7,8,9,10), -partition p1 values in (11,12,13,14,15,16,17,18,19,20), -partition p2 values in (21,22,23,24,25,26,27,28,29,30), -partition p3 values in (31,32,33,34,35,36,37,38,39,40), -partition p4 values in (41,42,43,44,45,46,47,48,49,50), -partition p5 values in (51,52,53,54,55,56,57,58,59,60) -); -create table t6 (colint int, col1 char(30)) engine='INNODB' -partition by range(colint) -(partition p0 values less than (second('18:30:14')), -partition p1 values less than maxvalue); -------------------------------------------------------------------------- ---- Access tables with second(col1) -------------------------------------------------------------------------- -insert into t1 values ('09:09:09'); -insert into t1 values ('14:30:20'); -insert into t2 values ('09:09:09'); -insert into t2 values ('14:30:20'); -insert into t2 values ('21:59:22'); -insert into t3 values ('09:09:09'); -insert into t3 values ('14:30:20'); -insert into t3 values ('21:59:22'); -load data infile 'MYSQLTEST_VARDIR/std_data/parts/part_supported_sql_funcs_int_time.inc' into table t4; -load data infile 'MYSQLTEST_VARDIR/std_data/parts/part_supported_sql_funcs_int_time.inc' into table t5; -load data infile 'MYSQLTEST_VARDIR/std_data/parts/part_supported_sql_funcs_int_time.inc' into table t6; -select second(col1) from t1 order by col1; -second(col1) -9 -20 -select * from t1 order by col1; -col1 -09:09:09 -14:30:20 -select * from t2 order by col1; -col1 -09:09:09 -14:30:20 -21:59:22 -select * from t3 order by col1; -col1 -09:09:09 -14:30:20 -21:59:22 -select * from t4 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 -select * from t5 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 -select * from t6 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 -update t1 set col1='10:22:33' where col1='09:09:09'; -update t2 set col1='10:22:33' where col1='09:09:09'; -update t3 set col1='10:22:33' where col1='09:09:09'; -update t4 set col1='10:22:33' where col1='09:09:09'; -update t5 set col1='10:22:33' where col1='09:09:09'; -update t6 set col1='10:22:33' where col1='09:09:09'; -select * from t1 order by col1; -col1 -10:22:33 -14:30:20 -select * from t2 order by col1; -col1 -10:22:33 -14:30:20 -21:59:22 -select * from t3 order by col1; -col1 -10:22:33 -14:30:20 -21:59:22 -select * from t4 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 -select * from t5 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 -select * from t6 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 -------------------------------------------------------------------------- ---- Alter tables with second(col1) -------------------------------------------------------------------------- -drop table if exists t11 ; -drop table if exists t22 ; -drop table if exists t33 ; -drop table if exists t44 ; -drop table if exists t55 ; -drop table if exists t66 ; -create table t11 engine='INNODB' as select * from t1; -create table t22 engine='INNODB' as select * from t2; -create table t33 engine='INNODB' as select * from t3; -create table t44 engine='INNODB' as select * from t4; -create table t55 engine='INNODB' as select * from t5; -create table t66 engine='INNODB' as select * from t6; -alter table t11 -partition by range(second(col1)) -(partition p0 values less than (15), -partition p1 values less than maxvalue); -alter table t22 -partition by list(second(col1)) -(partition p0 values in (0,1,2,3,4,5,6,7,8,9,10), -partition p1 values in (11,12,13,14,15,16,17,18,19,20), -partition p2 values in (21,22,23,24,25,26,27,28,29,30), -partition p3 values in (31,32,33,34,35,36,37,38,39,40), -partition p4 values in (41,42,43,44,45,46,47,48,49,50), -partition p5 values in (51,52,53,54,55,56,57,58,59,60) -); -alter table t33 -partition by hash(second(col1)); -alter table t44 -partition by range(colint) -subpartition by hash(second(col1)) subpartitions 2 -(partition p0 values less than (15), -partition p1 values less than maxvalue); -alter table t55 -partition by list(colint) -subpartition by hash(second(col1)) subpartitions 2 -(partition p0 values in (1,2,3,4,5,6,7,8,9,10), -partition p1 values in (11,12,13,14,15,16,17,18,19,20), -partition p2 values in (21,22,23,24,25,26,27,28,29,30), -partition p3 values in (31,32,33,34,35,36,37,38,39,40), -partition p4 values in (41,42,43,44,45,46,47,48,49,50), -partition p5 values in (51,52,53,54,55,56,57,58,59,60) -); -alter table t66 -partition by range(colint) -(partition p0 values less than (second('18:30:14')), -partition p1 values less than maxvalue); -select * from t11 order by col1; -col1 -10:22:33 -14:30:20 -select * from t22 order by col1; -col1 -10:22:33 -14:30:20 -21:59:22 -select * from t33 order by col1; -col1 -10:22:33 -14:30:20 -21:59:22 -select * from t44 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 -select * from t55 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 -select * from t66 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 ---------------------------- ----- some alter table begin ---------------------------- -alter table t11 -reorganize partition p0,p1 into -(partition s1 values less than maxvalue); -select * from t11 order by col1; -col1 -10:22:33 -14:30:20 -alter table t11 -reorganize partition s1 into -(partition p0 values less than (15), -partition p1 values less than maxvalue); -select * from t11 order by col1; -col1 -10:22:33 -14:30:20 -alter table t55 -partition by list(colint) -subpartition by hash(second(col1)) subpartitions 5 -(partition p0 values in (1,2,3,4,5,6,7,8,9,10), -partition p1 values in (11,12,13,14,15,16,17,18,19,20), -partition p2 values in (21,22,23,24,25,26,27,28,29,30), -partition p3 values in (31,32,33,34,35,36,37,38,39,40), -partition p4 values in (41,42,43,44,45,46,47,48,49,50), -partition p5 values in (51,52,53,54,55,56,57,58,59,60) -); -show create table t55; -Table Create Table -t55 CREATE TABLE `t55` ( - `colint` int(11) DEFAULT NULL, - `col1` char(30) DEFAULT NULL -) ENGINE=InnoDB DEFAULT CHARSET=latin1 -/*!50100 PARTITION BY LIST (colint) -SUBPARTITION BY HASH (second(col1)) -SUBPARTITIONS 5 -(PARTITION p0 VALUES IN (1,2,3,4,5,6,7,8,9,10) ENGINE = InnoDB, - PARTITION p1 VALUES IN (11,12,13,14,15,16,17,18,19,20) ENGINE = InnoDB, - PARTITION p2 VALUES IN (21,22,23,24,25,26,27,28,29,30) ENGINE = InnoDB, - PARTITION p3 VALUES IN (31,32,33,34,35,36,37,38,39,40) ENGINE = InnoDB, - PARTITION p4 VALUES IN (41,42,43,44,45,46,47,48,49,50) ENGINE = InnoDB, - PARTITION p5 VALUES IN (51,52,53,54,55,56,57,58,59,60) ENGINE = InnoDB) */ -select * from t55 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 -alter table t66 -reorganize partition p0,p1 into -(partition s1 values less than maxvalue); -select * from t66 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 -alter table t66 -reorganize partition s1 into -(partition p0 values less than (second('18:30:14')), -partition p1 values less than maxvalue); -select * from t66 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 -alter table t66 -reorganize partition p0,p1 into -(partition s1 values less than maxvalue); -select * from t66 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 -alter table t66 -reorganize partition s1 into -(partition p0 values less than (second('18:30:14')), -partition p1 values less than maxvalue); -select * from t66 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 -------------------------------------------------------------------------- ---- Delete rows and partitions of tables with second(col1) -------------------------------------------------------------------------- -delete from t1 where col1='14:30:20'; -delete from t2 where col1='14:30:20'; -delete from t3 where col1='14:30:20'; -delete from t4 where col1='14:30:20'; -delete from t5 where col1='14:30:20'; -delete from t6 where col1='14:30:20'; -select * from t1 order by col1; -col1 -10:22:33 -select * from t2 order by col1; -col1 -10:22:33 -21:59:22 -select * from t3 order by col1; -col1 -10:22:33 -21:59:22 -select * from t4 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 -select * from t5 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 -insert into t1 values ('14:30:20'); -insert into t2 values ('14:30:20'); -insert into t3 values ('14:30:20'); -insert into t4 values (60,'14:30:20'); -insert into t5 values (60,'14:30:20'); -insert into t6 values (60,'14:30:20'); -select * from t1 order by col1; -col1 -10:22:33 -14:30:20 -select * from t2 order by col1; -col1 -10:22:33 -14:30:20 -21:59:22 -select * from t3 order by col1; -col1 -10:22:33 -14:30:20 -21:59:22 -select * from t4 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 -60 14:30:20 -select * from t5 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 -60 14:30:20 -select * from t6 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 -60 14:30:20 -alter table t1 drop partition p0; -alter table t2 drop partition p0; -alter table t4 drop partition p0; -alter table t5 drop partition p0; -alter table t6 drop partition p0; -select * from t1 order by col1; -col1 -10:22:33 -14:30:20 -select * from t2 order by col1; -col1 -10:22:33 -14:30:20 -21:59:22 -select * from t3 order by col1; -col1 -10:22:33 -14:30:20 -21:59:22 -select * from t4 order by colint; -colint col1 -60 14:30:20 -select * from t5 order by colint; -colint col1 -60 14:30:20 -select * from t6 order by colint; -colint col1 -60 14:30:20 -------------------------------------------------------------------------- ---- Delete rows and partitions of tables with second(col1) -------------------------------------------------------------------------- -delete from t11 where col1='14:30:20'; -delete from t22 where col1='14:30:20'; -delete from t33 where col1='14:30:20'; -delete from t44 where col1='14:30:20'; -delete from t55 where col1='14:30:20'; -delete from t66 where col1='14:30:20'; -select * from t11 order by col1; -col1 -10:22:33 -select * from t22 order by col1; -col1 -10:22:33 -21:59:22 -select * from t33 order by col1; -col1 -10:22:33 -21:59:22 -select * from t44 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 -select * from t55 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 -insert into t11 values ('14:30:20'); -insert into t22 values ('14:30:20'); -insert into t33 values ('14:30:20'); -insert into t44 values (60,'14:30:20'); -insert into t55 values (60,'14:30:20'); -insert into t66 values (60,'14:30:20'); -select * from t11 order by col1; -col1 -10:22:33 -14:30:20 -select * from t22 order by col1; -col1 -10:22:33 -14:30:20 -21:59:22 -select * from t33 order by col1; -col1 -10:22:33 -14:30:20 -21:59:22 -select * from t44 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 -60 14:30:20 -select * from t55 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 -60 14:30:20 -select * from t66 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 -60 14:30:20 -alter table t11 drop partition p0; -alter table t22 drop partition p0; -alter table t44 drop partition p0; -alter table t55 drop partition p0; -alter table t66 drop partition p0; -select * from t11 order by col1; -col1 -10:22:33 -14:30:20 -select * from t22 order by col1; -col1 -10:22:33 -14:30:20 -21:59:22 -select * from t33 order by col1; -col1 -10:22:33 -14:30:20 -21:59:22 -select * from t44 order by colint; -colint col1 -60 14:30:20 -select * from t55 order by colint; -colint col1 -60 14:30:20 -select * from t66 order by colint; -colint col1 -60 14:30:20 -------------------------- ----- some alter table end -------------------------- -drop table if exists t1 ; -drop table if exists t2 ; -drop table if exists t3 ; -drop table if exists t4 ; -drop table if exists t5 ; -drop table if exists t6 ; -drop table if exists t11 ; -drop table if exists t22 ; -drop table if exists t33 ; -drop table if exists t44 ; -drop table if exists t55 ; -drop table if exists t66 ; -------------------------------------------------------------------------- --- month(col1) in partition with coltype date ------------------------------------------------------------------------- drop table if exists t1 ; @@ -10549,1024 +9523,6 @@ drop table if exists t44 ; drop table if exists t55 ; drop table if exists t66 ; ------------------------------------------------------------------------- ---- to_days(col1)-to_days('2006-01-01') in partition with coltype date -------------------------------------------------------------------------- -drop table if exists t1 ; -drop table if exists t2 ; -drop table if exists t3 ; -drop table if exists t4 ; -drop table if exists t5 ; -drop table if exists t6 ; -------------------------------------------------------------------------- ---- Create tables with to_days(col1)-to_days('2006-01-01') -------------------------------------------------------------------------- -create table t1 (col1 date) engine='INNODB' -partition by range(to_days(col1)-to_days('2006-01-01')) -(partition p0 values less than (15), -partition p1 values less than maxvalue); -create table t2 (col1 date) engine='INNODB' -partition by list(to_days(col1)-to_days('2006-01-01')) -(partition p0 values in (0,1,2,3,4,5,6,7,8,9,10), -partition p1 values in (11,12,13,14,15,16,17,18,19,20), -partition p2 values in (21,22,23,24,25,26,27,28,29,30), -partition p3 values in (31,32,33,34,35,36,37,38,39,40), -partition p4 values in (41,42,43,44,45,46,47,48,49,50), -partition p5 values in (51,52,53,54,55,56,57,58,59,60) -); -create table t3 (col1 date) engine='INNODB' -partition by hash(to_days(col1)-to_days('2006-01-01')); -create table t4 (colint int, col1 date) engine='INNODB' -partition by range(colint) -subpartition by hash(to_days(col1)-to_days('2006-01-01')) subpartitions 2 -(partition p0 values less than (15), -partition p1 values less than maxvalue); -create table t5 (colint int, col1 date) engine='INNODB' -partition by list(colint) -subpartition by hash(to_days(col1)-to_days('2006-01-01')) subpartitions 2 -(partition p0 values in (1,2,3,4,5,6,7,8,9,10), -partition p1 values in (11,12,13,14,15,16,17,18,19,20), -partition p2 values in (21,22,23,24,25,26,27,28,29,30), -partition p3 values in (31,32,33,34,35,36,37,38,39,40), -partition p4 values in (41,42,43,44,45,46,47,48,49,50), -partition p5 values in (51,52,53,54,55,56,57,58,59,60) -); -create table t6 (colint int, col1 date) engine='INNODB' -partition by range(colint) -(partition p0 values less than (to_days('2006-02-02')-to_days('2006-01-01')), -partition p1 values less than maxvalue); -------------------------------------------------------------------------- ---- Access tables with to_days(col1)-to_days('2006-01-01') -------------------------------------------------------------------------- -insert into t1 values ('2006-02-03'); -insert into t1 values ('2006-01-17'); -insert into t2 values ('2006-02-03'); -insert into t2 values ('2006-01-17'); -insert into t2 values ('2006-01-25'); -insert into t3 values ('2006-02-03'); -insert into t3 values ('2006-01-17'); -insert into t3 values ('2006-01-25'); -load data infile 'MYSQLTEST_VARDIR/std_data/parts/part_supported_sql_funcs_int_date.inc' into table t4; -load data infile 'MYSQLTEST_VARDIR/std_data/parts/part_supported_sql_funcs_int_date.inc' into table t5; -load data infile 'MYSQLTEST_VARDIR/std_data/parts/part_supported_sql_funcs_int_date.inc' into table t6; -select to_days(col1)-to_days('2006-01-01') from t1 order by col1; -to_days(col1)-to_days('2006-01-01') -16 -33 -select * from t1 order by col1; -col1 -2006-01-17 -2006-02-03 -select * from t2 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-03 -select * from t3 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-03 -select * from t4 order by colint; -colint col1 -1 2006-02-03 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -select * from t5 order by colint; -colint col1 -1 2006-02-03 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -select * from t6 order by colint; -colint col1 -1 2006-02-03 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -update t1 set col1='2006-02-06' where col1='2006-02-03'; -update t2 set col1='2006-02-06' where col1='2006-02-03'; -update t3 set col1='2006-02-06' where col1='2006-02-03'; -update t4 set col1='2006-02-06' where col1='2006-02-03'; -update t5 set col1='2006-02-06' where col1='2006-02-03'; -update t6 set col1='2006-02-06' where col1='2006-02-03'; -select * from t1 order by col1; -col1 -2006-01-17 -2006-02-06 -select * from t2 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t3 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t4 order by colint; -colint col1 -1 2006-02-06 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -select * from t5 order by colint; -colint col1 -1 2006-02-06 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -select * from t6 order by colint; -colint col1 -1 2006-02-06 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -------------------------------------------------------------------------- ---- Alter tables with to_days(col1)-to_days('2006-01-01') -------------------------------------------------------------------------- -drop table if exists t11 ; -drop table if exists t22 ; -drop table if exists t33 ; -drop table if exists t44 ; -drop table if exists t55 ; -drop table if exists t66 ; -create table t11 engine='INNODB' as select * from t1; -create table t22 engine='INNODB' as select * from t2; -create table t33 engine='INNODB' as select * from t3; -create table t44 engine='INNODB' as select * from t4; -create table t55 engine='INNODB' as select * from t5; -create table t66 engine='INNODB' as select * from t6; -alter table t11 -partition by range(to_days(col1)-to_days('2006-01-01')) -(partition p0 values less than (15), -partition p1 values less than maxvalue); -alter table t22 -partition by list(to_days(col1)-to_days('2006-01-01')) -(partition p0 values in (0,1,2,3,4,5,6,7,8,9,10), -partition p1 values in (11,12,13,14,15,16,17,18,19,20), -partition p2 values in (21,22,23,24,25,26,27,28,29,30), -partition p3 values in (31,32,33,34,35,36,37,38,39,40), -partition p4 values in (41,42,43,44,45,46,47,48,49,50), -partition p5 values in (51,52,53,54,55,56,57,58,59,60) -); -alter table t33 -partition by hash(to_days(col1)-to_days('2006-01-01')); -alter table t44 -partition by range(colint) -subpartition by hash(to_days(col1)-to_days('2006-01-01')) subpartitions 2 -(partition p0 values less than (15), -partition p1 values less than maxvalue); -alter table t55 -partition by list(colint) -subpartition by hash(to_days(col1)-to_days('2006-01-01')) subpartitions 2 -(partition p0 values in (1,2,3,4,5,6,7,8,9,10), -partition p1 values in (11,12,13,14,15,16,17,18,19,20), -partition p2 values in (21,22,23,24,25,26,27,28,29,30), -partition p3 values in (31,32,33,34,35,36,37,38,39,40), -partition p4 values in (41,42,43,44,45,46,47,48,49,50), -partition p5 values in (51,52,53,54,55,56,57,58,59,60) -); -alter table t66 -partition by range(colint) -(partition p0 values less than (to_days('2006-02-02')-to_days('2006-01-01')), -partition p1 values less than maxvalue); -select * from t11 order by col1; -col1 -2006-01-17 -2006-02-06 -select * from t22 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t33 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t44 order by colint; -colint col1 -1 2006-02-06 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -select * from t55 order by colint; -colint col1 -1 2006-02-06 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -select * from t66 order by colint; -colint col1 -1 2006-02-06 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 ---------------------------- ----- some alter table begin ---------------------------- -alter table t11 -reorganize partition p0,p1 into -(partition s1 values less than maxvalue); -select * from t11 order by col1; -col1 -2006-01-17 -2006-02-06 -alter table t11 -reorganize partition s1 into -(partition p0 values less than (15), -partition p1 values less than maxvalue); -select * from t11 order by col1; -col1 -2006-01-17 -2006-02-06 -alter table t55 -partition by list(colint) -subpartition by hash(to_days(col1)-to_days('2006-01-01')) subpartitions 5 -(partition p0 values in (1,2,3,4,5,6,7,8,9,10), -partition p1 values in (11,12,13,14,15,16,17,18,19,20), -partition p2 values in (21,22,23,24,25,26,27,28,29,30), -partition p3 values in (31,32,33,34,35,36,37,38,39,40), -partition p4 values in (41,42,43,44,45,46,47,48,49,50), -partition p5 values in (51,52,53,54,55,56,57,58,59,60) -); -show create table t55; -Table Create Table -t55 CREATE TABLE `t55` ( - `colint` int(11) DEFAULT NULL, - `col1` date DEFAULT NULL -) ENGINE=InnoDB DEFAULT CHARSET=latin1 -/*!50100 PARTITION BY LIST (colint) -SUBPARTITION BY HASH (to_days(col1)-to_days('2006-01-01')) -SUBPARTITIONS 5 -(PARTITION p0 VALUES IN (1,2,3,4,5,6,7,8,9,10) ENGINE = InnoDB, - PARTITION p1 VALUES IN (11,12,13,14,15,16,17,18,19,20) ENGINE = InnoDB, - PARTITION p2 VALUES IN (21,22,23,24,25,26,27,28,29,30) ENGINE = InnoDB, - PARTITION p3 VALUES IN (31,32,33,34,35,36,37,38,39,40) ENGINE = InnoDB, - PARTITION p4 VALUES IN (41,42,43,44,45,46,47,48,49,50) ENGINE = InnoDB, - PARTITION p5 VALUES IN (51,52,53,54,55,56,57,58,59,60) ENGINE = InnoDB) */ -select * from t55 order by colint; -colint col1 -1 2006-02-06 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -alter table t66 -reorganize partition p0,p1 into -(partition s1 values less than maxvalue); -select * from t66 order by colint; -colint col1 -1 2006-02-06 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -alter table t66 -reorganize partition s1 into -(partition p0 values less than (to_days('2006-02-02')-to_days('2006-01-01')), -partition p1 values less than maxvalue); -select * from t66 order by colint; -colint col1 -1 2006-02-06 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -alter table t66 -reorganize partition p0,p1 into -(partition s1 values less than maxvalue); -select * from t66 order by colint; -colint col1 -1 2006-02-06 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -alter table t66 -reorganize partition s1 into -(partition p0 values less than (to_days('2006-02-02')-to_days('2006-01-01')), -partition p1 values less than maxvalue); -select * from t66 order by colint; -colint col1 -1 2006-02-06 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -------------------------------------------------------------------------- ---- Delete rows and partitions of tables with to_days(col1)-to_days('2006-01-01') -------------------------------------------------------------------------- -delete from t1 where col1='2006-01-17'; -delete from t2 where col1='2006-01-17'; -delete from t3 where col1='2006-01-17'; -delete from t4 where col1='2006-01-17'; -delete from t5 where col1='2006-01-17'; -delete from t6 where col1='2006-01-17'; -select * from t1 order by col1; -col1 -2006-02-06 -select * from t2 order by col1; -col1 -2006-01-25 -2006-02-06 -select * from t3 order by col1; -col1 -2006-01-25 -2006-02-06 -select * from t4 order by colint; -colint col1 -1 2006-02-06 -3 2006-01-25 -4 2006-02-05 -select * from t5 order by colint; -colint col1 -1 2006-02-06 -3 2006-01-25 -4 2006-02-05 -insert into t1 values ('2006-01-17'); -insert into t2 values ('2006-01-17'); -insert into t3 values ('2006-01-17'); -insert into t4 values (60,'2006-01-17'); -insert into t5 values (60,'2006-01-17'); -insert into t6 values (60,'2006-01-17'); -select * from t1 order by col1; -col1 -2006-01-17 -2006-02-06 -select * from t2 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t3 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t4 order by colint; -colint col1 -1 2006-02-06 -3 2006-01-25 -4 2006-02-05 -60 2006-01-17 -select * from t5 order by colint; -colint col1 -1 2006-02-06 -3 2006-01-25 -4 2006-02-05 -60 2006-01-17 -select * from t6 order by colint; -colint col1 -1 2006-02-06 -3 2006-01-25 -4 2006-02-05 -60 2006-01-17 -alter table t1 drop partition p0; -alter table t2 drop partition p0; -alter table t4 drop partition p0; -alter table t5 drop partition p0; -alter table t6 drop partition p0; -select * from t1 order by col1; -col1 -2006-01-17 -2006-02-06 -select * from t2 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t3 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t4 order by colint; -colint col1 -60 2006-01-17 -select * from t5 order by colint; -colint col1 -60 2006-01-17 -select * from t6 order by colint; -colint col1 -60 2006-01-17 -------------------------------------------------------------------------- ---- Delete rows and partitions of tables with to_days(col1)-to_days('2006-01-01') -------------------------------------------------------------------------- -delete from t11 where col1='2006-01-17'; -delete from t22 where col1='2006-01-17'; -delete from t33 where col1='2006-01-17'; -delete from t44 where col1='2006-01-17'; -delete from t55 where col1='2006-01-17'; -delete from t66 where col1='2006-01-17'; -select * from t11 order by col1; -col1 -2006-02-06 -select * from t22 order by col1; -col1 -2006-01-25 -2006-02-06 -select * from t33 order by col1; -col1 -2006-01-25 -2006-02-06 -select * from t44 order by colint; -colint col1 -1 2006-02-06 -3 2006-01-25 -4 2006-02-05 -select * from t55 order by colint; -colint col1 -1 2006-02-06 -3 2006-01-25 -4 2006-02-05 -insert into t11 values ('2006-01-17'); -insert into t22 values ('2006-01-17'); -insert into t33 values ('2006-01-17'); -insert into t44 values (60,'2006-01-17'); -insert into t55 values (60,'2006-01-17'); -insert into t66 values (60,'2006-01-17'); -select * from t11 order by col1; -col1 -2006-01-17 -2006-02-06 -select * from t22 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t33 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t44 order by colint; -colint col1 -1 2006-02-06 -3 2006-01-25 -4 2006-02-05 -60 2006-01-17 -select * from t55 order by colint; -colint col1 -1 2006-02-06 -3 2006-01-25 -4 2006-02-05 -60 2006-01-17 -select * from t66 order by colint; -colint col1 -1 2006-02-06 -3 2006-01-25 -4 2006-02-05 -60 2006-01-17 -alter table t11 drop partition p0; -alter table t22 drop partition p0; -alter table t44 drop partition p0; -alter table t55 drop partition p0; -alter table t66 drop partition p0; -select * from t11 order by col1; -col1 -2006-01-17 -2006-02-06 -select * from t22 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t33 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t44 order by colint; -colint col1 -60 2006-01-17 -select * from t55 order by colint; -colint col1 -60 2006-01-17 -select * from t66 order by colint; -colint col1 -60 2006-01-17 -------------------------- ----- some alter table end -------------------------- -drop table if exists t1 ; -drop table if exists t2 ; -drop table if exists t3 ; -drop table if exists t4 ; -drop table if exists t5 ; -drop table if exists t6 ; -drop table if exists t11 ; -drop table if exists t22 ; -drop table if exists t33 ; -drop table if exists t44 ; -drop table if exists t55 ; -drop table if exists t66 ; -------------------------------------------------------------------------- ---- datediff(col1, '2006-01-01') in partition with coltype date -------------------------------------------------------------------------- -drop table if exists t1 ; -drop table if exists t2 ; -drop table if exists t3 ; -drop table if exists t4 ; -drop table if exists t5 ; -drop table if exists t6 ; -------------------------------------------------------------------------- ---- Create tables with datediff(col1, '2006-01-01') -------------------------------------------------------------------------- -create table t1 (col1 date) engine='INNODB' -partition by range(datediff(col1, '2006-01-01')) -(partition p0 values less than (15), -partition p1 values less than maxvalue); -create table t2 (col1 date) engine='INNODB' -partition by list(datediff(col1, '2006-01-01')) -(partition p0 values in (0,1,2,3,4,5,6,7,8,9,10), -partition p1 values in (11,12,13,14,15,16,17,18,19,20), -partition p2 values in (21,22,23,24,25,26,27,28,29,30), -partition p3 values in (31,32,33,34,35,36,37,38,39,40), -partition p4 values in (41,42,43,44,45,46,47,48,49,50), -partition p5 values in (51,52,53,54,55,56,57,58,59,60) -); -create table t3 (col1 date) engine='INNODB' -partition by hash(datediff(col1, '2006-01-01')); -create table t4 (colint int, col1 date) engine='INNODB' -partition by range(colint) -subpartition by hash(datediff(col1, '2006-01-01')) subpartitions 2 -(partition p0 values less than (15), -partition p1 values less than maxvalue); -create table t5 (colint int, col1 date) engine='INNODB' -partition by list(colint) -subpartition by hash(datediff(col1, '2006-01-01')) subpartitions 2 -(partition p0 values in (1,2,3,4,5,6,7,8,9,10), -partition p1 values in (11,12,13,14,15,16,17,18,19,20), -partition p2 values in (21,22,23,24,25,26,27,28,29,30), -partition p3 values in (31,32,33,34,35,36,37,38,39,40), -partition p4 values in (41,42,43,44,45,46,47,48,49,50), -partition p5 values in (51,52,53,54,55,56,57,58,59,60) -); -create table t6 (colint int, col1 date) engine='INNODB' -partition by range(colint) -(partition p0 values less than (datediff('2006-02-02', '2006-01-01')), -partition p1 values less than maxvalue); -------------------------------------------------------------------------- ---- Access tables with datediff(col1, '2006-01-01') -------------------------------------------------------------------------- -insert into t1 values ('2006-02-03'); -insert into t1 values ('2006-01-17'); -insert into t2 values ('2006-02-03'); -insert into t2 values ('2006-01-17'); -insert into t2 values ('2006-01-25'); -insert into t3 values ('2006-02-03'); -insert into t3 values ('2006-01-17'); -insert into t3 values ('2006-01-25'); -load data infile 'MYSQLTEST_VARDIR/std_data/parts/part_supported_sql_funcs_int_date.inc' into table t4; -load data infile 'MYSQLTEST_VARDIR/std_data/parts/part_supported_sql_funcs_int_date.inc' into table t5; -load data infile 'MYSQLTEST_VARDIR/std_data/parts/part_supported_sql_funcs_int_date.inc' into table t6; -select datediff(col1, '2006-01-01') from t1 order by col1; -datediff(col1, '2006-01-01') -16 -33 -select * from t1 order by col1; -col1 -2006-01-17 -2006-02-03 -select * from t2 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-03 -select * from t3 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-03 -select * from t4 order by colint; -colint col1 -1 2006-02-03 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -select * from t5 order by colint; -colint col1 -1 2006-02-03 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -select * from t6 order by colint; -colint col1 -1 2006-02-03 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -update t1 set col1='2006-02-06' where col1='2006-02-03'; -update t2 set col1='2006-02-06' where col1='2006-02-03'; -update t3 set col1='2006-02-06' where col1='2006-02-03'; -update t4 set col1='2006-02-06' where col1='2006-02-03'; -update t5 set col1='2006-02-06' where col1='2006-02-03'; -update t6 set col1='2006-02-06' where col1='2006-02-03'; -select * from t1 order by col1; -col1 -2006-01-17 -2006-02-06 -select * from t2 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t3 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t4 order by colint; -colint col1 -1 2006-02-06 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -select * from t5 order by colint; -colint col1 -1 2006-02-06 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -select * from t6 order by colint; -colint col1 -1 2006-02-06 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -------------------------------------------------------------------------- ---- Alter tables with datediff(col1, '2006-01-01') -------------------------------------------------------------------------- -drop table if exists t11 ; -drop table if exists t22 ; -drop table if exists t33 ; -drop table if exists t44 ; -drop table if exists t55 ; -drop table if exists t66 ; -create table t11 engine='INNODB' as select * from t1; -create table t22 engine='INNODB' as select * from t2; -create table t33 engine='INNODB' as select * from t3; -create table t44 engine='INNODB' as select * from t4; -create table t55 engine='INNODB' as select * from t5; -create table t66 engine='INNODB' as select * from t6; -alter table t11 -partition by range(datediff(col1, '2006-01-01')) -(partition p0 values less than (15), -partition p1 values less than maxvalue); -alter table t22 -partition by list(datediff(col1, '2006-01-01')) -(partition p0 values in (0,1,2,3,4,5,6,7,8,9,10), -partition p1 values in (11,12,13,14,15,16,17,18,19,20), -partition p2 values in (21,22,23,24,25,26,27,28,29,30), -partition p3 values in (31,32,33,34,35,36,37,38,39,40), -partition p4 values in (41,42,43,44,45,46,47,48,49,50), -partition p5 values in (51,52,53,54,55,56,57,58,59,60) -); -alter table t33 -partition by hash(datediff(col1, '2006-01-01')); -alter table t44 -partition by range(colint) -subpartition by hash(datediff(col1, '2006-01-01')) subpartitions 2 -(partition p0 values less than (15), -partition p1 values less than maxvalue); -alter table t55 -partition by list(colint) -subpartition by hash(datediff(col1, '2006-01-01')) subpartitions 2 -(partition p0 values in (1,2,3,4,5,6,7,8,9,10), -partition p1 values in (11,12,13,14,15,16,17,18,19,20), -partition p2 values in (21,22,23,24,25,26,27,28,29,30), -partition p3 values in (31,32,33,34,35,36,37,38,39,40), -partition p4 values in (41,42,43,44,45,46,47,48,49,50), -partition p5 values in (51,52,53,54,55,56,57,58,59,60) -); -alter table t66 -partition by range(colint) -(partition p0 values less than (datediff('2006-02-02', '2006-01-01')), -partition p1 values less than maxvalue); -select * from t11 order by col1; -col1 -2006-01-17 -2006-02-06 -select * from t22 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t33 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t44 order by colint; -colint col1 -1 2006-02-06 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -select * from t55 order by colint; -colint col1 -1 2006-02-06 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -select * from t66 order by colint; -colint col1 -1 2006-02-06 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 ---------------------------- ----- some alter table begin ---------------------------- -alter table t11 -reorganize partition p0,p1 into -(partition s1 values less than maxvalue); -select * from t11 order by col1; -col1 -2006-01-17 -2006-02-06 -alter table t11 -reorganize partition s1 into -(partition p0 values less than (15), -partition p1 values less than maxvalue); -select * from t11 order by col1; -col1 -2006-01-17 -2006-02-06 -alter table t55 -partition by list(colint) -subpartition by hash(datediff(col1, '2006-01-01')) subpartitions 5 -(partition p0 values in (1,2,3,4,5,6,7,8,9,10), -partition p1 values in (11,12,13,14,15,16,17,18,19,20), -partition p2 values in (21,22,23,24,25,26,27,28,29,30), -partition p3 values in (31,32,33,34,35,36,37,38,39,40), -partition p4 values in (41,42,43,44,45,46,47,48,49,50), -partition p5 values in (51,52,53,54,55,56,57,58,59,60) -); -show create table t55; -Table Create Table -t55 CREATE TABLE `t55` ( - `colint` int(11) DEFAULT NULL, - `col1` date DEFAULT NULL -) ENGINE=InnoDB DEFAULT CHARSET=latin1 -/*!50100 PARTITION BY LIST (colint) -SUBPARTITION BY HASH (datediff(col1, '2006-01-01')) -SUBPARTITIONS 5 -(PARTITION p0 VALUES IN (1,2,3,4,5,6,7,8,9,10) ENGINE = InnoDB, - PARTITION p1 VALUES IN (11,12,13,14,15,16,17,18,19,20) ENGINE = InnoDB, - PARTITION p2 VALUES IN (21,22,23,24,25,26,27,28,29,30) ENGINE = InnoDB, - PARTITION p3 VALUES IN (31,32,33,34,35,36,37,38,39,40) ENGINE = InnoDB, - PARTITION p4 VALUES IN (41,42,43,44,45,46,47,48,49,50) ENGINE = InnoDB, - PARTITION p5 VALUES IN (51,52,53,54,55,56,57,58,59,60) ENGINE = InnoDB) */ -select * from t55 order by colint; -colint col1 -1 2006-02-06 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -alter table t66 -reorganize partition p0,p1 into -(partition s1 values less than maxvalue); -select * from t66 order by colint; -colint col1 -1 2006-02-06 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -alter table t66 -reorganize partition s1 into -(partition p0 values less than (datediff('2006-02-02', '2006-01-01')), -partition p1 values less than maxvalue); -select * from t66 order by colint; -colint col1 -1 2006-02-06 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -alter table t66 -reorganize partition p0,p1 into -(partition s1 values less than maxvalue); -select * from t66 order by colint; -colint col1 -1 2006-02-06 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -alter table t66 -reorganize partition s1 into -(partition p0 values less than (datediff('2006-02-02', '2006-01-01')), -partition p1 values less than maxvalue); -select * from t66 order by colint; -colint col1 -1 2006-02-06 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -------------------------------------------------------------------------- ---- Delete rows and partitions of tables with datediff(col1, '2006-01-01') -------------------------------------------------------------------------- -delete from t1 where col1='2006-01-17'; -delete from t2 where col1='2006-01-17'; -delete from t3 where col1='2006-01-17'; -delete from t4 where col1='2006-01-17'; -delete from t5 where col1='2006-01-17'; -delete from t6 where col1='2006-01-17'; -select * from t1 order by col1; -col1 -2006-02-06 -select * from t2 order by col1; -col1 -2006-01-25 -2006-02-06 -select * from t3 order by col1; -col1 -2006-01-25 -2006-02-06 -select * from t4 order by colint; -colint col1 -1 2006-02-06 -3 2006-01-25 -4 2006-02-05 -select * from t5 order by colint; -colint col1 -1 2006-02-06 -3 2006-01-25 -4 2006-02-05 -insert into t1 values ('2006-01-17'); -insert into t2 values ('2006-01-17'); -insert into t3 values ('2006-01-17'); -insert into t4 values (60,'2006-01-17'); -insert into t5 values (60,'2006-01-17'); -insert into t6 values (60,'2006-01-17'); -select * from t1 order by col1; -col1 -2006-01-17 -2006-02-06 -select * from t2 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t3 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t4 order by colint; -colint col1 -1 2006-02-06 -3 2006-01-25 -4 2006-02-05 -60 2006-01-17 -select * from t5 order by colint; -colint col1 -1 2006-02-06 -3 2006-01-25 -4 2006-02-05 -60 2006-01-17 -select * from t6 order by colint; -colint col1 -1 2006-02-06 -3 2006-01-25 -4 2006-02-05 -60 2006-01-17 -alter table t1 drop partition p0; -alter table t2 drop partition p0; -alter table t4 drop partition p0; -alter table t5 drop partition p0; -alter table t6 drop partition p0; -select * from t1 order by col1; -col1 -2006-01-17 -2006-02-06 -select * from t2 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t3 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t4 order by colint; -colint col1 -60 2006-01-17 -select * from t5 order by colint; -colint col1 -60 2006-01-17 -select * from t6 order by colint; -colint col1 -60 2006-01-17 -------------------------------------------------------------------------- ---- Delete rows and partitions of tables with datediff(col1, '2006-01-01') -------------------------------------------------------------------------- -delete from t11 where col1='2006-01-17'; -delete from t22 where col1='2006-01-17'; -delete from t33 where col1='2006-01-17'; -delete from t44 where col1='2006-01-17'; -delete from t55 where col1='2006-01-17'; -delete from t66 where col1='2006-01-17'; -select * from t11 order by col1; -col1 -2006-02-06 -select * from t22 order by col1; -col1 -2006-01-25 -2006-02-06 -select * from t33 order by col1; -col1 -2006-01-25 -2006-02-06 -select * from t44 order by colint; -colint col1 -1 2006-02-06 -3 2006-01-25 -4 2006-02-05 -select * from t55 order by colint; -colint col1 -1 2006-02-06 -3 2006-01-25 -4 2006-02-05 -insert into t11 values ('2006-01-17'); -insert into t22 values ('2006-01-17'); -insert into t33 values ('2006-01-17'); -insert into t44 values (60,'2006-01-17'); -insert into t55 values (60,'2006-01-17'); -insert into t66 values (60,'2006-01-17'); -select * from t11 order by col1; -col1 -2006-01-17 -2006-02-06 -select * from t22 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t33 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t44 order by colint; -colint col1 -1 2006-02-06 -3 2006-01-25 -4 2006-02-05 -60 2006-01-17 -select * from t55 order by colint; -colint col1 -1 2006-02-06 -3 2006-01-25 -4 2006-02-05 -60 2006-01-17 -select * from t66 order by colint; -colint col1 -1 2006-02-06 -3 2006-01-25 -4 2006-02-05 -60 2006-01-17 -alter table t11 drop partition p0; -alter table t22 drop partition p0; -alter table t44 drop partition p0; -alter table t55 drop partition p0; -alter table t66 drop partition p0; -select * from t11 order by col1; -col1 -2006-01-17 -2006-02-06 -select * from t22 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t33 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t44 order by colint; -colint col1 -60 2006-01-17 -select * from t55 order by colint; -colint col1 -60 2006-01-17 -select * from t66 order by colint; -colint col1 -60 2006-01-17 -------------------------- ----- some alter table end -------------------------- -drop table if exists t1 ; -drop table if exists t2 ; -drop table if exists t3 ; -drop table if exists t4 ; -drop table if exists t5 ; -drop table if exists t6 ; -drop table if exists t11 ; -drop table if exists t22 ; -drop table if exists t33 ; -drop table if exists t44 ; -drop table if exists t55 ; -drop table if exists t66 ; -------------------------------------------------------------------------- --- weekday(col1) in partition with coltype date ------------------------------------------------------------------------- drop table if exists t1 ; diff --git a/mysql-test/suite/parts/r/part_supported_sql_func_myisam.result b/mysql-test/suite/parts/r/part_supported_sql_func_myisam.result index 375a6e130be..3cd8e10a4f3 100644 --- a/mysql-test/suite/parts/r/part_supported_sql_func_myisam.result +++ b/mysql-test/suite/parts/r/part_supported_sql_func_myisam.result @@ -5425,513 +5425,6 @@ drop table if exists t44 ; drop table if exists t55 ; drop table if exists t66 ; ------------------------------------------------------------------------- ---- dayofyear(col1) in partition with coltype char(30) -------------------------------------------------------------------------- -drop table if exists t1 ; -drop table if exists t2 ; -drop table if exists t3 ; -drop table if exists t4 ; -drop table if exists t5 ; -drop table if exists t6 ; -------------------------------------------------------------------------- ---- Create tables with dayofyear(col1) -------------------------------------------------------------------------- -create table t1 (col1 char(30)) engine='MYISAM' -partition by range(dayofyear(col1)) -(partition p0 values less than (15), -partition p1 values less than maxvalue); -create table t2 (col1 char(30)) engine='MYISAM' -partition by list(dayofyear(col1)) -(partition p0 values in (0,1,2,3,4,5,6,7,8,9,10), -partition p1 values in (11,12,13,14,15,16,17,18,19,20), -partition p2 values in (21,22,23,24,25,26,27,28,29,30), -partition p3 values in (31,32,33,34,35,36,37,38,39,40), -partition p4 values in (41,42,43,44,45,46,47,48,49,50), -partition p5 values in (51,52,53,54,55,56,57,58,59,60) -); -create table t3 (col1 char(30)) engine='MYISAM' -partition by hash(dayofyear(col1)); -create table t4 (colint int, col1 char(30)) engine='MYISAM' -partition by range(colint) -subpartition by hash(dayofyear(col1)) subpartitions 2 -(partition p0 values less than (15), -partition p1 values less than maxvalue); -create table t5 (colint int, col1 char(30)) engine='MYISAM' -partition by list(colint) -subpartition by hash(dayofyear(col1)) subpartitions 2 -(partition p0 values in (1,2,3,4,5,6,7,8,9,10), -partition p1 values in (11,12,13,14,15,16,17,18,19,20), -partition p2 values in (21,22,23,24,25,26,27,28,29,30), -partition p3 values in (31,32,33,34,35,36,37,38,39,40), -partition p4 values in (41,42,43,44,45,46,47,48,49,50), -partition p5 values in (51,52,53,54,55,56,57,58,59,60) -); -create table t6 (colint int, col1 char(30)) engine='MYISAM' -partition by range(colint) -(partition p0 values less than (dayofyear('2006-12-25')), -partition p1 values less than maxvalue); -------------------------------------------------------------------------- ---- Access tables with dayofyear(col1) -------------------------------------------------------------------------- -insert into t1 values ('2006-01-03'); -insert into t1 values ('2006-01-17'); -insert into t2 values ('2006-01-03'); -insert into t2 values ('2006-01-17'); -insert into t2 values ('2006-02-25'); -insert into t3 values ('2006-01-03'); -insert into t3 values ('2006-01-17'); -insert into t3 values ('2006-02-25'); -load data infile 'MYSQLTEST_VARDIR/std_data/parts/part_supported_sql_funcs_int_date.inc' into table t4; -load data infile 'MYSQLTEST_VARDIR/std_data/parts/part_supported_sql_funcs_int_date.inc' into table t5; -load data infile 'MYSQLTEST_VARDIR/std_data/parts/part_supported_sql_funcs_int_date.inc' into table t6; -select dayofyear(col1) from t1 order by col1; -dayofyear(col1) -3 -17 -select * from t1 order by col1; -col1 -2006-01-03 -2006-01-17 -select * from t2 order by col1; -col1 -2006-01-03 -2006-01-17 -2006-02-25 -select * from t3 order by col1; -col1 -2006-01-03 -2006-01-17 -2006-02-25 -select * from t4 order by colint; -colint col1 -1 2006-02-03 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -select * from t5 order by colint; -colint col1 -1 2006-02-03 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -select * from t6 order by colint; -colint col1 -1 2006-02-03 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -update t1 set col1='2006-02-05' where col1='2006-01-03'; -update t2 set col1='2006-02-05' where col1='2006-01-03'; -update t3 set col1='2006-02-05' where col1='2006-01-03'; -update t4 set col1='2006-02-05' where col1='2006-01-03'; -update t5 set col1='2006-02-05' where col1='2006-01-03'; -update t6 set col1='2006-02-05' where col1='2006-01-03'; -select * from t1 order by col1; -col1 -2006-01-17 -2006-02-05 -select * from t2 order by col1; -col1 -2006-01-17 -2006-02-05 -2006-02-25 -select * from t3 order by col1; -col1 -2006-01-17 -2006-02-05 -2006-02-25 -select * from t4 order by colint; -colint col1 -1 2006-02-03 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -select * from t5 order by colint; -colint col1 -1 2006-02-03 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -select * from t6 order by colint; -colint col1 -1 2006-02-03 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -------------------------------------------------------------------------- ---- Alter tables with dayofyear(col1) -------------------------------------------------------------------------- -drop table if exists t11 ; -drop table if exists t22 ; -drop table if exists t33 ; -drop table if exists t44 ; -drop table if exists t55 ; -drop table if exists t66 ; -create table t11 engine='MYISAM' as select * from t1; -create table t22 engine='MYISAM' as select * from t2; -create table t33 engine='MYISAM' as select * from t3; -create table t44 engine='MYISAM' as select * from t4; -create table t55 engine='MYISAM' as select * from t5; -create table t66 engine='MYISAM' as select * from t6; -alter table t11 -partition by range(dayofyear(col1)) -(partition p0 values less than (15), -partition p1 values less than maxvalue); -alter table t22 -partition by list(dayofyear(col1)) -(partition p0 values in (0,1,2,3,4,5,6,7,8,9,10), -partition p1 values in (11,12,13,14,15,16,17,18,19,20), -partition p2 values in (21,22,23,24,25,26,27,28,29,30), -partition p3 values in (31,32,33,34,35,36,37,38,39,40), -partition p4 values in (41,42,43,44,45,46,47,48,49,50), -partition p5 values in (51,52,53,54,55,56,57,58,59,60) -); -alter table t33 -partition by hash(dayofyear(col1)); -alter table t44 -partition by range(colint) -subpartition by hash(dayofyear(col1)) subpartitions 2 -(partition p0 values less than (15), -partition p1 values less than maxvalue); -alter table t55 -partition by list(colint) -subpartition by hash(dayofyear(col1)) subpartitions 2 -(partition p0 values in (1,2,3,4,5,6,7,8,9,10), -partition p1 values in (11,12,13,14,15,16,17,18,19,20), -partition p2 values in (21,22,23,24,25,26,27,28,29,30), -partition p3 values in (31,32,33,34,35,36,37,38,39,40), -partition p4 values in (41,42,43,44,45,46,47,48,49,50), -partition p5 values in (51,52,53,54,55,56,57,58,59,60) -); -alter table t66 -partition by range(colint) -(partition p0 values less than (dayofyear('2006-12-25')), -partition p1 values less than maxvalue); -select * from t11 order by col1; -col1 -2006-01-17 -2006-02-05 -select * from t22 order by col1; -col1 -2006-01-17 -2006-02-05 -2006-02-25 -select * from t33 order by col1; -col1 -2006-01-17 -2006-02-05 -2006-02-25 -select * from t44 order by colint; -colint col1 -1 2006-02-03 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -select * from t55 order by colint; -colint col1 -1 2006-02-03 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -select * from t66 order by colint; -colint col1 -1 2006-02-03 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 ---------------------------- ----- some alter table begin ---------------------------- -alter table t11 -reorganize partition p0,p1 into -(partition s1 values less than maxvalue); -select * from t11 order by col1; -col1 -2006-01-17 -2006-02-05 -alter table t11 -reorganize partition s1 into -(partition p0 values less than (15), -partition p1 values less than maxvalue); -select * from t11 order by col1; -col1 -2006-01-17 -2006-02-05 -alter table t55 -partition by list(colint) -subpartition by hash(dayofyear(col1)) subpartitions 5 -(partition p0 values in (1,2,3,4,5,6,7,8,9,10), -partition p1 values in (11,12,13,14,15,16,17,18,19,20), -partition p2 values in (21,22,23,24,25,26,27,28,29,30), -partition p3 values in (31,32,33,34,35,36,37,38,39,40), -partition p4 values in (41,42,43,44,45,46,47,48,49,50), -partition p5 values in (51,52,53,54,55,56,57,58,59,60) -); -show create table t55; -Table Create Table -t55 CREATE TABLE `t55` ( - `colint` int(11) DEFAULT NULL, - `col1` char(30) DEFAULT NULL -) ENGINE=MyISAM DEFAULT CHARSET=latin1 -/*!50100 PARTITION BY LIST (colint) -SUBPARTITION BY HASH (dayofyear(col1)) -SUBPARTITIONS 5 -(PARTITION p0 VALUES IN (1,2,3,4,5,6,7,8,9,10) ENGINE = MyISAM, - PARTITION p1 VALUES IN (11,12,13,14,15,16,17,18,19,20) ENGINE = MyISAM, - PARTITION p2 VALUES IN (21,22,23,24,25,26,27,28,29,30) ENGINE = MyISAM, - PARTITION p3 VALUES IN (31,32,33,34,35,36,37,38,39,40) ENGINE = MyISAM, - PARTITION p4 VALUES IN (41,42,43,44,45,46,47,48,49,50) ENGINE = MyISAM, - PARTITION p5 VALUES IN (51,52,53,54,55,56,57,58,59,60) ENGINE = MyISAM) */ -select * from t55 order by colint; -colint col1 -1 2006-02-03 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -alter table t66 -reorganize partition p0,p1 into -(partition s1 values less than maxvalue); -select * from t66 order by colint; -colint col1 -1 2006-02-03 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -alter table t66 -reorganize partition s1 into -(partition p0 values less than (dayofyear('2006-12-25')), -partition p1 values less than maxvalue); -select * from t66 order by colint; -colint col1 -1 2006-02-03 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -alter table t66 -reorganize partition p0,p1 into -(partition s1 values less than maxvalue); -select * from t66 order by colint; -colint col1 -1 2006-02-03 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -alter table t66 -reorganize partition s1 into -(partition p0 values less than (dayofyear('2006-12-25')), -partition p1 values less than maxvalue); -select * from t66 order by colint; -colint col1 -1 2006-02-03 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -------------------------------------------------------------------------- ---- Delete rows and partitions of tables with dayofyear(col1) -------------------------------------------------------------------------- -delete from t1 where col1='2006-01-17'; -delete from t2 where col1='2006-01-17'; -delete from t3 where col1='2006-01-17'; -delete from t4 where col1='2006-01-17'; -delete from t5 where col1='2006-01-17'; -delete from t6 where col1='2006-01-17'; -select * from t1 order by col1; -col1 -2006-02-05 -select * from t2 order by col1; -col1 -2006-02-05 -2006-02-25 -select * from t3 order by col1; -col1 -2006-02-05 -2006-02-25 -select * from t4 order by colint; -colint col1 -1 2006-02-03 -3 2006-01-25 -4 2006-02-05 -select * from t5 order by colint; -colint col1 -1 2006-02-03 -3 2006-01-25 -4 2006-02-05 -insert into t1 values ('2006-01-17'); -insert into t2 values ('2006-01-17'); -insert into t3 values ('2006-01-17'); -insert into t4 values (60,'2006-01-17'); -insert into t5 values (60,'2006-01-17'); -insert into t6 values (60,'2006-01-17'); -select * from t1 order by col1; -col1 -2006-01-17 -2006-02-05 -select * from t2 order by col1; -col1 -2006-01-17 -2006-02-05 -2006-02-25 -select * from t3 order by col1; -col1 -2006-01-17 -2006-02-05 -2006-02-25 -select * from t4 order by colint; -colint col1 -1 2006-02-03 -3 2006-01-25 -4 2006-02-05 -60 2006-01-17 -select * from t5 order by colint; -colint col1 -1 2006-02-03 -3 2006-01-25 -4 2006-02-05 -60 2006-01-17 -select * from t6 order by colint; -colint col1 -1 2006-02-03 -3 2006-01-25 -4 2006-02-05 -60 2006-01-17 -alter table t1 drop partition p0; -alter table t2 drop partition p0; -alter table t4 drop partition p0; -alter table t5 drop partition p0; -alter table t6 drop partition p0; -select * from t1 order by col1; -col1 -2006-01-17 -2006-02-05 -select * from t2 order by col1; -col1 -2006-01-17 -2006-02-05 -2006-02-25 -select * from t3 order by col1; -col1 -2006-01-17 -2006-02-05 -2006-02-25 -select * from t4 order by colint; -colint col1 -60 2006-01-17 -select * from t5 order by colint; -colint col1 -60 2006-01-17 -select * from t6 order by colint; -colint col1 -------------------------------------------------------------------------- ---- Delete rows and partitions of tables with dayofyear(col1) -------------------------------------------------------------------------- -delete from t11 where col1='2006-01-17'; -delete from t22 where col1='2006-01-17'; -delete from t33 where col1='2006-01-17'; -delete from t44 where col1='2006-01-17'; -delete from t55 where col1='2006-01-17'; -delete from t66 where col1='2006-01-17'; -select * from t11 order by col1; -col1 -2006-02-05 -select * from t22 order by col1; -col1 -2006-02-05 -2006-02-25 -select * from t33 order by col1; -col1 -2006-02-05 -2006-02-25 -select * from t44 order by colint; -colint col1 -1 2006-02-03 -3 2006-01-25 -4 2006-02-05 -select * from t55 order by colint; -colint col1 -1 2006-02-03 -3 2006-01-25 -4 2006-02-05 -insert into t11 values ('2006-01-17'); -insert into t22 values ('2006-01-17'); -insert into t33 values ('2006-01-17'); -insert into t44 values (60,'2006-01-17'); -insert into t55 values (60,'2006-01-17'); -insert into t66 values (60,'2006-01-17'); -select * from t11 order by col1; -col1 -2006-01-17 -2006-02-05 -select * from t22 order by col1; -col1 -2006-01-17 -2006-02-05 -2006-02-25 -select * from t33 order by col1; -col1 -2006-01-17 -2006-02-05 -2006-02-25 -select * from t44 order by colint; -colint col1 -1 2006-02-03 -3 2006-01-25 -4 2006-02-05 -60 2006-01-17 -select * from t55 order by colint; -colint col1 -1 2006-02-03 -3 2006-01-25 -4 2006-02-05 -60 2006-01-17 -select * from t66 order by colint; -colint col1 -1 2006-02-03 -3 2006-01-25 -4 2006-02-05 -60 2006-01-17 -alter table t11 drop partition p0; -alter table t22 drop partition p0; -alter table t44 drop partition p0; -alter table t55 drop partition p0; -alter table t66 drop partition p0; -select * from t11 order by col1; -col1 -2006-01-17 -2006-02-05 -select * from t22 order by col1; -col1 -2006-01-17 -2006-02-05 -2006-02-25 -select * from t33 order by col1; -col1 -2006-01-17 -2006-02-05 -2006-02-25 -select * from t44 order by colint; -colint col1 -60 2006-01-17 -select * from t55 order by colint; -colint col1 -60 2006-01-17 -select * from t66 order by colint; -colint col1 -------------------------- ----- some alter table end -------------------------- -drop table if exists t1 ; -drop table if exists t2 ; -drop table if exists t3 ; -drop table if exists t4 ; -drop table if exists t5 ; -drop table if exists t6 ; -drop table if exists t11 ; -drop table if exists t22 ; -drop table if exists t33 ; -drop table if exists t44 ; -drop table if exists t55 ; -drop table if exists t66 ; -------------------------------------------------------------------------- --- extract(month from col1) in partition with coltype date ------------------------------------------------------------------------- drop table if exists t1 ; @@ -8489,525 +7982,6 @@ drop table if exists t44 ; drop table if exists t55 ; drop table if exists t66 ; ------------------------------------------------------------------------- ---- second(col1) in partition with coltype char(30) -------------------------------------------------------------------------- -drop table if exists t1 ; -drop table if exists t2 ; -drop table if exists t3 ; -drop table if exists t4 ; -drop table if exists t5 ; -drop table if exists t6 ; -------------------------------------------------------------------------- ---- Create tables with second(col1) -------------------------------------------------------------------------- -create table t1 (col1 char(30)) engine='MYISAM' -partition by range(second(col1)) -(partition p0 values less than (15), -partition p1 values less than maxvalue); -create table t2 (col1 char(30)) engine='MYISAM' -partition by list(second(col1)) -(partition p0 values in (0,1,2,3,4,5,6,7,8,9,10), -partition p1 values in (11,12,13,14,15,16,17,18,19,20), -partition p2 values in (21,22,23,24,25,26,27,28,29,30), -partition p3 values in (31,32,33,34,35,36,37,38,39,40), -partition p4 values in (41,42,43,44,45,46,47,48,49,50), -partition p5 values in (51,52,53,54,55,56,57,58,59,60) -); -create table t3 (col1 char(30)) engine='MYISAM' -partition by hash(second(col1)); -create table t4 (colint int, col1 char(30)) engine='MYISAM' -partition by range(colint) -subpartition by hash(second(col1)) subpartitions 2 -(partition p0 values less than (15), -partition p1 values less than maxvalue); -create table t5 (colint int, col1 char(30)) engine='MYISAM' -partition by list(colint) -subpartition by hash(second(col1)) subpartitions 2 -(partition p0 values in (1,2,3,4,5,6,7,8,9,10), -partition p1 values in (11,12,13,14,15,16,17,18,19,20), -partition p2 values in (21,22,23,24,25,26,27,28,29,30), -partition p3 values in (31,32,33,34,35,36,37,38,39,40), -partition p4 values in (41,42,43,44,45,46,47,48,49,50), -partition p5 values in (51,52,53,54,55,56,57,58,59,60) -); -create table t6 (colint int, col1 char(30)) engine='MYISAM' -partition by range(colint) -(partition p0 values less than (second('18:30:14')), -partition p1 values less than maxvalue); -------------------------------------------------------------------------- ---- Access tables with second(col1) -------------------------------------------------------------------------- -insert into t1 values ('09:09:09'); -insert into t1 values ('14:30:20'); -insert into t2 values ('09:09:09'); -insert into t2 values ('14:30:20'); -insert into t2 values ('21:59:22'); -insert into t3 values ('09:09:09'); -insert into t3 values ('14:30:20'); -insert into t3 values ('21:59:22'); -load data infile 'MYSQLTEST_VARDIR/std_data/parts/part_supported_sql_funcs_int_time.inc' into table t4; -load data infile 'MYSQLTEST_VARDIR/std_data/parts/part_supported_sql_funcs_int_time.inc' into table t5; -load data infile 'MYSQLTEST_VARDIR/std_data/parts/part_supported_sql_funcs_int_time.inc' into table t6; -select second(col1) from t1 order by col1; -second(col1) -9 -20 -select * from t1 order by col1; -col1 -09:09:09 -14:30:20 -select * from t2 order by col1; -col1 -09:09:09 -14:30:20 -21:59:22 -select * from t3 order by col1; -col1 -09:09:09 -14:30:20 -21:59:22 -select * from t4 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 -select * from t5 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 -select * from t6 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 -update t1 set col1='10:22:33' where col1='09:09:09'; -update t2 set col1='10:22:33' where col1='09:09:09'; -update t3 set col1='10:22:33' where col1='09:09:09'; -update t4 set col1='10:22:33' where col1='09:09:09'; -update t5 set col1='10:22:33' where col1='09:09:09'; -update t6 set col1='10:22:33' where col1='09:09:09'; -select * from t1 order by col1; -col1 -10:22:33 -14:30:20 -select * from t2 order by col1; -col1 -10:22:33 -14:30:20 -21:59:22 -select * from t3 order by col1; -col1 -10:22:33 -14:30:20 -21:59:22 -select * from t4 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 -select * from t5 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 -select * from t6 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 -------------------------------------------------------------------------- ---- Alter tables with second(col1) -------------------------------------------------------------------------- -drop table if exists t11 ; -drop table if exists t22 ; -drop table if exists t33 ; -drop table if exists t44 ; -drop table if exists t55 ; -drop table if exists t66 ; -create table t11 engine='MYISAM' as select * from t1; -create table t22 engine='MYISAM' as select * from t2; -create table t33 engine='MYISAM' as select * from t3; -create table t44 engine='MYISAM' as select * from t4; -create table t55 engine='MYISAM' as select * from t5; -create table t66 engine='MYISAM' as select * from t6; -alter table t11 -partition by range(second(col1)) -(partition p0 values less than (15), -partition p1 values less than maxvalue); -alter table t22 -partition by list(second(col1)) -(partition p0 values in (0,1,2,3,4,5,6,7,8,9,10), -partition p1 values in (11,12,13,14,15,16,17,18,19,20), -partition p2 values in (21,22,23,24,25,26,27,28,29,30), -partition p3 values in (31,32,33,34,35,36,37,38,39,40), -partition p4 values in (41,42,43,44,45,46,47,48,49,50), -partition p5 values in (51,52,53,54,55,56,57,58,59,60) -); -alter table t33 -partition by hash(second(col1)); -alter table t44 -partition by range(colint) -subpartition by hash(second(col1)) subpartitions 2 -(partition p0 values less than (15), -partition p1 values less than maxvalue); -alter table t55 -partition by list(colint) -subpartition by hash(second(col1)) subpartitions 2 -(partition p0 values in (1,2,3,4,5,6,7,8,9,10), -partition p1 values in (11,12,13,14,15,16,17,18,19,20), -partition p2 values in (21,22,23,24,25,26,27,28,29,30), -partition p3 values in (31,32,33,34,35,36,37,38,39,40), -partition p4 values in (41,42,43,44,45,46,47,48,49,50), -partition p5 values in (51,52,53,54,55,56,57,58,59,60) -); -alter table t66 -partition by range(colint) -(partition p0 values less than (second('18:30:14')), -partition p1 values less than maxvalue); -select * from t11 order by col1; -col1 -10:22:33 -14:30:20 -select * from t22 order by col1; -col1 -10:22:33 -14:30:20 -21:59:22 -select * from t33 order by col1; -col1 -10:22:33 -14:30:20 -21:59:22 -select * from t44 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 -select * from t55 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 -select * from t66 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 ---------------------------- ----- some alter table begin ---------------------------- -alter table t11 -reorganize partition p0,p1 into -(partition s1 values less than maxvalue); -select * from t11 order by col1; -col1 -10:22:33 -14:30:20 -alter table t11 -reorganize partition s1 into -(partition p0 values less than (15), -partition p1 values less than maxvalue); -select * from t11 order by col1; -col1 -10:22:33 -14:30:20 -alter table t55 -partition by list(colint) -subpartition by hash(second(col1)) subpartitions 5 -(partition p0 values in (1,2,3,4,5,6,7,8,9,10), -partition p1 values in (11,12,13,14,15,16,17,18,19,20), -partition p2 values in (21,22,23,24,25,26,27,28,29,30), -partition p3 values in (31,32,33,34,35,36,37,38,39,40), -partition p4 values in (41,42,43,44,45,46,47,48,49,50), -partition p5 values in (51,52,53,54,55,56,57,58,59,60) -); -show create table t55; -Table Create Table -t55 CREATE TABLE `t55` ( - `colint` int(11) DEFAULT NULL, - `col1` char(30) DEFAULT NULL -) ENGINE=MyISAM DEFAULT CHARSET=latin1 -/*!50100 PARTITION BY LIST (colint) -SUBPARTITION BY HASH (second(col1)) -SUBPARTITIONS 5 -(PARTITION p0 VALUES IN (1,2,3,4,5,6,7,8,9,10) ENGINE = MyISAM, - PARTITION p1 VALUES IN (11,12,13,14,15,16,17,18,19,20) ENGINE = MyISAM, - PARTITION p2 VALUES IN (21,22,23,24,25,26,27,28,29,30) ENGINE = MyISAM, - PARTITION p3 VALUES IN (31,32,33,34,35,36,37,38,39,40) ENGINE = MyISAM, - PARTITION p4 VALUES IN (41,42,43,44,45,46,47,48,49,50) ENGINE = MyISAM, - PARTITION p5 VALUES IN (51,52,53,54,55,56,57,58,59,60) ENGINE = MyISAM) */ -select * from t55 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 -alter table t66 -reorganize partition p0,p1 into -(partition s1 values less than maxvalue); -select * from t66 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 -alter table t66 -reorganize partition s1 into -(partition p0 values less than (second('18:30:14')), -partition p1 values less than maxvalue); -select * from t66 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 -alter table t66 -reorganize partition p0,p1 into -(partition s1 values less than maxvalue); -select * from t66 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 -alter table t66 -reorganize partition s1 into -(partition p0 values less than (second('18:30:14')), -partition p1 values less than maxvalue); -select * from t66 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 -------------------------------------------------------------------------- ---- Delete rows and partitions of tables with second(col1) -------------------------------------------------------------------------- -delete from t1 where col1='14:30:20'; -delete from t2 where col1='14:30:20'; -delete from t3 where col1='14:30:20'; -delete from t4 where col1='14:30:20'; -delete from t5 where col1='14:30:20'; -delete from t6 where col1='14:30:20'; -select * from t1 order by col1; -col1 -10:22:33 -select * from t2 order by col1; -col1 -10:22:33 -21:59:22 -select * from t3 order by col1; -col1 -10:22:33 -21:59:22 -select * from t4 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 -select * from t5 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 -insert into t1 values ('14:30:20'); -insert into t2 values ('14:30:20'); -insert into t3 values ('14:30:20'); -insert into t4 values (60,'14:30:20'); -insert into t5 values (60,'14:30:20'); -insert into t6 values (60,'14:30:20'); -select * from t1 order by col1; -col1 -10:22:33 -14:30:20 -select * from t2 order by col1; -col1 -10:22:33 -14:30:20 -21:59:22 -select * from t3 order by col1; -col1 -10:22:33 -14:30:20 -21:59:22 -select * from t4 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 -60 14:30:20 -select * from t5 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 -60 14:30:20 -select * from t6 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 -60 14:30:20 -alter table t1 drop partition p0; -alter table t2 drop partition p0; -alter table t4 drop partition p0; -alter table t5 drop partition p0; -alter table t6 drop partition p0; -select * from t1 order by col1; -col1 -10:22:33 -14:30:20 -select * from t2 order by col1; -col1 -10:22:33 -14:30:20 -21:59:22 -select * from t3 order by col1; -col1 -10:22:33 -14:30:20 -21:59:22 -select * from t4 order by colint; -colint col1 -60 14:30:20 -select * from t5 order by colint; -colint col1 -60 14:30:20 -select * from t6 order by colint; -colint col1 -60 14:30:20 -------------------------------------------------------------------------- ---- Delete rows and partitions of tables with second(col1) -------------------------------------------------------------------------- -delete from t11 where col1='14:30:20'; -delete from t22 where col1='14:30:20'; -delete from t33 where col1='14:30:20'; -delete from t44 where col1='14:30:20'; -delete from t55 where col1='14:30:20'; -delete from t66 where col1='14:30:20'; -select * from t11 order by col1; -col1 -10:22:33 -select * from t22 order by col1; -col1 -10:22:33 -21:59:22 -select * from t33 order by col1; -col1 -10:22:33 -21:59:22 -select * from t44 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 -select * from t55 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 -insert into t11 values ('14:30:20'); -insert into t22 values ('14:30:20'); -insert into t33 values ('14:30:20'); -insert into t44 values (60,'14:30:20'); -insert into t55 values (60,'14:30:20'); -insert into t66 values (60,'14:30:20'); -select * from t11 order by col1; -col1 -10:22:33 -14:30:20 -select * from t22 order by col1; -col1 -10:22:33 -14:30:20 -21:59:22 -select * from t33 order by col1; -col1 -10:22:33 -14:30:20 -21:59:22 -select * from t44 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 -60 14:30:20 -select * from t55 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 -60 14:30:20 -select * from t66 order by colint; -colint col1 -1 09:09:15.000002 -2 04:30:01.000018 -3 00:59:22.000024 -4 05:30:34.000037 -60 14:30:20 -alter table t11 drop partition p0; -alter table t22 drop partition p0; -alter table t44 drop partition p0; -alter table t55 drop partition p0; -alter table t66 drop partition p0; -select * from t11 order by col1; -col1 -10:22:33 -14:30:20 -select * from t22 order by col1; -col1 -10:22:33 -14:30:20 -21:59:22 -select * from t33 order by col1; -col1 -10:22:33 -14:30:20 -21:59:22 -select * from t44 order by colint; -colint col1 -60 14:30:20 -select * from t55 order by colint; -colint col1 -60 14:30:20 -select * from t66 order by colint; -colint col1 -60 14:30:20 -------------------------- ----- some alter table end -------------------------- -drop table if exists t1 ; -drop table if exists t2 ; -drop table if exists t3 ; -drop table if exists t4 ; -drop table if exists t5 ; -drop table if exists t6 ; -drop table if exists t11 ; -drop table if exists t22 ; -drop table if exists t33 ; -drop table if exists t44 ; -drop table if exists t55 ; -drop table if exists t66 ; -------------------------------------------------------------------------- --- month(col1) in partition with coltype date ------------------------------------------------------------------------- drop table if exists t1 ; @@ -10549,1024 +9523,6 @@ drop table if exists t44 ; drop table if exists t55 ; drop table if exists t66 ; ------------------------------------------------------------------------- ---- to_days(col1)-to_days('2006-01-01') in partition with coltype date -------------------------------------------------------------------------- -drop table if exists t1 ; -drop table if exists t2 ; -drop table if exists t3 ; -drop table if exists t4 ; -drop table if exists t5 ; -drop table if exists t6 ; -------------------------------------------------------------------------- ---- Create tables with to_days(col1)-to_days('2006-01-01') -------------------------------------------------------------------------- -create table t1 (col1 date) engine='MYISAM' -partition by range(to_days(col1)-to_days('2006-01-01')) -(partition p0 values less than (15), -partition p1 values less than maxvalue); -create table t2 (col1 date) engine='MYISAM' -partition by list(to_days(col1)-to_days('2006-01-01')) -(partition p0 values in (0,1,2,3,4,5,6,7,8,9,10), -partition p1 values in (11,12,13,14,15,16,17,18,19,20), -partition p2 values in (21,22,23,24,25,26,27,28,29,30), -partition p3 values in (31,32,33,34,35,36,37,38,39,40), -partition p4 values in (41,42,43,44,45,46,47,48,49,50), -partition p5 values in (51,52,53,54,55,56,57,58,59,60) -); -create table t3 (col1 date) engine='MYISAM' -partition by hash(to_days(col1)-to_days('2006-01-01')); -create table t4 (colint int, col1 date) engine='MYISAM' -partition by range(colint) -subpartition by hash(to_days(col1)-to_days('2006-01-01')) subpartitions 2 -(partition p0 values less than (15), -partition p1 values less than maxvalue); -create table t5 (colint int, col1 date) engine='MYISAM' -partition by list(colint) -subpartition by hash(to_days(col1)-to_days('2006-01-01')) subpartitions 2 -(partition p0 values in (1,2,3,4,5,6,7,8,9,10), -partition p1 values in (11,12,13,14,15,16,17,18,19,20), -partition p2 values in (21,22,23,24,25,26,27,28,29,30), -partition p3 values in (31,32,33,34,35,36,37,38,39,40), -partition p4 values in (41,42,43,44,45,46,47,48,49,50), -partition p5 values in (51,52,53,54,55,56,57,58,59,60) -); -create table t6 (colint int, col1 date) engine='MYISAM' -partition by range(colint) -(partition p0 values less than (to_days('2006-02-02')-to_days('2006-01-01')), -partition p1 values less than maxvalue); -------------------------------------------------------------------------- ---- Access tables with to_days(col1)-to_days('2006-01-01') -------------------------------------------------------------------------- -insert into t1 values ('2006-02-03'); -insert into t1 values ('2006-01-17'); -insert into t2 values ('2006-02-03'); -insert into t2 values ('2006-01-17'); -insert into t2 values ('2006-01-25'); -insert into t3 values ('2006-02-03'); -insert into t3 values ('2006-01-17'); -insert into t3 values ('2006-01-25'); -load data infile 'MYSQLTEST_VARDIR/std_data/parts/part_supported_sql_funcs_int_date.inc' into table t4; -load data infile 'MYSQLTEST_VARDIR/std_data/parts/part_supported_sql_funcs_int_date.inc' into table t5; -load data infile 'MYSQLTEST_VARDIR/std_data/parts/part_supported_sql_funcs_int_date.inc' into table t6; -select to_days(col1)-to_days('2006-01-01') from t1 order by col1; -to_days(col1)-to_days('2006-01-01') -16 -33 -select * from t1 order by col1; -col1 -2006-01-17 -2006-02-03 -select * from t2 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-03 -select * from t3 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-03 -select * from t4 order by colint; -colint col1 -1 2006-02-03 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -select * from t5 order by colint; -colint col1 -1 2006-02-03 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -select * from t6 order by colint; -colint col1 -1 2006-02-03 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -update t1 set col1='2006-02-06' where col1='2006-02-03'; -update t2 set col1='2006-02-06' where col1='2006-02-03'; -update t3 set col1='2006-02-06' where col1='2006-02-03'; -update t4 set col1='2006-02-06' where col1='2006-02-03'; -update t5 set col1='2006-02-06' where col1='2006-02-03'; -update t6 set col1='2006-02-06' where col1='2006-02-03'; -select * from t1 order by col1; -col1 -2006-01-17 -2006-02-06 -select * from t2 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t3 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t4 order by colint; -colint col1 -1 2006-02-06 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -select * from t5 order by colint; -colint col1 -1 2006-02-06 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -select * from t6 order by colint; -colint col1 -1 2006-02-06 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -------------------------------------------------------------------------- ---- Alter tables with to_days(col1)-to_days('2006-01-01') -------------------------------------------------------------------------- -drop table if exists t11 ; -drop table if exists t22 ; -drop table if exists t33 ; -drop table if exists t44 ; -drop table if exists t55 ; -drop table if exists t66 ; -create table t11 engine='MYISAM' as select * from t1; -create table t22 engine='MYISAM' as select * from t2; -create table t33 engine='MYISAM' as select * from t3; -create table t44 engine='MYISAM' as select * from t4; -create table t55 engine='MYISAM' as select * from t5; -create table t66 engine='MYISAM' as select * from t6; -alter table t11 -partition by range(to_days(col1)-to_days('2006-01-01')) -(partition p0 values less than (15), -partition p1 values less than maxvalue); -alter table t22 -partition by list(to_days(col1)-to_days('2006-01-01')) -(partition p0 values in (0,1,2,3,4,5,6,7,8,9,10), -partition p1 values in (11,12,13,14,15,16,17,18,19,20), -partition p2 values in (21,22,23,24,25,26,27,28,29,30), -partition p3 values in (31,32,33,34,35,36,37,38,39,40), -partition p4 values in (41,42,43,44,45,46,47,48,49,50), -partition p5 values in (51,52,53,54,55,56,57,58,59,60) -); -alter table t33 -partition by hash(to_days(col1)-to_days('2006-01-01')); -alter table t44 -partition by range(colint) -subpartition by hash(to_days(col1)-to_days('2006-01-01')) subpartitions 2 -(partition p0 values less than (15), -partition p1 values less than maxvalue); -alter table t55 -partition by list(colint) -subpartition by hash(to_days(col1)-to_days('2006-01-01')) subpartitions 2 -(partition p0 values in (1,2,3,4,5,6,7,8,9,10), -partition p1 values in (11,12,13,14,15,16,17,18,19,20), -partition p2 values in (21,22,23,24,25,26,27,28,29,30), -partition p3 values in (31,32,33,34,35,36,37,38,39,40), -partition p4 values in (41,42,43,44,45,46,47,48,49,50), -partition p5 values in (51,52,53,54,55,56,57,58,59,60) -); -alter table t66 -partition by range(colint) -(partition p0 values less than (to_days('2006-02-02')-to_days('2006-01-01')), -partition p1 values less than maxvalue); -select * from t11 order by col1; -col1 -2006-01-17 -2006-02-06 -select * from t22 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t33 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t44 order by colint; -colint col1 -1 2006-02-06 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -select * from t55 order by colint; -colint col1 -1 2006-02-06 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -select * from t66 order by colint; -colint col1 -1 2006-02-06 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 ---------------------------- ----- some alter table begin ---------------------------- -alter table t11 -reorganize partition p0,p1 into -(partition s1 values less than maxvalue); -select * from t11 order by col1; -col1 -2006-01-17 -2006-02-06 -alter table t11 -reorganize partition s1 into -(partition p0 values less than (15), -partition p1 values less than maxvalue); -select * from t11 order by col1; -col1 -2006-01-17 -2006-02-06 -alter table t55 -partition by list(colint) -subpartition by hash(to_days(col1)-to_days('2006-01-01')) subpartitions 5 -(partition p0 values in (1,2,3,4,5,6,7,8,9,10), -partition p1 values in (11,12,13,14,15,16,17,18,19,20), -partition p2 values in (21,22,23,24,25,26,27,28,29,30), -partition p3 values in (31,32,33,34,35,36,37,38,39,40), -partition p4 values in (41,42,43,44,45,46,47,48,49,50), -partition p5 values in (51,52,53,54,55,56,57,58,59,60) -); -show create table t55; -Table Create Table -t55 CREATE TABLE `t55` ( - `colint` int(11) DEFAULT NULL, - `col1` date DEFAULT NULL -) ENGINE=MyISAM DEFAULT CHARSET=latin1 -/*!50100 PARTITION BY LIST (colint) -SUBPARTITION BY HASH (to_days(col1)-to_days('2006-01-01')) -SUBPARTITIONS 5 -(PARTITION p0 VALUES IN (1,2,3,4,5,6,7,8,9,10) ENGINE = MyISAM, - PARTITION p1 VALUES IN (11,12,13,14,15,16,17,18,19,20) ENGINE = MyISAM, - PARTITION p2 VALUES IN (21,22,23,24,25,26,27,28,29,30) ENGINE = MyISAM, - PARTITION p3 VALUES IN (31,32,33,34,35,36,37,38,39,40) ENGINE = MyISAM, - PARTITION p4 VALUES IN (41,42,43,44,45,46,47,48,49,50) ENGINE = MyISAM, - PARTITION p5 VALUES IN (51,52,53,54,55,56,57,58,59,60) ENGINE = MyISAM) */ -select * from t55 order by colint; -colint col1 -1 2006-02-06 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -alter table t66 -reorganize partition p0,p1 into -(partition s1 values less than maxvalue); -select * from t66 order by colint; -colint col1 -1 2006-02-06 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -alter table t66 -reorganize partition s1 into -(partition p0 values less than (to_days('2006-02-02')-to_days('2006-01-01')), -partition p1 values less than maxvalue); -select * from t66 order by colint; -colint col1 -1 2006-02-06 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -alter table t66 -reorganize partition p0,p1 into -(partition s1 values less than maxvalue); -select * from t66 order by colint; -colint col1 -1 2006-02-06 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -alter table t66 -reorganize partition s1 into -(partition p0 values less than (to_days('2006-02-02')-to_days('2006-01-01')), -partition p1 values less than maxvalue); -select * from t66 order by colint; -colint col1 -1 2006-02-06 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -------------------------------------------------------------------------- ---- Delete rows and partitions of tables with to_days(col1)-to_days('2006-01-01') -------------------------------------------------------------------------- -delete from t1 where col1='2006-01-17'; -delete from t2 where col1='2006-01-17'; -delete from t3 where col1='2006-01-17'; -delete from t4 where col1='2006-01-17'; -delete from t5 where col1='2006-01-17'; -delete from t6 where col1='2006-01-17'; -select * from t1 order by col1; -col1 -2006-02-06 -select * from t2 order by col1; -col1 -2006-01-25 -2006-02-06 -select * from t3 order by col1; -col1 -2006-01-25 -2006-02-06 -select * from t4 order by colint; -colint col1 -1 2006-02-06 -3 2006-01-25 -4 2006-02-05 -select * from t5 order by colint; -colint col1 -1 2006-02-06 -3 2006-01-25 -4 2006-02-05 -insert into t1 values ('2006-01-17'); -insert into t2 values ('2006-01-17'); -insert into t3 values ('2006-01-17'); -insert into t4 values (60,'2006-01-17'); -insert into t5 values (60,'2006-01-17'); -insert into t6 values (60,'2006-01-17'); -select * from t1 order by col1; -col1 -2006-01-17 -2006-02-06 -select * from t2 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t3 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t4 order by colint; -colint col1 -1 2006-02-06 -3 2006-01-25 -4 2006-02-05 -60 2006-01-17 -select * from t5 order by colint; -colint col1 -1 2006-02-06 -3 2006-01-25 -4 2006-02-05 -60 2006-01-17 -select * from t6 order by colint; -colint col1 -1 2006-02-06 -3 2006-01-25 -4 2006-02-05 -60 2006-01-17 -alter table t1 drop partition p0; -alter table t2 drop partition p0; -alter table t4 drop partition p0; -alter table t5 drop partition p0; -alter table t6 drop partition p0; -select * from t1 order by col1; -col1 -2006-01-17 -2006-02-06 -select * from t2 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t3 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t4 order by colint; -colint col1 -60 2006-01-17 -select * from t5 order by colint; -colint col1 -60 2006-01-17 -select * from t6 order by colint; -colint col1 -60 2006-01-17 -------------------------------------------------------------------------- ---- Delete rows and partitions of tables with to_days(col1)-to_days('2006-01-01') -------------------------------------------------------------------------- -delete from t11 where col1='2006-01-17'; -delete from t22 where col1='2006-01-17'; -delete from t33 where col1='2006-01-17'; -delete from t44 where col1='2006-01-17'; -delete from t55 where col1='2006-01-17'; -delete from t66 where col1='2006-01-17'; -select * from t11 order by col1; -col1 -2006-02-06 -select * from t22 order by col1; -col1 -2006-01-25 -2006-02-06 -select * from t33 order by col1; -col1 -2006-01-25 -2006-02-06 -select * from t44 order by colint; -colint col1 -1 2006-02-06 -3 2006-01-25 -4 2006-02-05 -select * from t55 order by colint; -colint col1 -1 2006-02-06 -3 2006-01-25 -4 2006-02-05 -insert into t11 values ('2006-01-17'); -insert into t22 values ('2006-01-17'); -insert into t33 values ('2006-01-17'); -insert into t44 values (60,'2006-01-17'); -insert into t55 values (60,'2006-01-17'); -insert into t66 values (60,'2006-01-17'); -select * from t11 order by col1; -col1 -2006-01-17 -2006-02-06 -select * from t22 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t33 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t44 order by colint; -colint col1 -1 2006-02-06 -3 2006-01-25 -4 2006-02-05 -60 2006-01-17 -select * from t55 order by colint; -colint col1 -1 2006-02-06 -3 2006-01-25 -4 2006-02-05 -60 2006-01-17 -select * from t66 order by colint; -colint col1 -1 2006-02-06 -3 2006-01-25 -4 2006-02-05 -60 2006-01-17 -alter table t11 drop partition p0; -alter table t22 drop partition p0; -alter table t44 drop partition p0; -alter table t55 drop partition p0; -alter table t66 drop partition p0; -select * from t11 order by col1; -col1 -2006-01-17 -2006-02-06 -select * from t22 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t33 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t44 order by colint; -colint col1 -60 2006-01-17 -select * from t55 order by colint; -colint col1 -60 2006-01-17 -select * from t66 order by colint; -colint col1 -60 2006-01-17 -------------------------- ----- some alter table end -------------------------- -drop table if exists t1 ; -drop table if exists t2 ; -drop table if exists t3 ; -drop table if exists t4 ; -drop table if exists t5 ; -drop table if exists t6 ; -drop table if exists t11 ; -drop table if exists t22 ; -drop table if exists t33 ; -drop table if exists t44 ; -drop table if exists t55 ; -drop table if exists t66 ; -------------------------------------------------------------------------- ---- datediff(col1, '2006-01-01') in partition with coltype date -------------------------------------------------------------------------- -drop table if exists t1 ; -drop table if exists t2 ; -drop table if exists t3 ; -drop table if exists t4 ; -drop table if exists t5 ; -drop table if exists t6 ; -------------------------------------------------------------------------- ---- Create tables with datediff(col1, '2006-01-01') -------------------------------------------------------------------------- -create table t1 (col1 date) engine='MYISAM' -partition by range(datediff(col1, '2006-01-01')) -(partition p0 values less than (15), -partition p1 values less than maxvalue); -create table t2 (col1 date) engine='MYISAM' -partition by list(datediff(col1, '2006-01-01')) -(partition p0 values in (0,1,2,3,4,5,6,7,8,9,10), -partition p1 values in (11,12,13,14,15,16,17,18,19,20), -partition p2 values in (21,22,23,24,25,26,27,28,29,30), -partition p3 values in (31,32,33,34,35,36,37,38,39,40), -partition p4 values in (41,42,43,44,45,46,47,48,49,50), -partition p5 values in (51,52,53,54,55,56,57,58,59,60) -); -create table t3 (col1 date) engine='MYISAM' -partition by hash(datediff(col1, '2006-01-01')); -create table t4 (colint int, col1 date) engine='MYISAM' -partition by range(colint) -subpartition by hash(datediff(col1, '2006-01-01')) subpartitions 2 -(partition p0 values less than (15), -partition p1 values less than maxvalue); -create table t5 (colint int, col1 date) engine='MYISAM' -partition by list(colint) -subpartition by hash(datediff(col1, '2006-01-01')) subpartitions 2 -(partition p0 values in (1,2,3,4,5,6,7,8,9,10), -partition p1 values in (11,12,13,14,15,16,17,18,19,20), -partition p2 values in (21,22,23,24,25,26,27,28,29,30), -partition p3 values in (31,32,33,34,35,36,37,38,39,40), -partition p4 values in (41,42,43,44,45,46,47,48,49,50), -partition p5 values in (51,52,53,54,55,56,57,58,59,60) -); -create table t6 (colint int, col1 date) engine='MYISAM' -partition by range(colint) -(partition p0 values less than (datediff('2006-02-02', '2006-01-01')), -partition p1 values less than maxvalue); -------------------------------------------------------------------------- ---- Access tables with datediff(col1, '2006-01-01') -------------------------------------------------------------------------- -insert into t1 values ('2006-02-03'); -insert into t1 values ('2006-01-17'); -insert into t2 values ('2006-02-03'); -insert into t2 values ('2006-01-17'); -insert into t2 values ('2006-01-25'); -insert into t3 values ('2006-02-03'); -insert into t3 values ('2006-01-17'); -insert into t3 values ('2006-01-25'); -load data infile 'MYSQLTEST_VARDIR/std_data/parts/part_supported_sql_funcs_int_date.inc' into table t4; -load data infile 'MYSQLTEST_VARDIR/std_data/parts/part_supported_sql_funcs_int_date.inc' into table t5; -load data infile 'MYSQLTEST_VARDIR/std_data/parts/part_supported_sql_funcs_int_date.inc' into table t6; -select datediff(col1, '2006-01-01') from t1 order by col1; -datediff(col1, '2006-01-01') -16 -33 -select * from t1 order by col1; -col1 -2006-01-17 -2006-02-03 -select * from t2 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-03 -select * from t3 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-03 -select * from t4 order by colint; -colint col1 -1 2006-02-03 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -select * from t5 order by colint; -colint col1 -1 2006-02-03 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -select * from t6 order by colint; -colint col1 -1 2006-02-03 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -update t1 set col1='2006-02-06' where col1='2006-02-03'; -update t2 set col1='2006-02-06' where col1='2006-02-03'; -update t3 set col1='2006-02-06' where col1='2006-02-03'; -update t4 set col1='2006-02-06' where col1='2006-02-03'; -update t5 set col1='2006-02-06' where col1='2006-02-03'; -update t6 set col1='2006-02-06' where col1='2006-02-03'; -select * from t1 order by col1; -col1 -2006-01-17 -2006-02-06 -select * from t2 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t3 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t4 order by colint; -colint col1 -1 2006-02-06 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -select * from t5 order by colint; -colint col1 -1 2006-02-06 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -select * from t6 order by colint; -colint col1 -1 2006-02-06 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -------------------------------------------------------------------------- ---- Alter tables with datediff(col1, '2006-01-01') -------------------------------------------------------------------------- -drop table if exists t11 ; -drop table if exists t22 ; -drop table if exists t33 ; -drop table if exists t44 ; -drop table if exists t55 ; -drop table if exists t66 ; -create table t11 engine='MYISAM' as select * from t1; -create table t22 engine='MYISAM' as select * from t2; -create table t33 engine='MYISAM' as select * from t3; -create table t44 engine='MYISAM' as select * from t4; -create table t55 engine='MYISAM' as select * from t5; -create table t66 engine='MYISAM' as select * from t6; -alter table t11 -partition by range(datediff(col1, '2006-01-01')) -(partition p0 values less than (15), -partition p1 values less than maxvalue); -alter table t22 -partition by list(datediff(col1, '2006-01-01')) -(partition p0 values in (0,1,2,3,4,5,6,7,8,9,10), -partition p1 values in (11,12,13,14,15,16,17,18,19,20), -partition p2 values in (21,22,23,24,25,26,27,28,29,30), -partition p3 values in (31,32,33,34,35,36,37,38,39,40), -partition p4 values in (41,42,43,44,45,46,47,48,49,50), -partition p5 values in (51,52,53,54,55,56,57,58,59,60) -); -alter table t33 -partition by hash(datediff(col1, '2006-01-01')); -alter table t44 -partition by range(colint) -subpartition by hash(datediff(col1, '2006-01-01')) subpartitions 2 -(partition p0 values less than (15), -partition p1 values less than maxvalue); -alter table t55 -partition by list(colint) -subpartition by hash(datediff(col1, '2006-01-01')) subpartitions 2 -(partition p0 values in (1,2,3,4,5,6,7,8,9,10), -partition p1 values in (11,12,13,14,15,16,17,18,19,20), -partition p2 values in (21,22,23,24,25,26,27,28,29,30), -partition p3 values in (31,32,33,34,35,36,37,38,39,40), -partition p4 values in (41,42,43,44,45,46,47,48,49,50), -partition p5 values in (51,52,53,54,55,56,57,58,59,60) -); -alter table t66 -partition by range(colint) -(partition p0 values less than (datediff('2006-02-02', '2006-01-01')), -partition p1 values less than maxvalue); -select * from t11 order by col1; -col1 -2006-01-17 -2006-02-06 -select * from t22 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t33 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t44 order by colint; -colint col1 -1 2006-02-06 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -select * from t55 order by colint; -colint col1 -1 2006-02-06 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -select * from t66 order by colint; -colint col1 -1 2006-02-06 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 ---------------------------- ----- some alter table begin ---------------------------- -alter table t11 -reorganize partition p0,p1 into -(partition s1 values less than maxvalue); -select * from t11 order by col1; -col1 -2006-01-17 -2006-02-06 -alter table t11 -reorganize partition s1 into -(partition p0 values less than (15), -partition p1 values less than maxvalue); -select * from t11 order by col1; -col1 -2006-01-17 -2006-02-06 -alter table t55 -partition by list(colint) -subpartition by hash(datediff(col1, '2006-01-01')) subpartitions 5 -(partition p0 values in (1,2,3,4,5,6,7,8,9,10), -partition p1 values in (11,12,13,14,15,16,17,18,19,20), -partition p2 values in (21,22,23,24,25,26,27,28,29,30), -partition p3 values in (31,32,33,34,35,36,37,38,39,40), -partition p4 values in (41,42,43,44,45,46,47,48,49,50), -partition p5 values in (51,52,53,54,55,56,57,58,59,60) -); -show create table t55; -Table Create Table -t55 CREATE TABLE `t55` ( - `colint` int(11) DEFAULT NULL, - `col1` date DEFAULT NULL -) ENGINE=MyISAM DEFAULT CHARSET=latin1 -/*!50100 PARTITION BY LIST (colint) -SUBPARTITION BY HASH (datediff(col1, '2006-01-01')) -SUBPARTITIONS 5 -(PARTITION p0 VALUES IN (1,2,3,4,5,6,7,8,9,10) ENGINE = MyISAM, - PARTITION p1 VALUES IN (11,12,13,14,15,16,17,18,19,20) ENGINE = MyISAM, - PARTITION p2 VALUES IN (21,22,23,24,25,26,27,28,29,30) ENGINE = MyISAM, - PARTITION p3 VALUES IN (31,32,33,34,35,36,37,38,39,40) ENGINE = MyISAM, - PARTITION p4 VALUES IN (41,42,43,44,45,46,47,48,49,50) ENGINE = MyISAM, - PARTITION p5 VALUES IN (51,52,53,54,55,56,57,58,59,60) ENGINE = MyISAM) */ -select * from t55 order by colint; -colint col1 -1 2006-02-06 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -alter table t66 -reorganize partition p0,p1 into -(partition s1 values less than maxvalue); -select * from t66 order by colint; -colint col1 -1 2006-02-06 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -alter table t66 -reorganize partition s1 into -(partition p0 values less than (datediff('2006-02-02', '2006-01-01')), -partition p1 values less than maxvalue); -select * from t66 order by colint; -colint col1 -1 2006-02-06 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -alter table t66 -reorganize partition p0,p1 into -(partition s1 values less than maxvalue); -select * from t66 order by colint; -colint col1 -1 2006-02-06 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -alter table t66 -reorganize partition s1 into -(partition p0 values less than (datediff('2006-02-02', '2006-01-01')), -partition p1 values less than maxvalue); -select * from t66 order by colint; -colint col1 -1 2006-02-06 -2 2006-01-17 -3 2006-01-25 -4 2006-02-05 -------------------------------------------------------------------------- ---- Delete rows and partitions of tables with datediff(col1, '2006-01-01') -------------------------------------------------------------------------- -delete from t1 where col1='2006-01-17'; -delete from t2 where col1='2006-01-17'; -delete from t3 where col1='2006-01-17'; -delete from t4 where col1='2006-01-17'; -delete from t5 where col1='2006-01-17'; -delete from t6 where col1='2006-01-17'; -select * from t1 order by col1; -col1 -2006-02-06 -select * from t2 order by col1; -col1 -2006-01-25 -2006-02-06 -select * from t3 order by col1; -col1 -2006-01-25 -2006-02-06 -select * from t4 order by colint; -colint col1 -1 2006-02-06 -3 2006-01-25 -4 2006-02-05 -select * from t5 order by colint; -colint col1 -1 2006-02-06 -3 2006-01-25 -4 2006-02-05 -insert into t1 values ('2006-01-17'); -insert into t2 values ('2006-01-17'); -insert into t3 values ('2006-01-17'); -insert into t4 values (60,'2006-01-17'); -insert into t5 values (60,'2006-01-17'); -insert into t6 values (60,'2006-01-17'); -select * from t1 order by col1; -col1 -2006-01-17 -2006-02-06 -select * from t2 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t3 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t4 order by colint; -colint col1 -1 2006-02-06 -3 2006-01-25 -4 2006-02-05 -60 2006-01-17 -select * from t5 order by colint; -colint col1 -1 2006-02-06 -3 2006-01-25 -4 2006-02-05 -60 2006-01-17 -select * from t6 order by colint; -colint col1 -1 2006-02-06 -3 2006-01-25 -4 2006-02-05 -60 2006-01-17 -alter table t1 drop partition p0; -alter table t2 drop partition p0; -alter table t4 drop partition p0; -alter table t5 drop partition p0; -alter table t6 drop partition p0; -select * from t1 order by col1; -col1 -2006-01-17 -2006-02-06 -select * from t2 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t3 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t4 order by colint; -colint col1 -60 2006-01-17 -select * from t5 order by colint; -colint col1 -60 2006-01-17 -select * from t6 order by colint; -colint col1 -60 2006-01-17 -------------------------------------------------------------------------- ---- Delete rows and partitions of tables with datediff(col1, '2006-01-01') -------------------------------------------------------------------------- -delete from t11 where col1='2006-01-17'; -delete from t22 where col1='2006-01-17'; -delete from t33 where col1='2006-01-17'; -delete from t44 where col1='2006-01-17'; -delete from t55 where col1='2006-01-17'; -delete from t66 where col1='2006-01-17'; -select * from t11 order by col1; -col1 -2006-02-06 -select * from t22 order by col1; -col1 -2006-01-25 -2006-02-06 -select * from t33 order by col1; -col1 -2006-01-25 -2006-02-06 -select * from t44 order by colint; -colint col1 -1 2006-02-06 -3 2006-01-25 -4 2006-02-05 -select * from t55 order by colint; -colint col1 -1 2006-02-06 -3 2006-01-25 -4 2006-02-05 -insert into t11 values ('2006-01-17'); -insert into t22 values ('2006-01-17'); -insert into t33 values ('2006-01-17'); -insert into t44 values (60,'2006-01-17'); -insert into t55 values (60,'2006-01-17'); -insert into t66 values (60,'2006-01-17'); -select * from t11 order by col1; -col1 -2006-01-17 -2006-02-06 -select * from t22 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t33 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t44 order by colint; -colint col1 -1 2006-02-06 -3 2006-01-25 -4 2006-02-05 -60 2006-01-17 -select * from t55 order by colint; -colint col1 -1 2006-02-06 -3 2006-01-25 -4 2006-02-05 -60 2006-01-17 -select * from t66 order by colint; -colint col1 -1 2006-02-06 -3 2006-01-25 -4 2006-02-05 -60 2006-01-17 -alter table t11 drop partition p0; -alter table t22 drop partition p0; -alter table t44 drop partition p0; -alter table t55 drop partition p0; -alter table t66 drop partition p0; -select * from t11 order by col1; -col1 -2006-01-17 -2006-02-06 -select * from t22 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t33 order by col1; -col1 -2006-01-17 -2006-01-25 -2006-02-06 -select * from t44 order by colint; -colint col1 -60 2006-01-17 -select * from t55 order by colint; -colint col1 -60 2006-01-17 -select * from t66 order by colint; -colint col1 -60 2006-01-17 -------------------------- ----- some alter table end -------------------------- -drop table if exists t1 ; -drop table if exists t2 ; -drop table if exists t3 ; -drop table if exists t4 ; -drop table if exists t5 ; -drop table if exists t6 ; -drop table if exists t11 ; -drop table if exists t22 ; -drop table if exists t33 ; -drop table if exists t44 ; -drop table if exists t55 ; -drop table if exists t66 ; -------------------------------------------------------------------------- --- weekday(col1) in partition with coltype date ------------------------------------------------------------------------- drop table if exists t1 ; diff --git a/mysql-test/t/partition.test b/mysql-test/t/partition.test index 86e2603cd01..0151820cef9 100644 --- a/mysql-test/t/partition.test +++ b/mysql-test/t/partition.test @@ -1821,15 +1821,16 @@ while ($cnt) drop table t1; # -# BUG#32272: partition crash 1: enum column +# BUG#32772: partition crash 1: enum column # +# Note that month(int_col) is disallowed after bug#54483. create table t1 ( c0 int, c1 bigint, c2 set('sweet'), key (c2,c1,c0), key(c0) -) engine=myisam partition by hash (month(c0)) partitions 5; +) engine=myisam partition by hash (c0) partitions 5; --disable_warnings insert ignore into t1 set c0 = -6502262, c1 = 3992917, c2 = 35019; diff --git a/mysql-test/t/partition_error.test b/mysql-test/t/partition_error.test index d3f10628254..b222b02252b 100644 --- a/mysql-test/t/partition_error.test +++ b/mysql-test/t/partition_error.test @@ -10,6 +10,670 @@ drop table if exists t1; let $MYSQLD_DATADIR= `SELECT @@datadir`; +--echo # +--echo # Bug#54483: valgrind errors when making warnings for multiline inserts +--echo # into partition +--echo # +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a VARBINARY(10)) +PARTITION BY RANGE (DAYOFWEEK(a)) +(PARTITION a1 VALUES LESS THAN (60)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a CHAR(10)) +PARTITION BY RANGE (DAYOFWEEK(a)) +(PARTITION a1 VALUES LESS THAN (60)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY RANGE (DAYOFWEEK(a)) +(PARTITION a1 VALUES LESS THAN (60)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a TIMESTAMP) +PARTITION BY RANGE (DAYOFWEEK(a)) +(PARTITION a1 VALUES LESS THAN (60)); +CREATE TABLE t1 (a DATE) +PARTITION BY RANGE (DAYOFWEEK(a)) +(PARTITION a1 VALUES LESS THAN (60)); +INSERT INTO t1 VALUES ('test'),('a'),('5'); +SHOW WARNINGS; +DROP TABLE t1; +CREATE TABLE t1 (a DATETIME) +PARTITION BY RANGE (DAYOFWEEK(a)) +(PARTITION a1 VALUES LESS THAN (60)); +INSERT INTO t1 VALUES ('test'),('a'),('5'); +SHOW WARNINGS; +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a TIME) +PARTITION BY RANGE (DAYOFWEEK(a)) +(PARTITION a1 VALUES LESS THAN (60)); +SHOW WARNINGS; + +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (TO_DAYS(a)); +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (TO_DAYS(a)); +DROP TABLE t1; +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (TO_DAYS(a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (TO_DAYS(a)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a INT) +PARTITION BY HASH (TO_DAYS(a)); + +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (DAYOFMONTH(a)); +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (DAYOFMONTH(a)); +DROP TABLE t1; +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (DAYOFMONTH(a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (DAYOFMONTH(a)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a INT) +PARTITION BY HASH (DAYOFMONTH(a)); + +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (MONTH(a)); +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (MONTH(a)); +DROP TABLE t1; +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (MONTH(a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (MONTH(a)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a INT) +PARTITION BY HASH (MONTH(a)); + +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (DAYOFYEAR(a)); +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (DAYOFYEAR(a)); +DROP TABLE t1; +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (DAYOFYEAR(a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (DAYOFYEAR(a)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a INT) +PARTITION BY HASH (DAYOFYEAR(a)); + +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (HOUR(a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (HOUR(a)); +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (HOUR(a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (HOUR(a)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a INT) +PARTITION BY HASH (HOUR(a)); + +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (MINUTE(a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (MINUTE(a)); +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (MINUTE(a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (MINUTE(a)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a INT) +PARTITION BY HASH (MINUTE(a)); + +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (QUARTER(a)); +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (QUARTER(a)); +DROP TABLE t1; +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (QUARTER(a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (QUARTER(a)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a INT) +PARTITION BY HASH (QUARTER(a)); + +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (SECOND(a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (SECOND(a)); +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (SECOND(a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (SECOND(a)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a INT) +PARTITION BY HASH (SECOND(a)); + +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (YEARWEEK(a)); +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (YEARWEEK(a)); +DROP TABLE t1; +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (YEARWEEK(a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (YEARWEEK(a)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a INT) +PARTITION BY HASH (YEARWEEK(a)); + +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (WEEKDAY(a)); +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (WEEKDAY(a)); +DROP TABLE t1; +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (WEEKDAY(a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (WEEKDAY(a)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a INT) +PARTITION BY HASH (WEEKDAY(a)); +--echo # TO_SECONDS() is added in 5.5. + +--error ER_PARSE_ERROR +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (TO_SECONDS(a)); +#--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +#CREATE TABLE t1 (a TIME) +#PARTITION BY HASH (TO_SECONDS(a)); +#CREATE TABLE t1 (a DATE) +#PARTITION BY HASH (TO_SECONDS(a)); +#DROP TABLE t1; +#CREATE TABLE t1 (a DATETIME) +#PARTITION BY HASH (TO_SECONDS(a)); +#DROP TABLE t1; +#--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +#CREATE TABLE t1 (a VARCHAR(10)) +#PARTITION BY HASH (TO_SECONDS(a)); +#--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +#CREATE TABLE t1 (a INT) +#PARTITION BY HASH (TO_SECONDS(a)); + +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (TIME_TO_SEC(a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (TIME_TO_SEC(a)); +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (TIME_TO_SEC(a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (TIME_TO_SEC(a)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a INT) +PARTITION BY HASH (TIME_TO_SEC(a)); + +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (FROM_DAYS(a)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (FROM_DAYS(a)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (FROM_DAYS(a)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (TO_DAYS(FROM_DAYS(a))); +--error ER_PARTITION_FUNC_NOT_ALLOWED_ERROR +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (FROM_DAYS(a)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a INT) +PARTITION BY HASH (TO_DAYS(FROM_DAYS(a))); +--error ER_PARTITION_FUNC_NOT_ALLOWED_ERROR +CREATE TABLE t1 (a INT) +PARTITION BY HASH (FROM_DAYS(a)); + +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (MICROSECOND(a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (MICROSECOND(a)); +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (MICROSECOND(a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (MICROSECOND(a)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a INT) +PARTITION BY HASH (MICROSECOND(a)); +--echo # Bug#57071 +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 +(`date` date, + `extracted_week` int, + `yearweek` int, + `week` int, + `default_week_format` int) +PARTITION BY LIST (EXTRACT(WEEK FROM date) % 3) +(PARTITION p0 VALUES IN (0), + PARTITION p1 VALUES IN (1), + PARTITION p2 VALUES IN (2)); +CREATE TABLE t1 +(`date` date, + `extracted_week` int, + `yearweek` int, + `week` int, + `default_week_format` int); +SET @old_default_week_format := @@default_week_format; +SET default_week_format = 0; +INSERT INTO t1 VALUES ('2000-01-01', EXTRACT(WEEK FROM '2000-01-01'), YEARWEEK('2000-01-01'), WEEK('2000-01-01'), @@default_week_format); +SET default_week_format = 1; +INSERT INTO t1 VALUES ('2000-01-01', EXTRACT(WEEK FROM '2000-01-01'), YEARWEEK('2000-01-01'), WEEK('2000-01-01'), @@default_week_format); +SET default_week_format = 2; +INSERT INTO t1 VALUES ('2000-01-01', EXTRACT(WEEK FROM '2000-01-01'), YEARWEEK('2000-01-01'), WEEK('2000-01-01'), @@default_week_format); +SET default_week_format = 3; +INSERT INTO t1 VALUES ('2000-01-01', EXTRACT(WEEK FROM '2000-01-01'), YEARWEEK('2000-01-01'), WEEK('2000-01-01'), @@default_week_format); +SET default_week_format = 4; +INSERT INTO t1 VALUES ('2000-01-01', EXTRACT(WEEK FROM '2000-01-01'), YEARWEEK('2000-01-01'), WEEK('2000-01-01'), @@default_week_format); +SET default_week_format = 5; +INSERT INTO t1 VALUES ('2000-01-01', EXTRACT(WEEK FROM '2000-01-01'), YEARWEEK('2000-01-01'), WEEK('2000-01-01'), @@default_week_format); +SET default_week_format = 6; +INSERT INTO t1 VALUES ('2000-01-01', EXTRACT(WEEK FROM '2000-01-01'), YEARWEEK('2000-01-01'), WEEK('2000-01-01'), @@default_week_format); +SET default_week_format = 7; +INSERT INTO t1 VALUES ('2000-01-01', EXTRACT(WEEK FROM '2000-01-01'), YEARWEEK('2000-01-01'), WEEK('2000-01-01'), @@default_week_format); +SELECT * FROM t1; +SET default_week_format = @old_default_week_format; +DROP TABLE t1; + +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (EXTRACT(YEAR FROM a)); +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (EXTRACT(YEAR FROM a)); +DROP TABLE t1; +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (EXTRACT(YEAR FROM a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (EXTRACT(YEAR FROM a)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a INT) +PARTITION BY HASH (EXTRACT(YEAR FROM a)); + +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (EXTRACT(YEAR_MONTH FROM a)); +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (EXTRACT(YEAR_MONTH FROM a)); +DROP TABLE t1; +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (EXTRACT(YEAR_MONTH FROM a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (EXTRACT(YEAR_MONTH FROM a)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a INT) +PARTITION BY HASH (EXTRACT(YEAR_MONTH FROM a)); + +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (EXTRACT(QUARTER FROM a)); +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (EXTRACT(QUARTER FROM a)); +DROP TABLE t1; +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (EXTRACT(QUARTER FROM a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (EXTRACT(QUARTER FROM a)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a INT) +PARTITION BY HASH (EXTRACT(QUARTER FROM a)); + +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (EXTRACT(MONTH FROM a)); +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (EXTRACT(MONTH FROM a)); +DROP TABLE t1; +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (EXTRACT(MONTH FROM a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (EXTRACT(MONTH FROM a)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a INT) +PARTITION BY HASH (EXTRACT(MONTH FROM a)); + +--echo # EXTRACT(WEEK...) is disallowed, see bug#57071. +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (EXTRACT(WEEK FROM a)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (EXTRACT(WEEK FROM a)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (EXTRACT(WEEK FROM a)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (EXTRACT(WEEK FROM a)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a INT) +PARTITION BY HASH (EXTRACT(WEEK FROM a)); + +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (EXTRACT(DAY FROM a)); +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (EXTRACT(DAY FROM a)); +DROP TABLE t1; +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (EXTRACT(DAY FROM a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (EXTRACT(DAY FROM a)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a INT) +PARTITION BY HASH (EXTRACT(DAY FROM a)); + +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (EXTRACT(DAY_HOUR FROM a)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (EXTRACT(DAY_HOUR FROM a)); +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (EXTRACT(DAY_HOUR FROM a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (EXTRACT(DAY_HOUR FROM a)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a INT) +PARTITION BY HASH (EXTRACT(DAY_HOUR FROM a)); + +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (EXTRACT(DAY_MINUTE FROM a)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (EXTRACT(DAY_MINUTE FROM a)); +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (EXTRACT(DAY_MINUTE FROM a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (EXTRACT(DAY_MINUTE FROM a)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a INT) +PARTITION BY HASH (EXTRACT(DAY_MINUTE FROM a)); + +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (EXTRACT(DAY_SECOND FROM a)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (EXTRACT(DAY_SECOND FROM a)); +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (EXTRACT(DAY_SECOND FROM a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (EXTRACT(DAY_SECOND FROM a)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a INT) +PARTITION BY HASH (EXTRACT(DAY_SECOND FROM a)); + +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (EXTRACT(HOUR FROM a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (EXTRACT(HOUR FROM a)); +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (EXTRACT(HOUR FROM a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (EXTRACT(HOUR FROM a)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a INT) +PARTITION BY HASH (EXTRACT(HOUR FROM a)); + +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (EXTRACT(HOUR_MINUTE FROM a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (EXTRACT(HOUR_MINUTE FROM a)); +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (EXTRACT(HOUR_MINUTE FROM a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (EXTRACT(HOUR_MINUTE FROM a)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a INT) +PARTITION BY HASH (EXTRACT(HOUR_MINUTE FROM a)); + +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (EXTRACT(HOUR_SECOND FROM a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (EXTRACT(HOUR_SECOND FROM a)); +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (EXTRACT(HOUR_SECOND FROM a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (EXTRACT(HOUR_SECOND FROM a)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a INT) +PARTITION BY HASH (EXTRACT(HOUR_SECOND FROM a)); + +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (EXTRACT(MINUTE FROM a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (EXTRACT(MINUTE FROM a)); +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (EXTRACT(MINUTE FROM a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (EXTRACT(MINUTE FROM a)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a INT) +PARTITION BY HASH (EXTRACT(MINUTE FROM a)); + +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (EXTRACT(MINUTE_SECOND FROM a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (EXTRACT(MINUTE_SECOND FROM a)); +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (EXTRACT(MINUTE_SECOND FROM a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (EXTRACT(MINUTE_SECOND FROM a)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a INT) +PARTITION BY HASH (EXTRACT(MINUTE_SECOND FROM a)); + +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (EXTRACT(SECOND FROM a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (EXTRACT(SECOND FROM a)); +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (EXTRACT(SECOND FROM a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (EXTRACT(SECOND FROM a)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a INT) +PARTITION BY HASH (EXTRACT(SECOND FROM a)); + +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (EXTRACT(MICROSECOND FROM a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (EXTRACT(MICROSECOND FROM a)); +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (EXTRACT(MICROSECOND FROM a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (EXTRACT(MICROSECOND FROM a)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a INT) +PARTITION BY HASH (EXTRACT(MICROSECOND FROM a)); + +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (EXTRACT(DAY_MICROSECOND FROM a)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (EXTRACT(DAY_MICROSECOND FROM a)); +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (EXTRACT(DAY_MICROSECOND FROM a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (EXTRACT(DAY_MICROSECOND FROM a)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a INT) +PARTITION BY HASH (EXTRACT(DAY_MICROSECOND FROM a)); + +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (EXTRACT(HOUR_MICROSECOND FROM a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (EXTRACT(HOUR_MICROSECOND FROM a)); +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (EXTRACT(HOUR_MICROSECOND FROM a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (EXTRACT(HOUR_MICROSECOND FROM a)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a INT) +PARTITION BY HASH (EXTRACT(HOUR_MICROSECOND FROM a)); + +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (EXTRACT(MINUTE_MICROSECOND FROM a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (EXTRACT(MINUTE_MICROSECOND FROM a)); +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (EXTRACT(MINUTE_MICROSECOND FROM a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (EXTRACT(MINUTE_MICROSECOND FROM a)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a INT) +PARTITION BY HASH (EXTRACT(MINUTE_MICROSECOND FROM a)); + +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (EXTRACT(SECOND_MICROSECOND FROM a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (EXTRACT(SECOND_MICROSECOND FROM a)); +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (EXTRACT(SECOND_MICROSECOND FROM a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (EXTRACT(SECOND_MICROSECOND FROM a)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a INT) +PARTITION BY HASH (EXTRACT(SECOND_MICROSECOND FROM a)); + +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a TIME, b DATE) +PARTITION BY HASH (DATEDIFF(a, b)); +CREATE TABLE t1 (a DATE, b DATETIME) +PARTITION BY HASH (DATEDIFF(a, b)); +DROP TABLE t1; +CREATE TABLE t1 (a DATETIME, b DATE) +PARTITION BY HASH (DATEDIFF(a, b)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a DATE, b VARCHAR(10)) +PARTITION BY HASH (DATEDIFF(a, b)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a INT, b DATETIME) +PARTITION BY HASH (DATEDIFF(a, b)); + +CREATE TABLE t1 (a TIME) +PARTITION BY HASH (TIME_TO_SEC(a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a DATE) +PARTITION BY HASH (TIME_TO_SEC(a)); +CREATE TABLE t1 (a DATETIME) +PARTITION BY HASH (TIME_TO_SEC(a)); +DROP TABLE t1; +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a VARCHAR(10)) +PARTITION BY HASH (TIME_TO_SEC(a)); +--error ER_WRONG_EXPR_IN_PARTITION_FUNC_ERROR +CREATE TABLE t1 (a INT) +PARTITION BY HASH (TIME_TO_SEC(a)); + + --echo # --echo # Bug#49161: Out of memory; restart server and try again (needed 2 bytes) --echo # diff --git a/sql/item.h b/sql/item.h index fd85fc780af..c2dd2052303 100644 --- a/sql/item.h +++ b/sql/item.h @@ -966,11 +966,11 @@ public: virtual bool set_no_const_sub(uchar *arg) { return FALSE; } virtual Item *replace_equal_field(uchar * arg) { return this; } /* - Check if an expression value depends on the current timezone. Used by - partitioning code to reject timezone-dependent expressions in a - (sub)partitioning function. + Check if an expression value has allowed arguments, like DATE/DATETIME + for date functions. Also used by partitioning code to reject + timezone-dependent expressions in a (sub)partitioning function. */ - virtual bool is_timezone_dependent_processor(uchar *bool_arg) + virtual bool is_arguments_valid_processor(uchar *bool_arg) { return FALSE; } diff --git a/sql/item_func.h b/sql/item_func.h index 256348eee08..548db490ac1 100644 --- a/sql/item_func.h +++ b/sql/item_func.h @@ -189,6 +189,7 @@ public: null_value=1; return 0.0; } + bool has_timestamp_args() { DBUG_ASSERT(fixed == TRUE); @@ -200,6 +201,45 @@ public: } return FALSE; } + + bool has_date_args() + { + DBUG_ASSERT(fixed == TRUE); + for (uint i= 0; i < arg_count; i++) + { + if (args[i]->type() == Item::FIELD_ITEM && + (args[i]->field_type() == MYSQL_TYPE_DATE || + args[i]->field_type() == MYSQL_TYPE_DATETIME)) + return TRUE; + } + return FALSE; + } + + bool has_time_args() + { + DBUG_ASSERT(fixed == TRUE); + for (uint i= 0; i < arg_count; i++) + { + if (args[i]->type() == Item::FIELD_ITEM && + (args[i]->field_type() == MYSQL_TYPE_TIME || + args[i]->field_type() == MYSQL_TYPE_DATETIME)) + return TRUE; + } + return FALSE; + } + + bool has_datetime_args() + { + DBUG_ASSERT(fixed == TRUE); + for (uint i= 0; i < arg_count; i++) + { + if (args[i]->type() == Item::FIELD_ITEM && + args[i]->field_type() == MYSQL_TYPE_DATETIME) + return TRUE; + } + return FALSE; + } + /* We assume the result of any function that has a TIMESTAMP argument to be timezone-dependent, since a TIMESTAMP value in both numeric and string @@ -208,7 +248,7 @@ public: representation of a TIMESTAMP argument verbatim, and thus does not depend on the timezone. */ - virtual bool is_timezone_dependent_processor(uchar *bool_arg) + virtual bool is_arguments_valid_processor(uchar *bool_arg) { return has_timestamp_args(); } diff --git a/sql/item_timefunc.h b/sql/item_timefunc.h index ef86406e1be..8f951645c78 100644 --- a/sql/item_timefunc.h +++ b/sql/item_timefunc.h @@ -70,6 +70,10 @@ public: enum_monotonicity_info get_monotonicity_info() const; longlong val_int_endpoint(bool left_endp, bool *incl_endp); bool check_partition_func_processor(uchar *int_arg) {return FALSE;} + bool is_arguments_valid_processor(uchar *int_arg) + { + return !has_date_args(); + } }; @@ -86,6 +90,10 @@ public: maybe_null=1; } bool check_partition_func_processor(uchar *int_arg) {return FALSE;} + bool is_arguments_valid_processor(uchar *int_arg) + { + return !has_date_args(); + } }; @@ -111,6 +119,10 @@ public: maybe_null=1; } bool check_partition_func_processor(uchar *int_arg) {return FALSE;} + bool is_arguments_valid_processor(uchar *int_arg) + { + return !has_date_args(); + } }; @@ -140,6 +152,10 @@ public: maybe_null=1; } bool check_partition_func_processor(uchar *int_arg) {return FALSE;} + bool is_arguments_valid_processor(uchar *int_arg) + { + return !has_date_args(); + } }; @@ -156,6 +172,10 @@ public: maybe_null=1; } bool check_partition_func_processor(uchar *int_arg) {return FALSE;} + bool is_arguments_valid_processor(uchar *int_arg) + { + return !has_time_args(); + } }; @@ -172,6 +192,10 @@ public: maybe_null=1; } bool check_partition_func_processor(uchar *int_arg) {return FALSE;} + bool is_arguments_valid_processor(uchar *int_arg) + { + return !has_time_args(); + } }; @@ -188,6 +212,10 @@ public: maybe_null=1; } bool check_partition_func_processor(uchar *int_arg) {return FALSE;} + bool is_arguments_valid_processor(uchar *int_arg) + { + return !has_date_args(); + } }; @@ -204,6 +232,10 @@ public: maybe_null=1; } bool check_partition_func_processor(uchar *int_arg) {return FALSE;} + bool is_arguments_valid_processor(uchar *int_arg) + { + return !has_time_args(); + } }; @@ -234,6 +266,10 @@ public: maybe_null=1; } bool check_partition_func_processor(uchar *int_arg) {return FALSE;} + bool is_arguments_valid_processor(uchar *int_arg) + { + return !has_date_args(); + } }; @@ -252,6 +288,10 @@ public: maybe_null=1; } bool check_partition_func_processor(uchar *int_arg) {return FALSE;} + bool is_arguments_valid_processor(uchar *int_arg) + { + return !has_date_args(); + } }; @@ -282,6 +322,10 @@ public: maybe_null=1; } bool check_partition_func_processor(uchar *int_arg) {return FALSE;} + bool is_arguments_valid_processor(uchar *int_arg) + { + return !has_date_args(); + } }; class Item_func_dayname :public Item_func_weekday @@ -311,7 +355,7 @@ public: (and thus may not be used as a partitioning function) when its argument is NOT of the TIMESTAMP type. */ - bool is_timezone_dependent_processor(uchar *int_arg) + bool is_arguments_valid_processor(uchar *int_arg) { return !has_timestamp_args(); } @@ -335,6 +379,10 @@ public: max_length=10*MY_CHARSET_BIN_MB_MAXLEN; } bool check_partition_func_processor(uchar *int_arg) {return FALSE;} + bool is_arguments_valid_processor(uchar *int_arg) + { + return !has_time_args(); + } }; @@ -588,6 +636,10 @@ public: const char *func_name() const { return "from_days"; } bool get_date(MYSQL_TIME *res, uint fuzzy_date); bool check_partition_func_processor(uchar *int_arg) {return FALSE;} + bool is_arguments_valid_processor(uchar *int_arg) + { + return has_date_args() || has_time_args(); + } }; @@ -714,6 +766,42 @@ class Item_extract :public Item_int_func bool eq(const Item *item, bool binary_cmp) const; virtual void print(String *str, enum_query_type query_type); bool check_partition_func_processor(uchar *int_arg) {return FALSE;} + bool is_arguments_valid_processor(uchar *int_arg) + { + switch (int_type) { + case INTERVAL_YEAR: + case INTERVAL_YEAR_MONTH: + case INTERVAL_QUARTER: + case INTERVAL_MONTH: + /* case INTERVAL_WEEK: Not allowed as partitioning function, bug#57071 */ + case INTERVAL_DAY: + return !has_date_args(); + case INTERVAL_DAY_HOUR: + case INTERVAL_DAY_MINUTE: + case INTERVAL_DAY_SECOND: + case INTERVAL_DAY_MICROSECOND: + return !has_datetime_args(); + case INTERVAL_HOUR: + case INTERVAL_HOUR_MINUTE: + case INTERVAL_HOUR_SECOND: + case INTERVAL_MINUTE: + case INTERVAL_MINUTE_SECOND: + case INTERVAL_SECOND: + case INTERVAL_MICROSECOND: + case INTERVAL_HOUR_MICROSECOND: + case INTERVAL_MINUTE_MICROSECOND: + case INTERVAL_SECOND_MICROSECOND: + return !has_time_args(); + default: + /* + INTERVAL_LAST is only an end marker, + INTERVAL_WEEK depends on default_week_format which is a session + variable and cannot be used for partitioning. See bug#57071. + */ + break; + } + return true; + } }; @@ -964,6 +1052,10 @@ public: maybe_null=1; } bool check_partition_func_processor(uchar *int_arg) {return FALSE;} + bool is_arguments_valid_processor(uchar *int_arg) + { + return !has_time_args(); + } }; diff --git a/sql/sql_partition.cc b/sql/sql_partition.cc index 7b0c47865d8..52bc7507cc4 100644 --- a/sql/sql_partition.cc +++ b/sql/sql_partition.cc @@ -1019,7 +1019,7 @@ static bool fix_fields_part_func(THD *thd, Item* func_expr, TABLE *table, opening existing tables for easier maintenance. This exception should be deprecated at some point in future so that we always throw an error. */ - if (func_expr->walk(&Item::is_timezone_dependent_processor, + if (func_expr->walk(&Item::is_arguments_valid_processor, 0, NULL)) { if (is_create_table_ind) From d19c8ec930055e446cd7612b37dff871924bd9b6 Mon Sep 17 00:00:00 2001 From: MySQL Build Team Date: Wed, 9 Feb 2011 22:01:35 +0100 Subject: [PATCH 099/202] Backport into build-201102032246-5.1.52sp1 > ------------------------------------------------------------ > revno: 3527.3.2 > revision-id: mattias.jonsson@oracle.com-20101222144517-cbv3l5jlbd0mq5s8 > parent: mattias.jonsson@oracle.com-20101222095036-2lpx0gqu4i45jtkz > committer: Mattias Jonsson > branch nick: b54483-51-bt_2 > timestamp: Wed 2010-12-22 15:45:17 +0100 > message: > Bug#54483: valgrind errors when making warnings for > multiline inserts into partition > Bug#57071: EXTRACT(WEEK from date_col) cannot be > allowed as partitioning function > > Renamed function according to reviewers comments. --- sql/item.h | 2 +- sql/item_func.h | 2 +- sql/item_timefunc.h | 32 ++++++++++++++++---------------- sql/sql_partition.cc | 11 ++++++----- 4 files changed, 24 insertions(+), 23 deletions(-) diff --git a/sql/item.h b/sql/item.h index c2dd2052303..e55f24dba5a 100644 --- a/sql/item.h +++ b/sql/item.h @@ -970,7 +970,7 @@ public: for date functions. Also used by partitioning code to reject timezone-dependent expressions in a (sub)partitioning function. */ - virtual bool is_arguments_valid_processor(uchar *bool_arg) + virtual bool check_valid_arguments_processor(uchar *bool_arg) { return FALSE; } diff --git a/sql/item_func.h b/sql/item_func.h index 548db490ac1..f4828bc7244 100644 --- a/sql/item_func.h +++ b/sql/item_func.h @@ -248,7 +248,7 @@ public: representation of a TIMESTAMP argument verbatim, and thus does not depend on the timezone. */ - virtual bool is_arguments_valid_processor(uchar *bool_arg) + virtual bool check_valid_arguments_processor(uchar *bool_arg) { return has_timestamp_args(); } diff --git a/sql/item_timefunc.h b/sql/item_timefunc.h index 8f951645c78..fafa267a190 100644 --- a/sql/item_timefunc.h +++ b/sql/item_timefunc.h @@ -70,7 +70,7 @@ public: enum_monotonicity_info get_monotonicity_info() const; longlong val_int_endpoint(bool left_endp, bool *incl_endp); bool check_partition_func_processor(uchar *int_arg) {return FALSE;} - bool is_arguments_valid_processor(uchar *int_arg) + bool check_valid_arguments_processor(uchar *int_arg) { return !has_date_args(); } @@ -90,7 +90,7 @@ public: maybe_null=1; } bool check_partition_func_processor(uchar *int_arg) {return FALSE;} - bool is_arguments_valid_processor(uchar *int_arg) + bool check_valid_arguments_processor(uchar *int_arg) { return !has_date_args(); } @@ -119,7 +119,7 @@ public: maybe_null=1; } bool check_partition_func_processor(uchar *int_arg) {return FALSE;} - bool is_arguments_valid_processor(uchar *int_arg) + bool check_valid_arguments_processor(uchar *int_arg) { return !has_date_args(); } @@ -152,7 +152,7 @@ public: maybe_null=1; } bool check_partition_func_processor(uchar *int_arg) {return FALSE;} - bool is_arguments_valid_processor(uchar *int_arg) + bool check_valid_arguments_processor(uchar *int_arg) { return !has_date_args(); } @@ -172,7 +172,7 @@ public: maybe_null=1; } bool check_partition_func_processor(uchar *int_arg) {return FALSE;} - bool is_arguments_valid_processor(uchar *int_arg) + bool check_valid_arguments_processor(uchar *int_arg) { return !has_time_args(); } @@ -192,7 +192,7 @@ public: maybe_null=1; } bool check_partition_func_processor(uchar *int_arg) {return FALSE;} - bool is_arguments_valid_processor(uchar *int_arg) + bool check_valid_arguments_processor(uchar *int_arg) { return !has_time_args(); } @@ -212,7 +212,7 @@ public: maybe_null=1; } bool check_partition_func_processor(uchar *int_arg) {return FALSE;} - bool is_arguments_valid_processor(uchar *int_arg) + bool check_valid_arguments_processor(uchar *int_arg) { return !has_date_args(); } @@ -232,7 +232,7 @@ public: maybe_null=1; } bool check_partition_func_processor(uchar *int_arg) {return FALSE;} - bool is_arguments_valid_processor(uchar *int_arg) + bool check_valid_arguments_processor(uchar *int_arg) { return !has_time_args(); } @@ -266,7 +266,7 @@ public: maybe_null=1; } bool check_partition_func_processor(uchar *int_arg) {return FALSE;} - bool is_arguments_valid_processor(uchar *int_arg) + bool check_valid_arguments_processor(uchar *int_arg) { return !has_date_args(); } @@ -288,7 +288,7 @@ public: maybe_null=1; } bool check_partition_func_processor(uchar *int_arg) {return FALSE;} - bool is_arguments_valid_processor(uchar *int_arg) + bool check_valid_arguments_processor(uchar *int_arg) { return !has_date_args(); } @@ -322,7 +322,7 @@ public: maybe_null=1; } bool check_partition_func_processor(uchar *int_arg) {return FALSE;} - bool is_arguments_valid_processor(uchar *int_arg) + bool check_valid_arguments_processor(uchar *int_arg) { return !has_date_args(); } @@ -355,7 +355,7 @@ public: (and thus may not be used as a partitioning function) when its argument is NOT of the TIMESTAMP type. */ - bool is_arguments_valid_processor(uchar *int_arg) + bool check_valid_arguments_processor(uchar *int_arg) { return !has_timestamp_args(); } @@ -379,7 +379,7 @@ public: max_length=10*MY_CHARSET_BIN_MB_MAXLEN; } bool check_partition_func_processor(uchar *int_arg) {return FALSE;} - bool is_arguments_valid_processor(uchar *int_arg) + bool check_valid_arguments_processor(uchar *int_arg) { return !has_time_args(); } @@ -636,7 +636,7 @@ public: const char *func_name() const { return "from_days"; } bool get_date(MYSQL_TIME *res, uint fuzzy_date); bool check_partition_func_processor(uchar *int_arg) {return FALSE;} - bool is_arguments_valid_processor(uchar *int_arg) + bool check_valid_arguments_processor(uchar *int_arg) { return has_date_args() || has_time_args(); } @@ -766,7 +766,7 @@ class Item_extract :public Item_int_func bool eq(const Item *item, bool binary_cmp) const; virtual void print(String *str, enum_query_type query_type); bool check_partition_func_processor(uchar *int_arg) {return FALSE;} - bool is_arguments_valid_processor(uchar *int_arg) + bool check_valid_arguments_processor(uchar *int_arg) { switch (int_type) { case INTERVAL_YEAR: @@ -1052,7 +1052,7 @@ public: maybe_null=1; } bool check_partition_func_processor(uchar *int_arg) {return FALSE;} - bool is_arguments_valid_processor(uchar *int_arg) + bool check_valid_arguments_processor(uchar *int_arg) { return !has_time_args(); } diff --git a/sql/sql_partition.cc b/sql/sql_partition.cc index 52bc7507cc4..91267c7f273 100644 --- a/sql/sql_partition.cc +++ b/sql/sql_partition.cc @@ -1014,12 +1014,13 @@ static bool fix_fields_part_func(THD *thd, Item* func_expr, TABLE *table, } /* - We don't allow creating partitions with timezone-dependent expressions as - a (sub)partitioning function, but we want to allow such expressions when - opening existing tables for easier maintenance. This exception should be - deprecated at some point in future so that we always throw an error. + We don't allow creating partitions with expressions with non matching + arguments as a (sub)partitioning function, + but we want to allow such expressions when opening existing tables for + easier maintenance. This exception should be deprecated at some point + in future so that we always throw an error. */ - if (func_expr->walk(&Item::is_arguments_valid_processor, + if (func_expr->walk(&Item::check_valid_arguments_processor, 0, NULL)) { if (is_create_table_ind) From 436b67e324b61ad3d4de6ea9368edd0e00817237 Mon Sep 17 00:00:00 2001 From: MySQL Build Team Date: Wed, 9 Feb 2011 22:02:48 +0100 Subject: [PATCH 100/202] Backport into build-201102032246-5.1.52sp1 > ------------------------------------------------------------ > revno: 3536 > revision-id: davi.arnaut@oracle.com-20110107183336-kp8niwm2hz3wb4c3 > parent: saikumar.v@sun.com-20110106103945-rhsek9uy6f63db44 > committer: Davi Arnaut > branch nick: 51023-5.1 > timestamp: Fri 2011-01-07 16:33:36 -0200 > message: > Bug#51023: Mysql server crashes on SIGHUP and destroys InnoDB files > > From a user perspective, the problem is that a FLUSH LOGS or SIGHUP > signal could end up associating the stdout and stderr to random > files. In the case of this bug report, the streams would end up > associated to InnoDB ibd files. > > The freopen(3) function is not thread-safe on FreeBSD. What this > means is that if another thread calls open(2) during freopen() > is executing that another thread's fd returned by open(2) may get > re-associated with the file being passed to freopen(3). See FreeBSD > PR number 79887 for reference: > > http://www.freebsd.org/cgi/query-pr.cgi?pr=79887 > > This problem is worked around by substituting a internal hook within > the FILE structure. This avoids the loss of atomicity by not having > the original fd closed before its duplicated. > > Patch based on the original work by Vasil Dimov. --- include/my_sys.h | 1 + mysys/my_fopen.c | 135 ++++++++++++++++++++++++++++++++++++++++++++++- sql/log.cc | 76 ++++---------------------- 3 files changed, 146 insertions(+), 66 deletions(-) diff --git a/include/my_sys.h b/include/my_sys.h index 3a240cfc118..43f66c73825 100644 --- a/include/my_sys.h +++ b/include/my_sys.h @@ -664,6 +664,7 @@ extern void init_glob_errs(void); extern void wait_for_free_space(const char *filename, int errors); extern FILE *my_fopen(const char *FileName,int Flags,myf MyFlags); extern FILE *my_fdopen(File Filedes,const char *name, int Flags,myf MyFlags); +extern FILE *my_freopen(const char *path, const char *mode, FILE *stream); extern int my_fclose(FILE *fd,myf MyFlags); extern int my_chsize(File fd,my_off_t newlength, int filler, myf MyFlags); extern int my_sync(File fd, myf my_flags); diff --git a/mysys/my_fopen.c b/mysys/my_fopen.c index 44156da6ae3..a822b63dd63 100644 --- a/mysys/my_fopen.c +++ b/mysys/my_fopen.c @@ -18,6 +18,10 @@ #include #include "mysys_err.h" +#if defined(__FreeBSD__) +extern int getosreldate(void); +#endif + static void make_ftype(char * to,int flag); /* @@ -97,8 +101,137 @@ FILE *my_fopen(const char *filename, int flags, myf MyFlags) } /* my_fopen */ - /* Close a stream */ +#if defined(_WIN32) +static FILE *my_win_freopen(const char *path, FILE *stream) +{ + int handle_fd, fd= _fileno(stream); + HANDLE osfh; + + DBUG_ASSERT(filename && stream); + + /* Services don't have stdout/stderr on Windows, so _fileno returns -1. */ + if (fd < 0) + { + if (!freopen(filename, mode, stream)) + return NULL; + + fd= _fileno(stream); + } + + if ((osfh= CreateFile(path, GENERIC_READ | GENERIC_WRITE, + FILE_SHARE_READ | FILE_SHARE_WRITE | + FILE_SHARE_DELETE, NULL, + OPEN_ALWAYS, FILE_ATTRIBUTE_NORMAL, + NULL)) == INVALID_HANDLE_VALUE) + return NULL; + + if ((handle_fd= _open_osfhandle((intptr_t)osfh, + _O_APPEND | _O_TEXT)) == -1) + { + CloseHandle(osfh); + return NULL; + } + + if (_dup2(handle_fd, fd) < 0) + { + CloseHandle(osfh); + return NULL; + } + + _close(handle_fd); + + return stream; +} + +#elif defined(__FreeBSD__) + +/* No close operation hook. */ + +static int no_close(void *cookie __attribute__((unused))) +{ + return 0; +} + +/* + A hack around a race condition in the implementation of freopen. + + The race condition steams from the fact that the current fd of + the stream is closed before its number is used to duplicate the + new file descriptor. This defeats the desired atomicity of the + close and duplicate of dup2(). + + See PR number 79887 for reference: + http://www.freebsd.org/cgi/query-pr.cgi?pr=79887 +*/ + +static FILE *my_freebsd_freopen(const char *path, const char *mode, FILE *stream) +{ + int old_fd; + FILE *result; + + flockfile(stream); + + old_fd= fileno(stream); + + /* Use a no operation close hook to avoid having the fd closed. */ + stream->_close= no_close; + + /* Relies on the implicit dup2 to close old_fd. */ + result= freopen(path, mode, stream); + + /* If successful, the _close hook was replaced. */ + + if (result == NULL) + close(old_fd); + else + funlockfile(result); + + return result; +} + +#endif + + +/** + Change the file associated with a file stream. + + @param path Path to file. + @param mode Mode of the stream. + @param stream File stream. + + @note + This function is used to redirect stdout and stderr to a file and + subsequently to close and reopen that file for log rotation. + + @retval A FILE pointer on success. Otherwise, NULL. +*/ + +FILE *my_freopen(const char *path, const char *mode, FILE *stream) +{ + FILE *result; + +#if defined(_WIN32) + result= my_win_freopen(path, mode, stream); +#elif defined(__FreeBSD__) + /* + XXX: Once the fix is ported to the stable releases, this should + be dependent upon the specific FreeBSD versions. Check at: + http://www.freebsd.org/cgi/query-pr.cgi?pr=79887 + */ + if (getosreldate() > 900027) + result= freopen(path, mode, stream); + else + result= my_freebsd_freopen(path, mode, stream); +#else + result= freopen(path, mode, stream); +#endif + + return result; +} + + +/* Close a stream */ int my_fclose(FILE *fd, myf MyFlags) { int err,file; diff --git a/sql/log.cc b/sql/log.cc index 56f151fe2ab..d6314da1e29 100644 --- a/sql/log.cc +++ b/sql/log.cc @@ -5067,80 +5067,26 @@ void sql_perror(const char *message) } -#ifdef __WIN__ +/* + Change the file associated with two output streams. Used to + redirect stdout and stderr to a file. The streams are reopened + only for appending (writing at end of file). +*/ extern "C" my_bool reopen_fstreams(const char *filename, FILE *outstream, FILE *errstream) { - int handle_fd; - int err_fd, out_fd; - HANDLE osfh; + if (outstream && !my_freopen(filename, "a", outstream)) + return TRUE; - DBUG_ASSERT(filename && errstream); - - // Services don't have stdout/stderr on Windows, so _fileno returns -1. - err_fd= _fileno(errstream); - if (err_fd < 0) - { - if (!freopen(filename, "a+", errstream)) - return TRUE; + if (errstream && !my_freopen(filename, "a", errstream)) + return TRUE; + /* The error stream must be unbuffered. */ + if (errstream) setbuf(errstream, NULL); - err_fd= _fileno(errstream); - } - - if (outstream) - { - out_fd= _fileno(outstream); - if (out_fd < 0) - { - if (!freopen(filename, "a+", outstream)) - return TRUE; - out_fd= _fileno(outstream); - } - } - - if ((osfh= CreateFile(filename, GENERIC_READ | GENERIC_WRITE, - FILE_SHARE_READ | FILE_SHARE_WRITE | - FILE_SHARE_DELETE, NULL, - OPEN_ALWAYS, FILE_ATTRIBUTE_NORMAL, - NULL)) == INVALID_HANDLE_VALUE) - return TRUE; - - if ((handle_fd= _open_osfhandle((intptr_t)osfh, - _O_APPEND | _O_TEXT)) == -1) - { - CloseHandle(osfh); - return TRUE; - } - - if (_dup2(handle_fd, err_fd) < 0) - { - CloseHandle(osfh); - return TRUE; - } - - if (outstream && _dup2(handle_fd, out_fd) < 0) - { - CloseHandle(osfh); - return TRUE; - } - - _close(handle_fd); - return FALSE; -} -#else -extern "C" my_bool reopen_fstreams(const char *filename, - FILE *outstream, FILE *errstream) -{ - if (outstream && !freopen(filename, "a+", outstream)) - return TRUE; - - if (errstream && !freopen(filename, "a+", errstream)) - return TRUE; return FALSE; } -#endif /* From 5ac3c5dea35185a1f94eedd60cee2a6f0d39dd7b Mon Sep 17 00:00:00 2001 From: MySQL Build Team Date: Wed, 9 Feb 2011 22:04:11 +0100 Subject: [PATCH 101/202] Backport into build-201102032246-5.1.52sp1 > ------------------------------------------------------------ > revno: 3537 > revision-id: davi.arnaut@oracle.com-20110107192806-rmvvxwhk10sy0219 > parent: davi.arnaut@oracle.com-20110107183336-kp8niwm2hz3wb4c3 > committer: Davi Arnaut > branch nick: mysql-5.1 > timestamp: Fri 2011-01-07 17:28:06 -0200 > message: > Bug#51023: Mysql server crashes on SIGHUP and destroys InnoDB files > > WIN32 compilation fixes: define ETIMEDOUT only if not available and > fix typos and add a missing parameter. --- include/my_pthread.h | 4 +++- mysys/my_fopen.c | 6 +++--- 2 files changed, 6 insertions(+), 4 deletions(-) diff --git a/include/my_pthread.h b/include/my_pthread.h index fec7c972a7b..d64c7d2199e 100644 --- a/include/my_pthread.h +++ b/include/my_pthread.h @@ -126,7 +126,9 @@ struct tm *gmtime_r(const time_t *timep,struct tm *tmp); void pthread_exit(void *a); /* was #define pthread_exit(A) ExitThread(A)*/ -#define ETIMEDOUT 145 /* Win32 doesn't have this */ +#ifndef ETIMEDOUT +#define ETIMEDOUT 145 /* Win32 might not have this */ +#endif #define getpid() GetCurrentThreadId() #define HAVE_LOCALTIME_R 1 #define _REENTRANT 1 diff --git a/mysys/my_fopen.c b/mysys/my_fopen.c index a822b63dd63..b8373ecb3ab 100644 --- a/mysys/my_fopen.c +++ b/mysys/my_fopen.c @@ -103,17 +103,17 @@ FILE *my_fopen(const char *filename, int flags, myf MyFlags) #if defined(_WIN32) -static FILE *my_win_freopen(const char *path, FILE *stream) +static FILE *my_win_freopen(const char *path, const char *mode, FILE *stream) { int handle_fd, fd= _fileno(stream); HANDLE osfh; - DBUG_ASSERT(filename && stream); + DBUG_ASSERT(path && stream); /* Services don't have stdout/stderr on Windows, so _fileno returns -1. */ if (fd < 0) { - if (!freopen(filename, mode, stream)) + if (!freopen(path, mode, stream)) return NULL; fd= _fileno(stream); From 6497b7aa4dfac482a559eefa294499f3f658a02f Mon Sep 17 00:00:00 2001 From: MySQL Build Team Date: Wed, 9 Feb 2011 22:06:24 +0100 Subject: [PATCH 102/202] Backport into build-201102032246-5.1.52sp1 > ------------------------------------------------------------ > revno: 3545 > revision-id: holyfoot@mysql.com-20110112130241-50lwmhq562otxw31 > parent: dmitry.lenev@oracle.com-20110112130830-csanweanbny2ua3n > committer: Alexey Botchkov > branch nick: 51mrg > timestamp: Wed 2011-01-12 17:02:41 +0400 > message: > Bug #57321 crashes and valgrind errors from spatial types > Item_func_spatial_collection::fix_length_and_dec didn't call parent's method, so > the maybe_null was set to '0' after it. But in this case the result was > just NULL, that caused wrong behaviour. > > per-file comments: > mysql-test/r/gis.result > Bug #57321 crashes and valgrind errors from spatial types > test result updated. > > mysql-test/t/gis.test > Bug #57321 crashes and valgrind errors from spatial types > test case added. > sql/item_geofunc.h > Bug #57321 crashes and valgrind errors from spatial types > Item_func_geometry::fix_length_and_dec() called in > Item_func_spatial_collection::fix_length_and_dec(). --- mysql-test/r/gis.result | 8 ++++++++ mysql-test/t/gis.test | 10 ++++++++++ sql/item_geofunc.h | 1 + 3 files changed, 19 insertions(+) diff --git a/mysql-test/r/gis.result b/mysql-test/r/gis.result index 3b18ee61336..f4aa361ffcf 100644 --- a/mysql-test/r/gis.result +++ b/mysql-test/r/gis.result @@ -1014,4 +1014,12 @@ SET @a=0x00000000030000000100000000000000000000000000144000000000000014400000000 SET @a=POLYFROMWKB(@a); SET @a=0x00000000030000000000000000000000000000000000144000000000000014400000000000001840000000000000184000000000000014400000000000001440; SET @a=POLYFROMWKB(@a); +create table t1(a polygon NOT NULL)engine=myisam; +insert into t1 values (geomfromtext("point(0 1)")); +insert into t1 values (geomfromtext("point(1 0)")); +select * from (select polygon(t1.a) as p from t1 order by t1.a) d; +p +NULL +NULL +drop table t1; End of 5.1 tests diff --git a/mysql-test/t/gis.test b/mysql-test/t/gis.test index fd0a18ab4dd..97fc6f94b6a 100644 --- a/mysql-test/t/gis.test +++ b/mysql-test/t/gis.test @@ -744,4 +744,14 @@ SET @a=0x00000000030000000000000000000000000000000000144000000000000014400000000 SET @a=POLYFROMWKB(@a); +# +# Bug #57321 crashes and valgrind errors from spatial types +# + +create table t1(a polygon NOT NULL)engine=myisam; +insert into t1 values (geomfromtext("point(0 1)")); +insert into t1 values (geomfromtext("point(1 0)")); +select * from (select polygon(t1.a) as p from t1 order by t1.a) d; +drop table t1; + --echo End of 5.1 tests diff --git a/sql/item_geofunc.h b/sql/item_geofunc.h index b3ecbc39933..08161badfd3 100644 --- a/sql/item_geofunc.h +++ b/sql/item_geofunc.h @@ -177,6 +177,7 @@ public: String *val_str(String *); void fix_length_and_dec() { + Item_geometry_func::fix_length_and_dec(); for (unsigned int i= 0; i < arg_count; ++i) { if (args[i]->fixed && args[i]->field_type() != MYSQL_TYPE_GEOMETRY) From 39f85a447681d9f67180c979223e7a571bfd7fd1 Mon Sep 17 00:00:00 2001 From: MySQL Build Team Date: Wed, 9 Feb 2011 22:14:11 +0100 Subject: [PATCH 103/202] removing EXCEPTIONS-CLIENT --- README | 3 +-- 1 file changed, 1 insertion(+), 2 deletions(-) diff --git a/README b/README index ac92d77f8bd..5c81817e74e 100644 --- a/README +++ b/README @@ -2,8 +2,7 @@ This is a release of MySQL, a dual-license SQL DBMS. MySQL is brought to you by the MySQL team at Oracle Corporation. License information can be found in these files: -- For GPL (free) distributions, see the COPYING file and - the EXCEPTIONS-CLIENT file. +- For GPL (free) distributions, see the COPYING file. - For commercial distributions, see the LICENSE.mysql file. GPLv2 Disclaimer From 6b736a7f0fd10b1df4e363b6ec5c9d2399378561 Mon Sep 17 00:00:00 2001 From: MySQL Build Team Date: Wed, 9 Feb 2011 23:07:08 +0100 Subject: [PATCH 104/202] adding macro definition for MY_GNUC_PREREQ --- include/my_compiler.h | 18 +++++++++++++++++- 1 file changed, 17 insertions(+), 1 deletion(-) diff --git a/include/my_compiler.h b/include/my_compiler.h index 1cd46ff4260..5f898621159 100644 --- a/include/my_compiler.h +++ b/include/my_compiler.h @@ -32,8 +32,15 @@ /* GNU C/C++ */ #if defined __GNUC__ +/* Convenience macro to test the minimum required GCC version. */ +# define MY_GNUC_PREREQ(maj, min) \ + ((__GNUC__ << 16) + __GNUC_MINOR__ >= ((maj) << 16) + (min)) /* Any after 2.95... */ # define MY_ALIGN_EXT +/* Comunicate to the compiler the unreachability of the code. */ +# if MY_GNUC_PREREQ(4,5) +# define MY_ASSERT_UNREACHABLE() __builtin_unreachable() +# endif /* Microsoft Visual C++ */ #elif defined _MSC_VER @@ -67,8 +74,13 @@ #endif /** - Generic compiler-dependent features. + Generic (compiler-independent) features. */ + +#ifndef MY_GNUC_PREREQ +# define MY_GNUC_PREREQ(maj, min) (0) +#endif + #ifndef MY_ALIGNOF # ifdef __cplusplus template struct my_alignof_helper { char m1; type m2; }; @@ -79,6 +91,10 @@ # endif #endif +#ifndef MY_ASSERT_UNREACHABLE +# define MY_ASSERT_UNREACHABLE() do { assert(0); } while (0) +#endif + /** C++ Type Traits */ From 8aa7e213dc7127bc334087eed5dbcd17e2865a47 Mon Sep 17 00:00:00 2001 From: Vasil Dimov Date: Thu, 10 Feb 2011 13:21:22 +0200 Subject: [PATCH 105/202] Increment InnoDB Plugin version from 1.0.15 to 1.0.16. InnoDB Plugin 1.0.15 has been released with MySQL 5.1.55. --- storage/innodb_plugin/include/univ.i | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) diff --git a/storage/innodb_plugin/include/univ.i b/storage/innodb_plugin/include/univ.i index 6dd38df3782..22ed765e680 100644 --- a/storage/innodb_plugin/include/univ.i +++ b/storage/innodb_plugin/include/univ.i @@ -46,7 +46,7 @@ Created 1/20/1994 Heikki Tuuri #define INNODB_VERSION_MAJOR 1 #define INNODB_VERSION_MINOR 0 -#define INNODB_VERSION_BUGFIX 15 +#define INNODB_VERSION_BUGFIX 16 /* The following is the InnoDB version as shown in SELECT plugin_version FROM information_schema.plugins; From b5c61ed1f25001e6a967bc2e70273d61bd22bab6 Mon Sep 17 00:00:00 2001 From: Vasil Dimov Date: Thu, 10 Feb 2011 17:16:32 +0200 Subject: [PATCH 106/202] Fix Bug#59307 Valgrind: uninitialized value in rw_lock_set_writer_id_and_recursion_flag() by silencing a bogus Valgrind warning: ==4392== Conditional jump or move depends on uninitialised value(s) ==4392== at 0x5A18416: rw_lock_set_writer_id_and_recursion_flag (sync0rw.ic:283) ==4392== by 0x5A1865C: rw_lock_x_lock_low (sync0rw.c:558) ==4392== by 0x5A18481: rw_lock_x_lock_func (sync0rw.c:617) ==4392== by 0x597EEE6: mtr_x_lock_func (mtr0mtr.ic:271) ==4392== by 0x597EBBD: fsp_header_init (fsp0fsp.c:970) ==4392== by 0x5A15E78: innobase_start_or_create_for_mysql (srv0start.c:1508) ==4392== by 0x598B789: innobase_init(void*) (ha_innodb.cc:2282) os_compare_and_swap_thread_id() is defined as __sync_bool_compare_and_swap(). From the GCC doc: `bool __sync_bool_compare_and_swap (TYPE *ptr, TYPE oldval TYPE newval, ...)' ... The "bool" version returns true if the comparison is successful and NEWVAL was written. So it is not possible that the return value is uninitialized, no matter what the arguments to os_compare_and_swap_thread_id() are. Probably Valgrind gets confused by the implementation of the GCC internal function __sync_bool_compare_and_swap(). --- storage/innodb_plugin/include/sync0rw.ic | 1 + 1 file changed, 1 insertion(+) diff --git a/storage/innodb_plugin/include/sync0rw.ic b/storage/innodb_plugin/include/sync0rw.ic index 7116f1b7c9b..4110a0a7e0c 100644 --- a/storage/innodb_plugin/include/sync0rw.ic +++ b/storage/innodb_plugin/include/sync0rw.ic @@ -280,6 +280,7 @@ rw_lock_set_writer_id_and_recursion_flag( local_thread = lock->writer_thread; success = os_compare_and_swap_thread_id( &lock->writer_thread, local_thread, curr_thread); + UNIV_MEM_VALID(&success, sizeof(success)); ut_a(success); lock->recursive = recursive; From 867217156d43b6f6f7ace569a093b829cccaf5e3 Mon Sep 17 00:00:00 2001 From: Georgi Kodinov Date: Fri, 11 Feb 2011 12:09:04 +0200 Subject: [PATCH 107/202] version bump to 5.1.57 --- configure.in | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) diff --git a/configure.in b/configure.in index 6d5bc07ba9a..dc944386f22 100644 --- a/configure.in +++ b/configure.in @@ -12,7 +12,7 @@ dnl dnl When changing the major version number please also check the switch dnl statement in mysqlbinlog::check_master_version(). You may also need dnl to update version.c in ndb. -AC_INIT([MySQL Server], [5.1.56], [], [mysql]) +AC_INIT([MySQL Server], [5.1.57], [], [mysql]) AC_CONFIG_SRCDIR([sql/mysqld.cc]) AC_CANONICAL_SYSTEM From 4a8c83574626f4107ca84964f4c1faa13176eff1 Mon Sep 17 00:00:00 2001 From: Jimmy Yang Date: Mon, 14 Feb 2011 02:07:59 -0800 Subject: [PATCH 108/202] Fix Bug #59749 Enabling concurrent reads while creating non-primary unique index gives failures. Approved by Marko --- storage/innodb_plugin/ChangeLog | 6 ++++++ storage/innodb_plugin/handler/handler0alter.cc | 12 ++++++++---- 2 files changed, 14 insertions(+), 4 deletions(-) diff --git a/storage/innodb_plugin/ChangeLog b/storage/innodb_plugin/ChangeLog index 0cbdc8ed9d2..9fa00ac8e6f 100644 --- a/storage/innodb_plugin/ChangeLog +++ b/storage/innodb_plugin/ChangeLog @@ -1,3 +1,9 @@ +2011-02-14 The InnoDB Team + + * handler/handler0alter.cc: + Bug#59749 Enabling concurrent reads while creating non-primary + unique index gives failures + 2011-01-31 The InnoDB Team * btr/btr0cur.c, include/row0upd.h, diff --git a/storage/innodb_plugin/handler/handler0alter.cc b/storage/innodb_plugin/handler/handler0alter.cc index 517445f7e69..dc1317d5c5a 100644 --- a/storage/innodb_plugin/handler/handler0alter.cc +++ b/storage/innodb_plugin/handler/handler0alter.cc @@ -782,10 +782,6 @@ err_exit: ut_ad(error == DB_SUCCESS); - /* We will need to rebuild index translation table. Set - valid index entry count in the translation table to zero */ - share->idx_trans_tbl.index_count = 0; - /* Commit the data dictionary transaction in order to release the table locks on the system tables. This means that if MySQL crashes while creating a new primary key inside @@ -911,6 +907,14 @@ error: } convert_error: + if (error == DB_SUCCESS) { + /* Build index is successful. We will need to + rebuild index translation table. Reset the + index entry count in the translation table + to zero, so that translation table will be rebuilt */ + share->idx_trans_tbl.index_count = 0; + } + error = convert_error_code_to_mysql(error, innodb_table->flags, user_thd); From 0efaef7d469eb6decdd8cf17057154914a10fd41 Mon Sep 17 00:00:00 2001 From: =?UTF-8?q?Marko=20M=C3=A4kel=C3=A4?= Date: Tue, 15 Feb 2011 10:51:33 +0200 Subject: [PATCH 109/202] Bug#59307 Valgrind: uninitialized value in rw_lock_set_writer_id_and_recursion_flag() rw_lock_create_func(): Initialize lock->writer_thread, so that Valgrind will not complain even when Valgrind instrumentation is not enabled. Flag lock->writer_thread uninitialized, so that Valgrind can complain when it is used uninitialized. rw_lock_set_writer_id_and_recursion_flag(): Revert the bogus Valgrind instrumentation that was pushed in the first attempt to fix this bug. --- .../innodb_plugin/r/innodb_bug59307.result | 28 ++++++++++++++++ .../innodb_plugin/t/innodb_bug59307.test | 32 +++++++++++++++++++ storage/innodb_plugin/ChangeLog | 6 ++++ storage/innodb_plugin/include/sync0rw.ic | 1 - storage/innodb_plugin/sync/sync0rw.c | 3 ++ 5 files changed, 69 insertions(+), 1 deletion(-) create mode 100644 mysql-test/suite/innodb_plugin/r/innodb_bug59307.result create mode 100644 mysql-test/suite/innodb_plugin/t/innodb_bug59307.test diff --git a/mysql-test/suite/innodb_plugin/r/innodb_bug59307.result b/mysql-test/suite/innodb_plugin/r/innodb_bug59307.result new file mode 100644 index 00000000000..0d726e83708 --- /dev/null +++ b/mysql-test/suite/innodb_plugin/r/innodb_bug59307.result @@ -0,0 +1,28 @@ +CREATE TABLE t1 ( +t1_int INT, +t1_time TIME +) ENGINE=innodb; +CREATE TABLE t2 ( +t2_int int PRIMARY KEY, +t2_int2 INT +) ENGINE=INNODB; +INSERT INTO t2 VALUES (); +Warnings: +Warning 1364 Field 't2_int' doesn't have a default value +INSERT INTO t1 VALUES (); +SELECT * +FROM t1 AS t1a +WHERE NOT EXISTS +(SELECT * +FROM t1 AS t1b +WHERE t1b.t1_int NOT IN +(SELECT t2.t2_int +FROM t2 +WHERE t1b.t1_time LIKE t1b.t1_int +OR t1b.t1_time <> t2.t2_int2 +AND 6=7 +) +) +; +t1_int t1_time +DROP TABLE t1,t2; diff --git a/mysql-test/suite/innodb_plugin/t/innodb_bug59307.test b/mysql-test/suite/innodb_plugin/t/innodb_bug59307.test new file mode 100644 index 00000000000..9c68adf36cf --- /dev/null +++ b/mysql-test/suite/innodb_plugin/t/innodb_bug59307.test @@ -0,0 +1,32 @@ +-- source include/have_innodb_plugin.inc +# Bug #59307 uninitialized value in rw_lock_set_writer_id_and_recursion_flag() +# when Valgrind instrumentation (UNIV_DEBUG_VALGRIND) is not enabled + +CREATE TABLE t1 ( + t1_int INT, + t1_time TIME +) ENGINE=innodb; + +CREATE TABLE t2 ( + t2_int int PRIMARY KEY, + t2_int2 INT +) ENGINE=INNODB; + +INSERT INTO t2 VALUES (); +INSERT INTO t1 VALUES (); + +SELECT * +FROM t1 AS t1a +WHERE NOT EXISTS + (SELECT * + FROM t1 AS t1b + WHERE t1b.t1_int NOT IN + (SELECT t2.t2_int + FROM t2 + WHERE t1b.t1_time LIKE t1b.t1_int + OR t1b.t1_time <> t2.t2_int2 + AND 6=7 + ) +) +; +DROP TABLE t1,t2; diff --git a/storage/innodb_plugin/ChangeLog b/storage/innodb_plugin/ChangeLog index 9fa00ac8e6f..1b2747ab012 100644 --- a/storage/innodb_plugin/ChangeLog +++ b/storage/innodb_plugin/ChangeLog @@ -1,3 +1,9 @@ +2011-02-15 The InnoDB Team + + * sync/sync0rw.c, innodb_bug59307.test: + Bug#59307 Valgrind: uninitialized value in + rw_lock_set_writer_id_and_recursion_flag() + 2011-02-14 The InnoDB Team * handler/handler0alter.cc: diff --git a/storage/innodb_plugin/include/sync0rw.ic b/storage/innodb_plugin/include/sync0rw.ic index 4110a0a7e0c..7116f1b7c9b 100644 --- a/storage/innodb_plugin/include/sync0rw.ic +++ b/storage/innodb_plugin/include/sync0rw.ic @@ -280,7 +280,6 @@ rw_lock_set_writer_id_and_recursion_flag( local_thread = lock->writer_thread; success = os_compare_and_swap_thread_id( &lock->writer_thread, local_thread, curr_thread); - UNIV_MEM_VALID(&success, sizeof(success)); ut_a(success); lock->recursive = recursive; diff --git a/storage/innodb_plugin/sync/sync0rw.c b/storage/innodb_plugin/sync/sync0rw.c index 00e0324becd..a5da606ad80 100644 --- a/storage/innodb_plugin/sync/sync0rw.c +++ b/storage/innodb_plugin/sync/sync0rw.c @@ -260,6 +260,9 @@ rw_lock_create_func( contains garbage at initialization and cannot be used for recursive x-locking. */ lock->recursive = FALSE; + /* Silence Valgrind when UNIV_DEBUG_VALGRIND is not enabled. */ + memset((void*) &lock->writer_thread, 0, sizeof lock->writer_thread); + UNIV_MEM_INVALID(&lock->writer_thread, sizeof lock->writer_thread); #ifdef UNIV_SYNC_DEBUG UT_LIST_INIT(lock->debug_list); From cb884043b6ea225c0093c2ae5dba7575214fac49 Mon Sep 17 00:00:00 2001 From: =?UTF-8?q?Marko=20M=C3=A4kel=C3=A4?= Date: Tue, 15 Feb 2011 12:12:27 +0200 Subject: [PATCH 110/202] Add a test for suspected Bug#60049. --- .../suite/innodb/r/innodb_bug60049.result | 8 ++++ .../suite/innodb/t/innodb_bug60049-master.opt | 1 + .../suite/innodb/t/innodb_bug60049.test | 38 +++++++++++++++++++ .../innodb_plugin/r/innodb_bug60049.result | 8 ++++ .../t/innodb_bug60049-master.opt | 1 + .../innodb_plugin/t/innodb_bug60049.test | 38 +++++++++++++++++++ 6 files changed, 94 insertions(+) create mode 100644 mysql-test/suite/innodb/r/innodb_bug60049.result create mode 100644 mysql-test/suite/innodb/t/innodb_bug60049-master.opt create mode 100644 mysql-test/suite/innodb/t/innodb_bug60049.test create mode 100644 mysql-test/suite/innodb_plugin/r/innodb_bug60049.result create mode 100644 mysql-test/suite/innodb_plugin/t/innodb_bug60049-master.opt create mode 100644 mysql-test/suite/innodb_plugin/t/innodb_bug60049.test diff --git a/mysql-test/suite/innodb/r/innodb_bug60049.result b/mysql-test/suite/innodb/r/innodb_bug60049.result new file mode 100644 index 00000000000..bec0e05a897 --- /dev/null +++ b/mysql-test/suite/innodb/r/innodb_bug60049.result @@ -0,0 +1,8 @@ +CREATE TABLE t(a INT)ENGINE=InnoDB; +RENAME TABLE t TO u; +DROP TABLE u; +SELECT @@innodb_fast_shutdown; +@@innodb_fast_shutdown +0 +Last record of ID_IND root page (9): +1808000018050074000000000000000c5359535f464f524549474e5f434f4c53 diff --git a/mysql-test/suite/innodb/t/innodb_bug60049-master.opt b/mysql-test/suite/innodb/t/innodb_bug60049-master.opt new file mode 100644 index 00000000000..22a5d4ed221 --- /dev/null +++ b/mysql-test/suite/innodb/t/innodb_bug60049-master.opt @@ -0,0 +1 @@ +--innodb_fast_shutdown=0 diff --git a/mysql-test/suite/innodb/t/innodb_bug60049.test b/mysql-test/suite/innodb/t/innodb_bug60049.test new file mode 100644 index 00000000000..1e0feaf0c89 --- /dev/null +++ b/mysql-test/suite/innodb/t/innodb_bug60049.test @@ -0,0 +1,38 @@ +# Bug #60049 Verify that purge leaves no garbage in unique secondary indexes +# This test requires a fresh server start-up and a slow shutdown. +# This was a suspected bug (not a bug). + +-- source include/have_innodb.inc + +CREATE TABLE t(a INT)ENGINE=InnoDB; +RENAME TABLE t TO u; +DROP TABLE u; +SELECT @@innodb_fast_shutdown; +let $MYSQLD_DATADIR=`select @@datadir`; + +# Shut down the server +-- exec echo "wait" > $MYSQLTEST_VARDIR/tmp/mysqld.1.expect +-- shutdown_server 10 +-- source include/wait_until_disconnected.inc + +# Check the tail of ID_IND (SYS_TABLES.ID) +let IBDATA1=$MYSQLD_DATADIR/ibdata1; +perl; +my $file = $ENV{'IBDATA1'}; +open(FILE, "<$file") || die "Unable to open $file"; +# Read DICT_HDR_TABLE_IDS, the root page number of ID_IND (SYS_TABLES.ID). +seek(FILE, 7*16384+38+36, 0) || die "Unable to seek $file"; +die unless read(FILE, $_, 4) == 4; +my $sys_tables_id_root = unpack "N"; +print "Last record of ID_IND root page ($sys_tables_id_root):\n"; +# This should be the last record in ID_IND. Dump it in hexadecimal. +seek(FILE, $sys_tables_id_root*16384 + 152, 0) || die "Unable to seek $file"; +read(FILE, $_, 32) || die "Unable to read $file"; +close(FILE); +print unpack("H*"),"\n"; +EOF + +# Restart the server. +-- exec echo "restart" > $MYSQLTEST_VARDIR/tmp/mysqld.1.expect +-- enable_reconnect +-- source include/wait_until_connected_again.inc diff --git a/mysql-test/suite/innodb_plugin/r/innodb_bug60049.result b/mysql-test/suite/innodb_plugin/r/innodb_bug60049.result new file mode 100644 index 00000000000..bec0e05a897 --- /dev/null +++ b/mysql-test/suite/innodb_plugin/r/innodb_bug60049.result @@ -0,0 +1,8 @@ +CREATE TABLE t(a INT)ENGINE=InnoDB; +RENAME TABLE t TO u; +DROP TABLE u; +SELECT @@innodb_fast_shutdown; +@@innodb_fast_shutdown +0 +Last record of ID_IND root page (9): +1808000018050074000000000000000c5359535f464f524549474e5f434f4c53 diff --git a/mysql-test/suite/innodb_plugin/t/innodb_bug60049-master.opt b/mysql-test/suite/innodb_plugin/t/innodb_bug60049-master.opt new file mode 100644 index 00000000000..22a5d4ed221 --- /dev/null +++ b/mysql-test/suite/innodb_plugin/t/innodb_bug60049-master.opt @@ -0,0 +1 @@ +--innodb_fast_shutdown=0 diff --git a/mysql-test/suite/innodb_plugin/t/innodb_bug60049.test b/mysql-test/suite/innodb_plugin/t/innodb_bug60049.test new file mode 100644 index 00000000000..0c093ac94b1 --- /dev/null +++ b/mysql-test/suite/innodb_plugin/t/innodb_bug60049.test @@ -0,0 +1,38 @@ +# Bug #60049 Verify that purge leaves no garbage in unique secondary indexes +# This test requires a fresh server start-up and a slow shutdown. +# This was a suspected bug (not a bug). + +-- source include/have_innodb_plugin.inc + +CREATE TABLE t(a INT)ENGINE=InnoDB; +RENAME TABLE t TO u; +DROP TABLE u; +SELECT @@innodb_fast_shutdown; +let $MYSQLD_DATADIR=`select @@datadir`; + +# Shut down the server +-- exec echo "wait" > $MYSQLTEST_VARDIR/tmp/mysqld.1.expect +-- shutdown_server 10 +-- source include/wait_until_disconnected.inc + +# Check the tail of ID_IND (SYS_TABLES.ID) +let IBDATA1=$MYSQLD_DATADIR/ibdata1; +perl; +my $file = $ENV{'IBDATA1'}; +open(FILE, "<$file") || die "Unable to open $file"; +# Read DICT_HDR_TABLE_IDS, the root page number of ID_IND (SYS_TABLES.ID). +seek(FILE, 7*16384+38+36, 0) || die "Unable to seek $file"; +die unless read(FILE, $_, 4) == 4; +my $sys_tables_id_root = unpack "N"; +print "Last record of ID_IND root page ($sys_tables_id_root):\n"; +# This should be the last record in ID_IND. Dump it in hexadecimal. +seek(FILE, $sys_tables_id_root*16384 + 152, 0) || die "Unable to seek $file"; +read(FILE, $_, 32) || die "Unable to read $file"; +close(FILE); +print unpack("H*"),"\n"; +EOF + +# Restart the server. +-- exec echo "restart" > $MYSQLTEST_VARDIR/tmp/mysqld.1.expect +-- enable_reconnect +-- source include/wait_until_connected_again.inc From 9c89cca5e364310928bde10287a56128378c107c Mon Sep 17 00:00:00 2001 From: Dmitry Lenev Date: Tue, 15 Feb 2011 14:03:05 +0300 Subject: [PATCH 111/202] Fix for bug#11766714 (former bug @59888) "debug assertion when attempt to create spatial index on char > 31 bytes". Attempt to create spatial index on char field with length greater than 31 byte led to assertion failure on server compiled with safemutex support. The problem occurred in mi_create() function which was called to create a new version of table being altered. This function failed since it detected an attempt to create a spatial key on non-binary column and tried to return an error. On its error path it tried to unlock THR_LOCK_myisam mutex which has not been not locked at this point. Indeed such an incorrect behavior was caught by safemutex wrapper and caused assertion failure. This patch fixes the problem by ensuring that mi_create() doesn't releases THR_LOCK_myisam mutex on error path if it was not acquired. mysql-test/r/gis.result: Added test for bug @59888 "debug assertion when attempt to create spatial index on char > 31 bytes". mysql-test/t/gis.test: Added test for bug @59888 "debug assertion when attempt to create spatial index on char > 31 bytes". storage/myisam/mi_create.c: Changed mi_create() not to release THR_LOCK_myisam mutex on error path if it was not acquired. --- mysql-test/r/gis.result | 8 ++++++++ mysql-test/t/gis.test | 12 ++++++++++++ storage/myisam/mi_create.c | 16 +++++++++------- 3 files changed, 29 insertions(+), 7 deletions(-) diff --git a/mysql-test/r/gis.result b/mysql-test/r/gis.result index a9beb9631ae..d82a86a6423 100644 --- a/mysql-test/r/gis.result +++ b/mysql-test/r/gis.result @@ -1034,4 +1034,12 @@ p NULL NULL drop table t1; +# +# Test for bug #59888 "debug assertion when attempt to create spatial index +# on char > 31 bytes". +# +create table t1(a char(32) not null) engine=myisam; +create spatial index i on t1 (a); +ERROR HY000: Can't create table '#sql-temporary' (errno: 140) +drop table t1; End of 5.1 tests diff --git a/mysql-test/t/gis.test b/mysql-test/t/gis.test index bdbbfc7c064..94cec60944a 100644 --- a/mysql-test/t/gis.test +++ b/mysql-test/t/gis.test @@ -754,4 +754,16 @@ insert into t1 values (geomfromtext("point(1 0)")); select * from (select polygon(t1.a) as p from t1 order by t1.a) d; drop table t1; + +--echo # +--echo # Test for bug #59888 "debug assertion when attempt to create spatial index +--echo # on char > 31 bytes". +--echo # +create table t1(a char(32) not null) engine=myisam; +--replace_regex /'[^']*test\.#sql-[0-9a-f_]*'/'#sql-temporary'/ +--error ER_CANT_CREATE_TABLE +create spatial index i on t1 (a); +drop table t1; + + --echo End of 5.1 tests diff --git a/storage/myisam/mi_create.c b/storage/myisam/mi_create.c index 42bd8e26a94..8c83996cadf 100644 --- a/storage/myisam/mi_create.c +++ b/storage/myisam/mi_create.c @@ -272,7 +272,7 @@ int mi_create(const char *name,uint keys,MI_KEYDEF *keydefs, keyseg->type != HA_KEYTYPE_VARBINARY2) { my_errno=HA_WRONG_CREATE_OPTION; - goto err; + goto err_no_lock; } } keydef->keysegs+=sp_segs; @@ -281,7 +281,7 @@ int mi_create(const char *name,uint keys,MI_KEYDEF *keydefs, min_key_length_skip+=SPLEN*2*SPDIMS; #else my_errno= HA_ERR_UNSUPPORTED; - goto err; + goto err_no_lock; #endif /*HAVE_SPATIAL*/ } else if (keydef->flag & HA_FULLTEXT) @@ -297,7 +297,7 @@ int mi_create(const char *name,uint keys,MI_KEYDEF *keydefs, keyseg->type != HA_KEYTYPE_VARTEXT2) { my_errno=HA_WRONG_CREATE_OPTION; - goto err; + goto err_no_lock; } if (!(keyseg->flag & HA_BLOB_PART) && (keyseg->type == HA_KEYTYPE_VARTEXT1 || @@ -422,7 +422,7 @@ int mi_create(const char *name,uint keys,MI_KEYDEF *keydefs, if (keydef->keysegs > MI_MAX_KEY_SEG) { my_errno=HA_WRONG_CREATE_OPTION; - goto err; + goto err_no_lock; } /* key_segs may be 0 in the case when we only want to be able to @@ -447,7 +447,7 @@ int mi_create(const char *name,uint keys,MI_KEYDEF *keydefs, length >= MI_MAX_KEY_BUFF) { my_errno=HA_WRONG_CREATE_OPTION; - goto err; + goto err_no_lock; } set_if_bigger(max_key_block_length,keydef->block_length); keydef->keylength= (uint16) key_length; @@ -494,7 +494,7 @@ int mi_create(const char *name,uint keys,MI_KEYDEF *keydefs, "indexes and/or unique constraints.", MYF(0), name + dirname_length(name)); my_errno= HA_WRONG_CREATE_OPTION; - goto err; + goto err_no_lock; } bmove(share.state.header.file_version,(uchar*) myisam_file_magic,4); @@ -827,12 +827,14 @@ int mi_create(const char *name,uint keys,MI_KEYDEF *keydefs, errpos=0; pthread_mutex_unlock(&THR_LOCK_myisam); if (my_close(file,MYF(0))) - goto err; + goto err_no_lock; my_free((char*) rec_per_key_part,MYF(0)); DBUG_RETURN(0); err: pthread_mutex_unlock(&THR_LOCK_myisam); + +err_no_lock: save_errno=my_errno; switch (errpos) { case 3: From 6459e2c3e1e53c5ead7e8420dc3ccc2cf8015e88 Mon Sep 17 00:00:00 2001 From: =?UTF-8?q?Marko=20M=C3=A4kel=C3=A4?= Date: Wed, 16 Feb 2011 15:34:16 +0200 Subject: [PATCH 112/202] Make the implicit unpack parameter explicit in the Bug #60049 test. --- mysql-test/suite/innodb/t/innodb_bug60049.test | 4 ++-- mysql-test/suite/innodb_plugin/t/innodb_bug60049.test | 4 ++-- 2 files changed, 4 insertions(+), 4 deletions(-) diff --git a/mysql-test/suite/innodb/t/innodb_bug60049.test b/mysql-test/suite/innodb/t/innodb_bug60049.test index 1e0feaf0c89..cff1c3dc09d 100644 --- a/mysql-test/suite/innodb/t/innodb_bug60049.test +++ b/mysql-test/suite/innodb/t/innodb_bug60049.test @@ -23,13 +23,13 @@ open(FILE, "<$file") || die "Unable to open $file"; # Read DICT_HDR_TABLE_IDS, the root page number of ID_IND (SYS_TABLES.ID). seek(FILE, 7*16384+38+36, 0) || die "Unable to seek $file"; die unless read(FILE, $_, 4) == 4; -my $sys_tables_id_root = unpack "N"; +my $sys_tables_id_root = unpack("N", $_); print "Last record of ID_IND root page ($sys_tables_id_root):\n"; # This should be the last record in ID_IND. Dump it in hexadecimal. seek(FILE, $sys_tables_id_root*16384 + 152, 0) || die "Unable to seek $file"; read(FILE, $_, 32) || die "Unable to read $file"; close(FILE); -print unpack("H*"),"\n"; +print unpack("H*", $_), "\n"; EOF # Restart the server. diff --git a/mysql-test/suite/innodb_plugin/t/innodb_bug60049.test b/mysql-test/suite/innodb_plugin/t/innodb_bug60049.test index 0c093ac94b1..b3557243235 100644 --- a/mysql-test/suite/innodb_plugin/t/innodb_bug60049.test +++ b/mysql-test/suite/innodb_plugin/t/innodb_bug60049.test @@ -23,13 +23,13 @@ open(FILE, "<$file") || die "Unable to open $file"; # Read DICT_HDR_TABLE_IDS, the root page number of ID_IND (SYS_TABLES.ID). seek(FILE, 7*16384+38+36, 0) || die "Unable to seek $file"; die unless read(FILE, $_, 4) == 4; -my $sys_tables_id_root = unpack "N"; +my $sys_tables_id_root = unpack("N", $_); print "Last record of ID_IND root page ($sys_tables_id_root):\n"; # This should be the last record in ID_IND. Dump it in hexadecimal. seek(FILE, $sys_tables_id_root*16384 + 152, 0) || die "Unable to seek $file"; read(FILE, $_, 32) || die "Unable to read $file"; close(FILE); -print unpack("H*"),"\n"; +print unpack("H*", $_), "\n"; EOF # Restart the server. From 6ad0c9b16daccb64ec34dffc8a21e73ca9c6073d Mon Sep 17 00:00:00 2001 From: Jon Olav Hauglid Date: Wed, 16 Feb 2011 16:26:19 +0100 Subject: [PATCH 113/202] Bug #11752069 (former bug 43152) Assertion `bitmap_is_set_all(&table->s->all_set)' failed in handler::ha_reset This assertion could be triggered if two connections simultaneously executed two bitmap test functions on the same bitmap. For example, the assertion could be triggered if one connection executed UPDATE while a second connection executed SELECT on the same table. Even if bitmap test functions have read-only semantics and have const bitmaps as parameter, several of them modified the internal state of the bitmap. With interleaved execution of two such functions it was possible for one function to modify the state of the same bitmap that the other function had just modified. This lead to an inconsistent state and could trigger the assert. Internally the bitmap uses 32 bit words for storage. Since bitmaps can contain any number of bits, the last word in the bitmap may not be fully used. A 32 bit mask is maintained where a bit is set if the corresponding bit in the last bitmap word is unused. The problem was that several test functions applied this mask to the last word. Sometimes the mask was negated and used to zero out the remainder of the last word and sometimes the mask was used as-is to fill the remainder of the last word with 1's. This meant that if a function first used the negated mask and another function then used the mask as-is (or vice-versa), the first function would then get the wrong result. This patch fixes the problem by changing the implementation of 9 bitmap functions that modified the bitmap state even if the bitmap was declared const. These functions now preserve the internal state of the bitmap. This makes it possible for two connections to concurrently execute two of these functions on the same bitmap without issues. The patch also removes dead testing code from my_bitmap.c. These tests have already been moved to unittest/mysys/bitmap-t.c. Existing test coverage of my_bitmap has been extended. No MTR test case added as this would require adding several sync points to the bitmap functions. The patch has been tested with a non-deterministic test case posted on the bug report. include/my_bit.h: Removed my_count_bits_ushort() which is not needed anymore. Added my_count_bits_uint32(). unittest/mysys/bitmap-t.c: Extended test coverage of my_bitmap. --- include/my_bit.h | 24 +- include/my_bitmap.h | 9 +- mysys/my_bitmap.c | 629 +++++++++----------------------------- unittest/mysys/bitmap-t.c | 173 ++++++++++- 4 files changed, 328 insertions(+), 507 deletions(-) diff --git a/include/my_bit.h b/include/my_bit.h index 2e464e89049..2ab47b04184 100644 --- a/include/my_bit.h +++ b/include/my_bit.h @@ -1,3 +1,18 @@ +/* Copyright (c) 2007, 2011, Oracle and/or its affiliates. All rights reserved. + + This program is free software; you can redistribute it and/or modify + it under the terms of the GNU General Public License as published by + the Free Software Foundation; version 2 of the License. + + This program is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the + GNU General Public License for more details. + + You should have received a copy of the GNU General Public License + along with this program; if not, write to the Free Software + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA */ + /* Some useful bit functions */ @@ -42,9 +57,12 @@ STATIC_INLINE uint my_count_bits(ulonglong v) #endif } -STATIC_INLINE uint my_count_bits_ushort(ushort v) +STATIC_INLINE uint my_count_bits_uint32(uint32 v) { - return _my_bits_nbits[v]; + return (uint) (uchar) (_my_bits_nbits[(uchar) v] + + _my_bits_nbits[(uchar) (v >> 8)] + + _my_bits_nbits[(uchar) (v >> 16)] + + _my_bits_nbits[(uchar) (v >> 24)]); } @@ -104,6 +122,6 @@ extern uint32 my_round_up_to_next_power(uint32 v); uint32 my_clear_highest_bit(uint32 v); uint32 my_reverse_bits(uint32 key); extern uint my_count_bits(ulonglong v); -extern uint my_count_bits_ushort(ushort v); +extern uint my_count_bits_uint32(uint32 v); #endif /* HAVE_INLINE */ C_MODE_END diff --git a/include/my_bitmap.h b/include/my_bitmap.h index ab69b2d671d..42f985c8918 100644 --- a/include/my_bitmap.h +++ b/include/my_bitmap.h @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by @@ -149,9 +149,10 @@ bitmap_is_set(const MY_BITMAP *map,uint bit) static inline my_bool bitmap_cmp(const MY_BITMAP *map1, const MY_BITMAP *map2) { - *(map1)->last_word_ptr|= (map1)->last_word_mask; - *(map2)->last_word_ptr|= (map2)->last_word_mask; - return memcmp((map1)->bitmap, (map2)->bitmap, 4*no_words_in_map((map1)))==0; + if (memcmp(map1->bitmap, map2->bitmap, 4*(no_words_in_map(map1)-1)) != 0) + return FALSE; + return ((*map1->last_word_ptr | map1->last_word_mask) == + (*map2->last_word_ptr | map2->last_word_mask)); } #define bitmap_clear_all(MAP) \ diff --git a/mysys/my_bitmap.c b/mysys/my_bitmap.c index b7258080337..3d3ab16b599 100644 --- a/mysys/my_bitmap.c +++ b/mysys/my_bitmap.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by @@ -91,6 +91,7 @@ static inline void bitmap_lock(MY_BITMAP *map __attribute__((unused))) #endif } + static inline void bitmap_unlock(MY_BITMAP *map __attribute__((unused))) { #ifdef THREAD @@ -100,6 +101,46 @@ static inline void bitmap_unlock(MY_BITMAP *map __attribute__((unused))) } +static inline uint get_first_set(uint32 value, uint word_pos) +{ + uchar *byte_ptr= (uchar*)&value; + uchar byte_value; + uint byte_pos, bit_pos; + + for (byte_pos=0; byte_pos < 4; byte_pos++, byte_ptr++) + { + byte_value= *byte_ptr; + if (byte_value) + { + for (bit_pos=0; ; bit_pos++) + if (byte_value & (1 << bit_pos)) + return (word_pos*32) + (byte_pos*8) + bit_pos; + } + } + return MY_BIT_NONE; +} + + +static inline uint get_first_not_set(uint32 value, uint word_pos) +{ + uchar *byte_ptr= (uchar*)&value; + uchar byte_value; + uint byte_pos, bit_pos; + + for (byte_pos=0; byte_pos < 4; byte_pos++, byte_ptr++) + { + byte_value= *byte_ptr; + if (byte_value != 0xFF) + { + for (bit_pos=0; ; bit_pos++) + if (!(byte_value & (1 << bit_pos))) + return (word_pos*32) + (byte_pos*8) + bit_pos; + } + } + return MY_BIT_NONE; +} + + my_bool bitmap_init(MY_BITMAP *map, my_bitmap_map *buf, uint n_bits, my_bool thread_safe __attribute__((unused))) { @@ -259,7 +300,7 @@ void bitmap_set_prefix(MY_BITMAP *map, uint prefix_size) memset(m, 0xff, prefix_bytes); m+= prefix_bytes; if ((prefix_bits= prefix_size & 7)) - *m++= (1 << prefix_bits)-1; + *(m++)= (1 << prefix_bits)-1; if ((d= no_bytes_in_map(map)-prefix_bytes)) bzero(m, d); } @@ -267,28 +308,43 @@ void bitmap_set_prefix(MY_BITMAP *map, uint prefix_size) my_bool bitmap_is_prefix(const MY_BITMAP *map, uint prefix_size) { - uint prefix_bits= prefix_size & 0x7, res; - uchar *m= (uchar*)map->bitmap; - uchar *end_prefix= m+prefix_size/8; - uchar *end; - DBUG_ASSERT(m && prefix_size <= map->n_bits); - end= m+no_bytes_in_map(map); + uint prefix_bits= prefix_size % 32; + my_bitmap_map *word_ptr= map->bitmap, last_word; + my_bitmap_map *end_prefix= word_ptr + prefix_size / 32; + DBUG_ASSERT(word_ptr && prefix_size <= map->n_bits); - while (m < end_prefix) - if (*m++ != 0xff) - return 0; + /* 1: Words that should be filled with 1 */ + for (; word_ptr < end_prefix; word_ptr++) + if (*word_ptr != 0xFFFFFFFF) + return FALSE; - *map->last_word_ptr&= ~map->last_word_mask; /*Clear bits*/ - res= 0; - if (prefix_bits && *m++ != (1 << prefix_bits)-1) - goto ret; + last_word= *map->last_word_ptr & ~map->last_word_mask; - while (m < end) - if (*m++ != 0) - goto ret; - res= 1; -ret: - return res; + /* 2: Word which contains the end of the prefix (if any) */ + if (prefix_bits) + { + if (word_ptr == map->last_word_ptr) + return uint4korr((uchar*)&last_word) == (uint32)((1 << prefix_bits) - 1); + else if (uint4korr((uchar*)word_ptr) != (uint32)((1 << prefix_bits) - 1)) + return FALSE; + word_ptr++; + } + + /* 3: Words that should be filled with 0 */ + for (; word_ptr < map->last_word_ptr; word_ptr++) + if (*word_ptr != 0) + return FALSE; + + /* + We can end up here in two situations: + 1) We went through the whole bitmap in step 1. This will happen if the + whole bitmap is filled with 1 and prefix_size is a multiple of 32 + (i.e. the prefix does not end in the middle of a word). + In this case word_ptr will be larger than map->last_word_ptr. + 2) We have gone through steps 1-3 and just need to check that also + the last word is 0. + */ + return word_ptr > map->last_word_ptr || last_word == 0; } @@ -296,10 +352,12 @@ my_bool bitmap_is_set_all(const MY_BITMAP *map) { my_bitmap_map *data_ptr= map->bitmap; my_bitmap_map *end= map->last_word_ptr; - *map->last_word_ptr |= map->last_word_mask; - for (; data_ptr <= end; data_ptr++) + + for (; data_ptr < end; data_ptr++) if (*data_ptr != 0xFFFFFFFF) return FALSE; + if ((*map->last_word_ptr | map->last_word_mask) != 0xFFFFFFFF) + return FALSE; return TRUE; } @@ -307,13 +365,13 @@ my_bool bitmap_is_set_all(const MY_BITMAP *map) my_bool bitmap_is_clear_all(const MY_BITMAP *map) { my_bitmap_map *data_ptr= map->bitmap; - my_bitmap_map *end; - if (*map->last_word_ptr & ~map->last_word_mask) - return FALSE; - end= map->last_word_ptr; + my_bitmap_map *end= map->last_word_ptr; + for (; data_ptr < end; data_ptr++) if (*data_ptr) return FALSE; + if (*map->last_word_ptr & ~map->last_word_mask) + return FALSE; return TRUE; } @@ -327,14 +385,14 @@ my_bool bitmap_is_subset(const MY_BITMAP *map1, const MY_BITMAP *map2) map1->n_bits==map2->n_bits); end= map1->last_word_ptr; - *map1->last_word_ptr &= ~map1->last_word_mask; - *map2->last_word_ptr &= ~map2->last_word_mask; - while (m1 <= end) - { - if ((*m1++) & ~(*m2++)) - return 0; - } - return 1; + for (; m1 < end; m1++, m2++) + if (*m1 & ~(*m2)) + return FALSE; + + if ((*map1->last_word_ptr & ~map1->last_word_mask) & + ~(*map2->last_word_ptr & ~map2->last_word_mask)) + return FALSE; + return TRUE; } /* True if bitmaps has any common bits */ @@ -347,14 +405,14 @@ my_bool bitmap_is_overlapping(const MY_BITMAP *map1, const MY_BITMAP *map2) map1->n_bits==map2->n_bits); end= map1->last_word_ptr; - *map1->last_word_ptr &= ~map1->last_word_mask; - *map2->last_word_ptr &= ~map2->last_word_mask; - while (m1 <= end) - { - if ((*m1++) & (*m2++)) - return 1; - } - return 0; + for (; m1 < end; m1++, m2++) + if (*m1 & *m2) + return TRUE; + + if ((*map1->last_word_ptr & ~map1->last_word_mask) & + (*map2->last_word_ptr & ~map2->last_word_mask)) + return TRUE; + return FALSE; } @@ -366,15 +424,17 @@ void bitmap_intersect(MY_BITMAP *map, const MY_BITMAP *map2) DBUG_ASSERT(map->bitmap && map2->bitmap); end= to+min(len,len2); - *map2->last_word_ptr&= ~map2->last_word_mask; /*Clear last bits in map2*/ - while (to < end) - *to++ &= *from++; + for (; to < end; to++, from++) + *to &= *from; + + if (len >= len2) + map->bitmap[len2 - 1] &= ~map2->last_word_mask; if (len2 < len) { end+=len-len2; - while (to < end) - *to++=0; + for (; to < end; to++) + *to= 0; } } @@ -405,8 +465,8 @@ void bitmap_set_above(MY_BITMAP *map, uint from_byte, uint use_bit) uchar *to= (uchar *)map->bitmap + from_byte; uchar *end= (uchar *)map->bitmap + (map->n_bits+7)/8; - while (to < end) - *to++= use_byte; + for (; to < end; to++) + *to= use_byte; } @@ -415,59 +475,60 @@ void bitmap_subtract(MY_BITMAP *map, const MY_BITMAP *map2) my_bitmap_map *to= map->bitmap, *from= map2->bitmap, *end; DBUG_ASSERT(map->bitmap && map2->bitmap && map->n_bits==map2->n_bits); - end= map->last_word_ptr; - while (to <= end) - *to++ &= ~(*from++); + for (; to <= end; to++, from++) + *to &= ~(*from); } void bitmap_union(MY_BITMAP *map, const MY_BITMAP *map2) { my_bitmap_map *to= map->bitmap, *from= map2->bitmap, *end; - DBUG_ASSERT(map->bitmap && map2->bitmap && map->n_bits==map2->n_bits); end= map->last_word_ptr; - while (to <= end) - *to++ |= *from++; + for (; to <= end; to++, from++) + *to |= *from; } void bitmap_xor(MY_BITMAP *map, const MY_BITMAP *map2) { - my_bitmap_map *to= map->bitmap, *from= map2->bitmap, *end= map->last_word_ptr; + my_bitmap_map *to= map->bitmap, *from= map2->bitmap, *end; DBUG_ASSERT(map->bitmap && map2->bitmap && map->n_bits==map2->n_bits); - while (to <= end) - *to++ ^= *from++; + end= map->last_word_ptr; + + for (; to <= end; to++, from++) + *to ^= *from; } void bitmap_invert(MY_BITMAP *map) { my_bitmap_map *to= map->bitmap, *end; - DBUG_ASSERT(map->bitmap); end= map->last_word_ptr; - while (to <= end) - *to++ ^= 0xFFFFFFFF; + for (; to <= end; to++) + *to ^= 0xFFFFFFFF; } uint bitmap_bits_set(const MY_BITMAP *map) -{ - uchar *m= (uchar*)map->bitmap; - uchar *end= m + no_bytes_in_map(map); +{ + my_bitmap_map *data_ptr= map->bitmap; + my_bitmap_map *end= map->last_word_ptr; uint res= 0; - DBUG_ASSERT(map->bitmap); - *map->last_word_ptr&= ~map->last_word_mask; /*Reset last bits to zero*/ - while (m < end) - res+= my_count_bits_ushort(*m++); + + for (; data_ptr < end; data_ptr++) + res+= my_count_bits_uint32(*data_ptr); + + /*Reset last bits to zero*/ + res+= my_count_bits_uint32(*map->last_word_ptr & ~map->last_word_mask); return res; } @@ -475,76 +536,44 @@ uint bitmap_bits_set(const MY_BITMAP *map) void bitmap_copy(MY_BITMAP *map, const MY_BITMAP *map2) { my_bitmap_map *to= map->bitmap, *from= map2->bitmap, *end; - DBUG_ASSERT(map->bitmap && map2->bitmap && map->n_bits==map2->n_bits); end= map->last_word_ptr; - while (to <= end) - *to++ = *from++; + + for (; to <= end; to++, from++) + *to = *from; } uint bitmap_get_first_set(const MY_BITMAP *map) { - uchar *byte_ptr; - uint i,j,k; + uint word_pos; my_bitmap_map *data_ptr, *end= map->last_word_ptr; DBUG_ASSERT(map->bitmap); data_ptr= map->bitmap; - *map->last_word_ptr &= ~map->last_word_mask; - for (i=0; data_ptr <= end; data_ptr++, i++) - { + for (word_pos=0; data_ptr < end; data_ptr++, word_pos++) if (*data_ptr) - { - byte_ptr= (uchar*)data_ptr; - for (j=0; ; j++, byte_ptr++) - { - if (*byte_ptr) - { - for (k=0; ; k++) - { - if (*byte_ptr & (1 << k)) - return (i*32) + (j*8) + k; - } - } - } - } - } - return MY_BIT_NONE; + return get_first_set(*data_ptr, word_pos); + + return get_first_set(*map->last_word_ptr & ~map->last_word_mask, word_pos); } uint bitmap_get_first(const MY_BITMAP *map) { - uchar *byte_ptr; - uint i,j,k; + uint word_pos; my_bitmap_map *data_ptr, *end= map->last_word_ptr; DBUG_ASSERT(map->bitmap); data_ptr= map->bitmap; - *map->last_word_ptr|= map->last_word_mask; - for (i=0; data_ptr <= end; data_ptr++, i++) - { + for (word_pos=0; data_ptr < end; data_ptr++, word_pos++) if (*data_ptr != 0xFFFFFFFF) - { - byte_ptr= (uchar*)data_ptr; - for (j=0; ; j++, byte_ptr++) - { - if (*byte_ptr != 0xFF) - { - for (k=0; ; k++) - { - if (!(*byte_ptr & (1 << k))) - return (i*32) + (j*8) + k; - } - } - } - } - } - return MY_BIT_NONE; + return get_first_not_set(*data_ptr, word_pos); + + return get_first_not_set(*map->last_word_ptr | map->last_word_mask, word_pos); } @@ -752,375 +781,3 @@ void bitmap_lock_flip_bit(MY_BITMAP *map, uint bitmap_bit) bitmap_unlock(map); } #endif -#ifdef MAIN - -uint get_rand_bit(uint bitsize) -{ - return (rand() % bitsize); -} - -bool test_set_get_clear_bit(MY_BITMAP *map, uint bitsize) -{ - uint i, test_bit; - uint no_loops= bitsize > 128 ? 128 : bitsize; - for (i=0; i < no_loops; i++) - { - test_bit= get_rand_bit(bitsize); - bitmap_set_bit(map, test_bit); - if (!bitmap_is_set(map, test_bit)) - goto error1; - bitmap_clear_bit(map, test_bit); - if (bitmap_is_set(map, test_bit)) - goto error2; - } - return FALSE; -error1: - printf("Error in set bit, bit %u, bitsize = %u", test_bit, bitsize); - return TRUE; -error2: - printf("Error in clear bit, bit %u, bitsize = %u", test_bit, bitsize); - return TRUE; -} - -bool test_flip_bit(MY_BITMAP *map, uint bitsize) -{ - uint i, test_bit; - uint no_loops= bitsize > 128 ? 128 : bitsize; - for (i=0; i < no_loops; i++) - { - test_bit= get_rand_bit(bitsize); - bitmap_flip_bit(map, test_bit); - if (!bitmap_is_set(map, test_bit)) - goto error1; - bitmap_flip_bit(map, test_bit); - if (bitmap_is_set(map, test_bit)) - goto error2; - } - return FALSE; -error1: - printf("Error in flip bit 1, bit %u, bitsize = %u", test_bit, bitsize); - return TRUE; -error2: - printf("Error in flip bit 2, bit %u, bitsize = %u", test_bit, bitsize); - return TRUE; -} - -bool test_operators(MY_BITMAP *map __attribute__((unused)), - uint bitsize __attribute__((unused))) -{ - return FALSE; -} - -bool test_get_all_bits(MY_BITMAP *map, uint bitsize) -{ - uint i; - bitmap_set_all(map); - if (!bitmap_is_set_all(map)) - goto error1; - if (!bitmap_is_prefix(map, bitsize)) - goto error5; - bitmap_clear_all(map); - if (!bitmap_is_clear_all(map)) - goto error2; - if (!bitmap_is_prefix(map, 0)) - goto error6; - for (i=0; i 128 ? 128 : bitsize; - MY_BITMAP map2_obj, map3_obj; - MY_BITMAP *map2= &map2_obj, *map3= &map3_obj; - my_bitmap_map map2buf[1024]; - my_bitmap_map map3buf[1024]; - bitmap_init(&map2_obj, map2buf, bitsize, FALSE); - bitmap_init(&map3_obj, map3buf, bitsize, FALSE); - bitmap_clear_all(map2); - bitmap_clear_all(map3); - for (i=0; i < no_loops; i++) - { - test_bit1=get_rand_bit(bitsize); - bitmap_set_prefix(map, test_bit1); - test_bit2=get_rand_bit(bitsize); - bitmap_set_prefix(map2, test_bit2); - bitmap_intersect(map, map2); - test_bit3= test_bit2 < test_bit1 ? test_bit2 : test_bit1; - bitmap_set_prefix(map3, test_bit3); - if (!bitmap_cmp(map, map3)) - goto error1; - bitmap_clear_all(map); - bitmap_clear_all(map2); - bitmap_clear_all(map3); - test_bit1=get_rand_bit(bitsize); - test_bit2=get_rand_bit(bitsize); - test_bit3=get_rand_bit(bitsize); - bitmap_set_prefix(map, test_bit1); - bitmap_set_prefix(map2, test_bit2); - test_bit3= test_bit2 > test_bit1 ? test_bit2 : test_bit1; - bitmap_set_prefix(map3, test_bit3); - bitmap_union(map, map2); - if (!bitmap_cmp(map, map3)) - goto error2; - bitmap_clear_all(map); - bitmap_clear_all(map2); - bitmap_clear_all(map3); - test_bit1=get_rand_bit(bitsize); - test_bit2=get_rand_bit(bitsize); - test_bit3=get_rand_bit(bitsize); - bitmap_set_prefix(map, test_bit1); - bitmap_set_prefix(map2, test_bit2); - bitmap_xor(map, map2); - test_bit3= test_bit2 > test_bit1 ? test_bit2 : test_bit1; - test_bit4= test_bit2 < test_bit1 ? test_bit2 : test_bit1; - bitmap_set_prefix(map3, test_bit3); - for (j=0; j < test_bit4; j++) - bitmap_clear_bit(map3, j); - if (!bitmap_cmp(map, map3)) - goto error3; - bitmap_clear_all(map); - bitmap_clear_all(map2); - bitmap_clear_all(map3); - test_bit1=get_rand_bit(bitsize); - test_bit2=get_rand_bit(bitsize); - test_bit3=get_rand_bit(bitsize); - bitmap_set_prefix(map, test_bit1); - bitmap_set_prefix(map2, test_bit2); - bitmap_subtract(map, map2); - if (test_bit2 < test_bit1) - { - bitmap_set_prefix(map3, test_bit1); - for (j=0; j < test_bit2; j++) - bitmap_clear_bit(map3, j); - } - if (!bitmap_cmp(map, map3)) - goto error4; - bitmap_clear_all(map); - bitmap_clear_all(map2); - bitmap_clear_all(map3); - test_bit1=get_rand_bit(bitsize); - bitmap_set_prefix(map, test_bit1); - bitmap_invert(map); - bitmap_set_all(map3); - for (j=0; j < test_bit1; j++) - bitmap_clear_bit(map3, j); - if (!bitmap_cmp(map, map3)) - goto error5; - bitmap_clear_all(map); - bitmap_clear_all(map3); - } - return FALSE; -error1: - printf("intersect error bitsize=%u,size1=%u,size2=%u", bitsize, - test_bit1,test_bit2); - return TRUE; -error2: - printf("union error bitsize=%u,size1=%u,size2=%u", bitsize, - test_bit1,test_bit2); - return TRUE; -error3: - printf("xor error bitsize=%u,size1=%u,size2=%u", bitsize, - test_bit1,test_bit2); - return TRUE; -error4: - printf("subtract error bitsize=%u,size1=%u,size2=%u", bitsize, - test_bit1,test_bit2); - return TRUE; -error5: - printf("invert error bitsize=%u,size=%u", bitsize, - test_bit1); - return TRUE; -} - -bool test_count_bits_set(MY_BITMAP *map, uint bitsize) -{ - uint i, bit_count=0, test_bit; - uint no_loops= bitsize > 128 ? 128 : bitsize; - for (i=0; i < no_loops; i++) - { - test_bit=get_rand_bit(bitsize); - if (!bitmap_is_set(map, test_bit)) - { - bitmap_set_bit(map, test_bit); - bit_count++; - } - } - if (bit_count==0 && bitsize > 0) - goto error1; - if (bitmap_bits_set(map) != bit_count) - goto error2; - return FALSE; -error1: - printf("No bits set bitsize = %u", bitsize); - return TRUE; -error2: - printf("Wrong count of bits set, bitsize = %u", bitsize); - return TRUE; -} - -bool test_get_first_bit(MY_BITMAP *map, uint bitsize) -{ - uint i, test_bit; - uint no_loops= bitsize > 128 ? 128 : bitsize; - for (i=0; i < no_loops; i++) - { - test_bit=get_rand_bit(bitsize); - bitmap_set_bit(map, test_bit); - if (bitmap_get_first_set(map) != test_bit) - goto error1; - bitmap_set_all(map); - bitmap_clear_bit(map, test_bit); - if (bitmap_get_first(map) != test_bit) - goto error2; - bitmap_clear_all(map); - } - return FALSE; -error1: - printf("get_first_set error bitsize=%u,prefix_size=%u",bitsize,test_bit); - return TRUE; -error2: - printf("get_first error bitsize= %u, prefix_size= %u",bitsize,test_bit); - return TRUE; -} - -bool test_get_next_bit(MY_BITMAP *map, uint bitsize) -{ - uint i, j, test_bit; - uint no_loops= bitsize > 128 ? 128 : bitsize; - for (i=0; i < no_loops; i++) - { - test_bit=get_rand_bit(bitsize); - for (j=0; j < test_bit; j++) - bitmap_set_next(map); - if (!bitmap_is_prefix(map, test_bit)) - goto error1; - bitmap_clear_all(map); - } - return FALSE; -error1: - printf("get_next error bitsize= %u, prefix_size= %u", bitsize,test_bit); - return TRUE; -} - -bool test_prefix(MY_BITMAP *map, uint bitsize) -{ - uint i, j, test_bit; - uint no_loops= bitsize > 128 ? 128 : bitsize; - for (i=0; i < no_loops; i++) - { - test_bit=get_rand_bit(bitsize); - bitmap_set_prefix(map, test_bit); - if (!bitmap_is_prefix(map, test_bit)) - goto error1; - bitmap_clear_all(map); - for (j=0; j < test_bit; j++) - bitmap_set_bit(map, j); - if (!bitmap_is_prefix(map, test_bit)) - goto error2; - bitmap_set_all(map); - for (j=bitsize - 1; ~(j-test_bit); j--) - bitmap_clear_bit(map, j); - if (!bitmap_is_prefix(map, test_bit)) - goto error3; - bitmap_clear_all(map); - } - return FALSE; -error1: - printf("prefix1 error bitsize = %u, prefix_size = %u", bitsize,test_bit); - return TRUE; -error2: - printf("prefix2 error bitsize = %u, prefix_size = %u", bitsize,test_bit); - return TRUE; -error3: - printf("prefix3 error bitsize = %u, prefix_size = %u", bitsize,test_bit); - return TRUE; -} - - -bool do_test(uint bitsize) -{ - MY_BITMAP map; - my_bitmap_map buf[1024]; - if (bitmap_init(&map, buf, bitsize, FALSE)) - { - printf("init error for bitsize %d", bitsize); - goto error; - } - if (test_set_get_clear_bit(&map,bitsize)) - goto error; - bitmap_clear_all(&map); - if (test_flip_bit(&map,bitsize)) - goto error; - bitmap_clear_all(&map); - if (test_operators(&map,bitsize)) - goto error; - bitmap_clear_all(&map); - if (test_get_all_bits(&map, bitsize)) - goto error; - bitmap_clear_all(&map); - if (test_compare_operators(&map,bitsize)) - goto error; - bitmap_clear_all(&map); - if (test_count_bits_set(&map,bitsize)) - goto error; - bitmap_clear_all(&map); - if (test_get_first_bit(&map,bitsize)) - goto error; - bitmap_clear_all(&map); - if (test_get_next_bit(&map,bitsize)) - goto error; - if (test_prefix(&map,bitsize)) - goto error; - return FALSE; -error: - printf("\n"); - return TRUE; -} - -int main() -{ - int i; - for (i= 1; i < 4096; i++) - { - printf("Start test for bitsize=%u\n",i); - if (do_test(i)) - return -1; - } - printf("OK\n"); - return 0; -} - -/* - In directory mysys: - make test_bitmap - will build the bitmap tests and ./test_bitmap will execute it -*/ - -#endif diff --git a/unittest/mysys/bitmap-t.c b/unittest/mysys/bitmap-t.c index 0bd21b63430..d5c1791ca14 100644 --- a/unittest/mysys/bitmap-t.c +++ b/unittest/mysys/bitmap-t.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2006 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by @@ -24,6 +24,8 @@ #include #include +#define MAX_TESTED_BITMAP_SIZE 1024 + uint get_rand_bit(uint bitsize) { return (rand() % bitsize); @@ -75,12 +77,6 @@ error2: return TRUE; } -my_bool test_operators(MY_BITMAP *map __attribute__((unused)), - uint bitsize __attribute__((unused))) -{ - return FALSE; -} - my_bool test_get_all_bits(MY_BITMAP *map, uint bitsize) { uint i; @@ -129,8 +125,8 @@ my_bool test_compare_operators(MY_BITMAP *map, uint bitsize) uint no_loops= bitsize > 128 ? 128 : bitsize; MY_BITMAP map2_obj, map3_obj; MY_BITMAP *map2= &map2_obj, *map3= &map3_obj; - uint32 map2buf[1024]; - uint32 map3buf[1024]; + uint32 map2buf[MAX_TESTED_BITMAP_SIZE]; + uint32 map3buf[MAX_TESTED_BITMAP_SIZE]; bitmap_init(&map2_obj, map2buf, bitsize, FALSE); bitmap_init(&map3_obj, map3buf, bitsize, FALSE); bitmap_clear_all(map2); @@ -259,6 +255,19 @@ my_bool test_get_first_bit(MY_BITMAP *map, uint bitsize) { uint i, test_bit; uint no_loops= bitsize > 128 ? 128 : bitsize; + + bitmap_set_all(map); + for (i=0; i < bitsize; i++) + bitmap_clear_bit(map, i); + if (bitmap_get_first_set(map) != MY_BIT_NONE) + goto error1; + bitmap_clear_all(map); + for (i=0; i < bitsize; i++) + bitmap_set_bit(map, i); + if (bitmap_get_first(map) != MY_BIT_NONE) + goto error2; + bitmap_clear_all(map); + for (i=0; i < no_loops; i++) { test_bit=get_rand_bit(bitsize); @@ -321,6 +330,24 @@ my_bool test_prefix(MY_BITMAP *map, uint bitsize) goto error3; bitmap_clear_all(map); } + for (i=0; i < bitsize; i++) + { + if (bitmap_is_prefix(map, i + 1)) + goto error4; + bitmap_set_bit(map, i); + if (!bitmap_is_prefix(map, i + 1)) + goto error5; + test_bit=get_rand_bit(bitsize); + bitmap_set_bit(map, test_bit); + if (test_bit <= i && !bitmap_is_prefix(map, i + 1)) + goto error5; + else if (test_bit > i) + { + if (bitmap_is_prefix(map, i + 1)) + goto error4; + bitmap_clear_bit(map, test_bit); + } + } return FALSE; error1: diag("prefix1 error bitsize = %u, prefix_size = %u", bitsize,test_bit); @@ -331,13 +358,127 @@ error2: error3: diag("prefix3 error bitsize = %u, prefix_size = %u", bitsize,test_bit); return TRUE; +error4: + diag("prefix4 error bitsize = %u, i = %u", bitsize,i); + return TRUE; +error5: + diag("prefix5 error bitsize = %u, i = %u", bitsize,i); + return TRUE; } +my_bool test_compare(MY_BITMAP *map, uint bitsize) +{ + MY_BITMAP map2; + uint32 map2buf[MAX_TESTED_BITMAP_SIZE]; + uint i, test_bit; + uint no_loops= bitsize > 128 ? 128 : bitsize; + if (bitmap_init(&map2, map2buf, bitsize, FALSE)) + { + diag("init error for bitsize %d", bitsize); + return TRUE; + } + /* Test all 4 possible combinations of set/unset bits. */ + for (i=0; i < no_loops; i++) + { + test_bit=get_rand_bit(bitsize); + bitmap_clear_bit(map, test_bit); + bitmap_clear_bit(&map2, test_bit); + if (!bitmap_is_subset(map, &map2)) + goto error_is_subset; + bitmap_set_bit(map, test_bit); + if (bitmap_is_subset(map, &map2)) + goto error_is_subset; + bitmap_set_bit(&map2, test_bit); + if (!bitmap_is_subset(map, &map2)) + goto error_is_subset; + bitmap_clear_bit(map, test_bit); + if (!bitmap_is_subset(map, &map2)) + goto error_is_subset; + /* Note that test_bit is not cleared i map2. */ + } + bitmap_clear_all(map); + bitmap_clear_all(&map2); + /* Test all 4 possible combinations of set/unset bits. */ + for (i=0; i < no_loops; i++) + { + test_bit=get_rand_bit(bitsize); + if (bitmap_is_overlapping(map, &map2)) + goto error_is_overlapping; + bitmap_set_bit(map, test_bit); + if (bitmap_is_overlapping(map, &map2)) + goto error_is_overlapping; + bitmap_set_bit(&map2, test_bit); + if (!bitmap_is_overlapping(map, &map2)) + goto error_is_overlapping; + bitmap_clear_bit(map, test_bit); + if (bitmap_is_overlapping(map, &map2)) + goto error_is_overlapping; + bitmap_clear_bit(&map2, test_bit); + /* Note that test_bit is not cleared i map2. */ + } + return FALSE; +error_is_subset: + diag("is_subset error bitsize = %u", bitsize); + return TRUE; +error_is_overlapping: + diag("is_overlapping error bitsize = %u", bitsize); + return TRUE; +} + +my_bool test_intersect(MY_BITMAP *map, uint bitsize) +{ + uint bitsize2 = 1 + get_rand_bit(MAX_TESTED_BITMAP_SIZE - 1); + MY_BITMAP map2; + uint32 map2buf[bitsize2]; + uint i, test_bit1, test_bit2, test_bit3; + if (bitmap_init(&map2, map2buf, bitsize2, FALSE)) + { + diag("init error for bitsize %d", bitsize2); + return TRUE; + } + test_bit1= get_rand_bit(bitsize); + test_bit2= get_rand_bit(bitsize); + bitmap_set_bit(map, test_bit1); + bitmap_set_bit(map, test_bit2); + test_bit3= get_rand_bit(bitsize2); + bitmap_set_bit(&map2, test_bit3); + if (test_bit2 < bitsize2) + bitmap_set_bit(&map2, test_bit2); + + bitmap_intersect(map, &map2); + if (test_bit2 < bitsize2) + { + if (!bitmap_is_set(map, test_bit2)) + goto error; + bitmap_clear_bit(map, test_bit2); + } + if (test_bit1 == test_bit3) + { + if (!bitmap_is_set(map, test_bit1)) + goto error; + bitmap_clear_bit(map, test_bit1); + } + if (!bitmap_is_clear_all(map)) + goto error; + + bitmap_set_all(map); + bitmap_set_all(&map2); + for (i=0; i < bitsize2; i++) + bitmap_clear_bit(&map2, i); + bitmap_intersect(map, &map2); + if (!bitmap_is_clear_all(map)) + goto error; + return FALSE; +error: + diag("intersect error bitsize = %u, bit1 = %u, bit2 = %u, bit3 = %u", + bitsize, test_bit1, test_bit2, test_bit3); + return TRUE; +} my_bool do_test(uint bitsize) { MY_BITMAP map; - uint32 buf[1024]; + uint32 buf[MAX_TESTED_BITMAP_SIZE]; if (bitmap_init(&map, buf, bitsize, FALSE)) { diag("init error for bitsize %d", bitsize); @@ -349,9 +490,6 @@ my_bool do_test(uint bitsize) if (test_flip_bit(&map,bitsize)) goto error; bitmap_clear_all(&map); - if (test_operators(&map,bitsize)) - goto error; - bitmap_clear_all(&map); if (test_get_all_bits(&map, bitsize)) goto error; bitmap_clear_all(&map); @@ -366,8 +504,15 @@ my_bool do_test(uint bitsize) bitmap_clear_all(&map); if (test_get_next_bit(&map,bitsize)) goto error; + bitmap_clear_all(&map); if (test_prefix(&map,bitsize)) goto error; + bitmap_clear_all(&map); + if (test_compare(&map,bitsize)) + goto error; + bitmap_clear_all(&map); + if (test_intersect(&map,bitsize)) + goto error; return FALSE; error: return TRUE; @@ -377,7 +522,7 @@ int main() { int i; int const min_size = 1; - int const max_size = 1024; + int const max_size = MAX_TESTED_BITMAP_SIZE; MY_INIT("bitmap-t"); plan(max_size - min_size); From 0e28aa2f1c6c5bd12fd907636cb28e255f425590 Mon Sep 17 00:00:00 2001 From: Jon Olav Hauglid Date: Wed, 16 Feb 2011 18:19:10 +0100 Subject: [PATCH 114/202] Followup to Bug #11752069 (former bug 43152) Assertion `bitmap_is_set_all(&table->s->all_set)' failed in handler::ha_reset This followup fixes the compilation warning 'test_bit' may be used uninitialized in this function introduced by the previous patch. --- unittest/mysys/bitmap-t.c | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) diff --git a/unittest/mysys/bitmap-t.c b/unittest/mysys/bitmap-t.c index d5c1791ca14..d0df9fbb040 100644 --- a/unittest/mysys/bitmap-t.c +++ b/unittest/mysys/bitmap-t.c @@ -253,7 +253,7 @@ error2: my_bool test_get_first_bit(MY_BITMAP *map, uint bitsize) { - uint i, test_bit; + uint i, test_bit= 0; uint no_loops= bitsize > 128 ? 128 : bitsize; bitmap_set_all(map); From ee2f9d868c59934bc8c051faf52519ffe77747cd Mon Sep 17 00:00:00 2001 From: Bjorn Munch Date: Wed, 16 Feb 2011 21:43:12 +0100 Subject: [PATCH 115/202] Simple fix of suppress pattern in test insert_select --- mysql-test/r/insert_select.result | 2 +- mysql-test/t/insert_select.test | 2 +- 2 files changed, 2 insertions(+), 2 deletions(-) diff --git a/mysql-test/r/insert_select.result b/mysql-test/r/insert_select.result index f12c9a0a61a..708c44f07a9 100644 --- a/mysql-test/r/insert_select.result +++ b/mysql-test/r/insert_select.result @@ -841,7 +841,7 @@ SET max_heap_table_size = 16384; SET @old_myisam_data_pointer_size = @@myisam_data_pointer_size; SET GLOBAL myisam_data_pointer_size = 2; INSERT INTO t1 VALUES (1), (2), (3), (4), (5); -call mtr.add_suppression("mysqld: The table '.*#sql.*' is full"); +call mtr.add_suppression("mysqld.*: The table '.*#sql.*' is full"); INSERT IGNORE INTO t1 SELECT t1.a FROM t1,t1 t2,t1 t3,t1 t4,t1 t5,t1 t6,t1 t7; Got one of the listed errors SET GLOBAL myisam_data_pointer_size = @old_myisam_data_pointer_size; diff --git a/mysql-test/t/insert_select.test b/mysql-test/t/insert_select.test index 7318e45889a..d7fe816bec7 100644 --- a/mysql-test/t/insert_select.test +++ b/mysql-test/t/insert_select.test @@ -407,7 +407,7 @@ SET GLOBAL myisam_data_pointer_size = 2; INSERT INTO t1 VALUES (1), (2), (3), (4), (5); -call mtr.add_suppression("mysqld: The table '.*#sql.*' is full"); +call mtr.add_suppression("mysqld.*: The table '.*#sql.*' is full"); --error ER_RECORD_FILE_FULL,ER_RECORD_FILE_FULL INSERT IGNORE INTO t1 SELECT t1.a FROM t1,t1 t2,t1 t3,t1 t4,t1 t5,t1 t6,t1 t7; From e53ffb8f7f7a0420e92158eb61fc8afdfc385f16 Mon Sep 17 00:00:00 2001 From: Jonathan Perkin Date: Wed, 16 Feb 2011 14:42:44 -0800 Subject: [PATCH 116/202] Updated README file. --- README | 23 ++++++++++++++++------- 1 file changed, 16 insertions(+), 7 deletions(-) diff --git a/README b/README index 5463de4a7e8..2e18fb55a22 100644 --- a/README +++ b/README @@ -3,18 +3,29 @@ MySQL Server This is a release of MySQL, a dual-license SQL database server. For the avoidance of doubt, this particular copy of the software is released under the version 2 of the GNU General Public License. -MySQL is brought to you by the MySQL team at Oracle. +MySQL is brought to you by Oracle. -Copyright (c) 2000, 2010, Oracle and/or its affiliates. All rights reserved. +Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. License information can be found in the COPYING file. +MySQL FOSS License Exception +We want free and open source software applications under certain +licenses to be able to use specified GPL-licensed MySQL client +libraries despite the fact that not all such FOSS licenses are +compatible with version 2 of the GNU General Public License. +Therefore there are special exceptions to the terms and conditions +of the GPLv2 as applied to these client libraries, which are +identified and described in more detail in the FOSS License +Exception at +. + This distribution may include materials developed by third parties. For license and attribution notices for these materials, please refer to the documentation that accompanies -this distribution (see the Licenses for Third-Party Components -appendix). A copy of the license/notices is also reproduced -below. +this distribution (see the "Licenses for Third-Party Components" +appendix) or view the online documentation at +. GPLv2 Disclaimer For the avoidance of doubt, except that if any license choice @@ -38,8 +49,6 @@ Some Reference Manual sections of special interest: chapter. - For the new features/bugfix history, see the MySQL Change History appendix. -- For currently known bugs, see the Errors and Common Problems - appendix. You can browse the MySQL Reference Manual online or download it in any of several formats at the URL given earlier in this file. From 61449541fb8aec7f82d8ab8e64688a4c5118e923 Mon Sep 17 00:00:00 2001 From: =?UTF-8?q?Marko=20M=C3=A4kel=C3=A4?= Date: Thu, 17 Feb 2011 09:45:07 +0200 Subject: [PATCH 117/202] Disable the Bug #60049 test on embedded, as it requires server restart. --- mysql-test/suite/innodb/t/innodb_bug60049.test | 1 + mysql-test/suite/innodb_plugin/t/innodb_bug60049.test | 1 + 2 files changed, 2 insertions(+) diff --git a/mysql-test/suite/innodb/t/innodb_bug60049.test b/mysql-test/suite/innodb/t/innodb_bug60049.test index cff1c3dc09d..b35fb12cc5e 100644 --- a/mysql-test/suite/innodb/t/innodb_bug60049.test +++ b/mysql-test/suite/innodb/t/innodb_bug60049.test @@ -2,6 +2,7 @@ # This test requires a fresh server start-up and a slow shutdown. # This was a suspected bug (not a bug). +-- source include/not_embedded.inc -- source include/have_innodb.inc CREATE TABLE t(a INT)ENGINE=InnoDB; diff --git a/mysql-test/suite/innodb_plugin/t/innodb_bug60049.test b/mysql-test/suite/innodb_plugin/t/innodb_bug60049.test index b3557243235..8d6c38ff9ef 100644 --- a/mysql-test/suite/innodb_plugin/t/innodb_bug60049.test +++ b/mysql-test/suite/innodb_plugin/t/innodb_bug60049.test @@ -2,6 +2,7 @@ # This test requires a fresh server start-up and a slow shutdown. # This was a suspected bug (not a bug). +-- source include/not_embedded.inc -- source include/have_innodb_plugin.inc CREATE TABLE t(a INT)ENGINE=InnoDB; From 6503226743a2fa24c7330d4541560a5b8fa821d6 Mon Sep 17 00:00:00 2001 From: Magne Mahre Date: Thu, 17 Feb 2011 12:43:53 +0100 Subject: [PATCH 118/202] Bug#48053 String::c_ptr has a race and/or does an invalid memory reference There are two issues present here. 1) There is a possibility that we test a byte beyond the allocated buffer 2) We compare a byte that might never have been initalized to see if it's 0. The first issue is not triggered by existing code, but an ASSERT has been added to safe-guard against introducing new code that triggers it. The second issue is what triggers the Valgrind warnings reported in the bug report. A buffer is allocated in class String to hold the value. This buffer is populated by the character data constituting the string, but is not zero-terminated in most cases. Testing if it is indeed zero-terminated means that we check a byte that has never been explicitly set, thus causing Valgrind to trigger. Note that issue 2 is not a serious problem. The variable is read, and if it's not zero, we will set it to zero. There are no further consequences. Note that this patch does not fix the underlying problems with issue 1, as it is deemed too risky to fix at this point (as noted in the bug report). As discussed in the report, the c_ptr() method should probably be replaced, but this requires a thorough analysis of the ~200 calls to the method. sql/set_var.cc: These two cases have been reported to fail with Valgrind. --- mysql-test/r/ctype_cp1250_ch.result | 3 +++ mysql-test/r/ctype_cp1251.result | 2 ++ mysql-test/r/ctype_eucjpms.result | 2 ++ mysql-test/t/ctype_cp1250_ch.test | 10 ++++++++++ mysql-test/t/ctype_cp1251.test | 10 ++++++++++ mysql-test/t/ctype_eucjpms.test | 8 ++++++++ sql/set_var.cc | 4 ++-- sql/sql_string.h | 3 +++ 8 files changed, 40 insertions(+), 2 deletions(-) mode change 100755 => 100644 mysql-test/r/ctype_eucjpms.result diff --git a/mysql-test/r/ctype_cp1250_ch.result b/mysql-test/r/ctype_cp1250_ch.result index 7f0cdf3f17b..46ca1f25ef4 100644 --- a/mysql-test/r/ctype_cp1250_ch.result +++ b/mysql-test/r/ctype_cp1250_ch.result @@ -238,3 +238,6 @@ select a from t1 where a like "abcdefgh a abcdefghá drop table t1; +set global LC_MESSAGES=convert((@@global.log_bin_trust_function_creators) +using cp1250); +ERROR HY000: Unknown system variable 'LC_MESSAGES' diff --git a/mysql-test/r/ctype_cp1251.result b/mysql-test/r/ctype_cp1251.result index dc12f9ceb03..2e91ecb7bc0 100644 --- a/mysql-test/r/ctype_cp1251.result +++ b/mysql-test/r/ctype_cp1251.result @@ -375,6 +375,8 @@ FD FD FD D18D FD FE FE FE D18E FE FF FF FF D18F FF DROP TABLE t1; +set global LC_TIME_NAMES=convert((-8388608) using cp1251); +ERROR HY000: Unknown locale: '-8388608' # # End of 5.1 tests # diff --git a/mysql-test/r/ctype_eucjpms.result b/mysql-test/r/ctype_eucjpms.result old mode 100755 new mode 100644 index 21aa38b7fe6..21109f596c1 --- a/mysql-test/r/ctype_eucjpms.result +++ b/mysql-test/r/ctype_eucjpms.result @@ -9859,3 +9859,5 @@ hex(convert(_eucjpms 0xA5FE41 using ucs2)) select hex(convert(_eucjpms 0x8FABF841 using ucs2)); hex(convert(_eucjpms 0x8FABF841 using ucs2)) 003F0041 +set global LC_TIME_NAMES=convert((convert((0x63) using eucjpms)) using utf8); +ERROR HY000: Unknown locale: 'c' diff --git a/mysql-test/t/ctype_cp1250_ch.test b/mysql-test/t/ctype_cp1250_ch.test index 1fb656f2a01..3e17ee52164 100644 --- a/mysql-test/t/ctype_cp1250_ch.test +++ b/mysql-test/t/ctype_cp1250_ch.test @@ -72,3 +72,13 @@ select a from t1 where a like "abcdefgh drop table t1; # End of 4.1 tests + +# +# Bug #48053 String::c_ptr has a race and/or does an invalid +# memory reference +# (triggered by Valgrind tests) +# (see also ctype_eucjpms.test, ctype_cp1250.test, ctype_cp1251.test) +# +--error 1193 +set global LC_MESSAGES=convert((@@global.log_bin_trust_function_creators) + using cp1250); diff --git a/mysql-test/t/ctype_cp1251.test b/mysql-test/t/ctype_cp1251.test index 2331c731061..bde72d04ba7 100644 --- a/mysql-test/t/ctype_cp1251.test +++ b/mysql-test/t/ctype_cp1251.test @@ -55,6 +55,16 @@ drop table t1; --source include/ctype_8bit.inc +# +# Bug #48053 String::c_ptr has a race and/or does an invalid +# memory reference +# (triggered by Valgrind tests) +# (see also ctype_eucjpms.test, ctype_cp1250.test, ctype_cp1251.test) +# +--error 1105 +set global LC_TIME_NAMES=convert((-8388608) using cp1251); + + --echo # --echo # End of 5.1 tests --echo # diff --git a/mysql-test/t/ctype_eucjpms.test b/mysql-test/t/ctype_eucjpms.test index ec358d94900..165cfba897a 100644 --- a/mysql-test/t/ctype_eucjpms.test +++ b/mysql-test/t/ctype_eucjpms.test @@ -381,3 +381,11 @@ select hex(convert(_eucjpms 0xA5FE41 using ucs2)); # the next character, which is a single byte character 0x41. select hex(convert(_eucjpms 0x8FABF841 using ucs2)); +# +# Bug #48053 String::c_ptr has a race and/or does an invalid +# memory reference +# (triggered by Valgrind tests) +# (see also ctype_eucjpms.test, ctype_cp1250.test, ctype_cp1251.test) +# +--error 1105 +set global LC_TIME_NAMES=convert((convert((0x63) using eucjpms)) using utf8); diff --git a/sql/set_var.cc b/sql/set_var.cc index d297be3fc10..26c9b06a912 100644 --- a/sql/set_var.cc +++ b/sql/set_var.cc @@ -1828,7 +1828,7 @@ bool sys_var::check_set(THD *thd, set_var *var, TYPELIB *enum_names) } var->save_result.ulong_value= ((ulong) - find_set(enum_names, res->c_ptr(), + find_set(enum_names, res->c_ptr_safe(), res->length(), NULL, &error, &error_len, @@ -2941,7 +2941,7 @@ bool sys_var_thd_lc_time_names::check(THD *thd, set_var *var) my_error(ER_WRONG_VALUE_FOR_VAR, MYF(0), name, "NULL"); return 1; } - const char *locale_str= res->c_ptr(); + const char *locale_str= res->c_ptr_safe(); if (!(locale_match= my_locale_by_name(locale_str))) { my_printf_error(ER_UNKNOWN_ERROR, diff --git a/sql/sql_string.h b/sql/sql_string.h index 092e194646f..c56c69493d4 100644 --- a/sql/sql_string.h +++ b/sql/sql_string.h @@ -106,6 +106,9 @@ public: inline const char *ptr() const { return Ptr; } inline char *c_ptr() { + DBUG_ASSERT(!alloced || !Ptr || !Alloced_length || + (Alloced_length >= (str_length + 1))); + if (!Ptr || Ptr[str_length]) /* Should be safe */ (void) realloc(str_length); return Ptr; From a27d85aa46147ecb59b1306c02194bd12a3378ed Mon Sep 17 00:00:00 2001 From: Vasil Dimov Date: Thu, 17 Feb 2011 19:09:53 +0200 Subject: [PATCH 119/202] Fix the non-determinism in innodb_information_schema.test Thanks to Kristian Nielsen for finding out the root cause for the failure, see: https://bugs.launchpad.net/maria/+bug/677407 --- .../t/innodb_information_schema.test | 28 +++++++++++++++---- 1 file changed, 23 insertions(+), 5 deletions(-) diff --git a/mysql-test/suite/innodb_plugin/t/innodb_information_schema.test b/mysql-test/suite/innodb_plugin/t/innodb_information_schema.test index 25255e0b2a9..20c25015c56 100644 --- a/mysql-test/suite/innodb_plugin/t/innodb_information_schema.test +++ b/mysql-test/suite/innodb_plugin/t/innodb_information_schema.test @@ -116,11 +116,29 @@ SELECT * FROM ```t'\"_str` WHERE c1 = '4' FOR UPDATE; # executes before some of them, resulting in less than expected number # of rows being selected from innodb_locks. If there is a bug and there # are no 14 rows in innodb_locks then this test will fail with timeout. -let $count = 14; -let $table = INFORMATION_SCHEMA.INNODB_LOCKS; --- source include/wait_until_rows_count.inc -# the above enables the query log, re-disable it --- disable_query_log +# Notice that if we query INNODB_LOCKS more often than once per 0.1 sec +# then its contents will never change because the cache from which it is +# filled is updated only if it has not been read for 0.1 seconds. See +# CACHE_MIN_IDLE_TIME_US in trx/trx0i_s.c. +let $cnt=10; +while ($cnt) +{ + let $success=`SELECT COUNT(*) = 14 FROM INFORMATION_SCHEMA.INNODB_LOCKS`; + if ($success) + { + let $cnt=0; + } + if (!$success) + { + real_sleep 0.2; + dec $cnt; + } +} +if (!$success) +{ + -- echo Timeout waiting for rows in INNODB_LOCKS to appear +} + SELECT lock_mode, lock_type, lock_table, lock_index, lock_rec, lock_data FROM INFORMATION_SCHEMA.INNODB_LOCKS ORDER BY lock_data; From c83889d9d6a95dc0e1628dedfef9127da7bad3df Mon Sep 17 00:00:00 2001 From: =?UTF-8?q?Marko=20M=C3=A4kel=C3=A4?= Date: Thu, 17 Feb 2011 22:25:33 +0200 Subject: [PATCH 120/202] Allow 30 seconds for slow shutdown in the Bug #60049 test. --- mysql-test/suite/innodb/t/innodb_bug60049.test | 2 +- mysql-test/suite/innodb_plugin/t/innodb_bug60049.test | 2 +- 2 files changed, 2 insertions(+), 2 deletions(-) diff --git a/mysql-test/suite/innodb/t/innodb_bug60049.test b/mysql-test/suite/innodb/t/innodb_bug60049.test index b35fb12cc5e..ec4e3b8de7e 100644 --- a/mysql-test/suite/innodb/t/innodb_bug60049.test +++ b/mysql-test/suite/innodb/t/innodb_bug60049.test @@ -13,7 +13,7 @@ let $MYSQLD_DATADIR=`select @@datadir`; # Shut down the server -- exec echo "wait" > $MYSQLTEST_VARDIR/tmp/mysqld.1.expect --- shutdown_server 10 +-- shutdown_server 30 -- source include/wait_until_disconnected.inc # Check the tail of ID_IND (SYS_TABLES.ID) diff --git a/mysql-test/suite/innodb_plugin/t/innodb_bug60049.test b/mysql-test/suite/innodb_plugin/t/innodb_bug60049.test index 8d6c38ff9ef..0423f5d3635 100644 --- a/mysql-test/suite/innodb_plugin/t/innodb_bug60049.test +++ b/mysql-test/suite/innodb_plugin/t/innodb_bug60049.test @@ -13,7 +13,7 @@ let $MYSQLD_DATADIR=`select @@datadir`; # Shut down the server -- exec echo "wait" > $MYSQLTEST_VARDIR/tmp/mysqld.1.expect --- shutdown_server 10 +-- shutdown_server 30 -- source include/wait_until_disconnected.inc # Check the tail of ID_IND (SYS_TABLES.ID) From 61b256177bc9876d05ac807a98cb141c70d9357e Mon Sep 17 00:00:00 2001 From: Martin Hansson Date: Fri, 18 Feb 2011 11:50:06 +0100 Subject: [PATCH 121/202] Bug#11766675 - 59839: Aggregation followed by subquery yields wrong result The loop that was looping over subqueries' references to outer field used a local boolean variable to tell whether the field was grouped or not. But the implementor failed to reset the variable after each iteration. Thus a field that was not directly aggregated appeared to be. Fixed by resetting the variable upon each new iteration. --- mysql-test/r/group_by.result | 36 ++++++++++++++++++++ mysql-test/t/group_by.test | 37 ++++++++++++++++++++ sql/sql_select.cc | 66 +++++++++++++++++++----------------- 3 files changed, 108 insertions(+), 31 deletions(-) diff --git a/mysql-test/r/group_by.result b/mysql-test/r/group_by.result index 83f1f220023..1dfb0f5860a 100644 --- a/mysql-test/r/group_by.result +++ b/mysql-test/r/group_by.result @@ -1855,4 +1855,40 @@ ON 1 WHERE t2.f1 > 1 GROUP BY t2.f1; COUNT(*) 2 DROP TABLE t1; +# +# Bug#59839: Aggregation followed by subquery yields wrong result +# +CREATE TABLE t1 ( +a INT, +b INT, +c INT, +KEY (a, b) +); +INSERT INTO t1 VALUES +( 1, 1, 1 ), +( 1, 2, 2 ), +( 1, 3, 3 ), +( 1, 4, 6 ), +( 1, 5, 5 ), +( 1, 9, 13 ), +( 2, 1, 6 ), +( 2, 2, 7 ), +( 2, 3, 8 ); +EXPLAIN +SELECT a, AVG(t1.b), +(SELECT t11.c FROM t1 t11 WHERE t11.a = t1.a AND t11.b = AVG(t1.b)) AS t11c, +(SELECT t12.c FROM t1 t12 WHERE t12.a = t1.a AND t12.b = AVG(t1.b)) AS t12c +FROM t1 GROUP BY a; +id select_type table type possible_keys key key_len ref rows Extra +1 PRIMARY t1 index NULL a 10 NULL 9 Using index +3 DEPENDENT SUBQUERY t12 ref a a 10 func,func 2 Using where +2 DEPENDENT SUBQUERY t11 ref a a 10 func,func 2 Using where +SELECT a, AVG(t1.b), +(SELECT t11.c FROM t1 t11 WHERE t11.a = t1.a AND t11.b = AVG(t1.b)) AS t11c, +(SELECT t12.c FROM t1 t12 WHERE t12.a = t1.a AND t12.b = AVG(t1.b)) AS t12c +FROM t1 GROUP BY a; +a AVG(t1.b) t11c t12c +1 4.0000 6 6 +2 2.0000 7 7 +DROP TABLE t1; # End of 5.1 tests diff --git a/mysql-test/t/group_by.test b/mysql-test/t/group_by.test index 580c2e5091c..1a4b9a3bab7 100644 --- a/mysql-test/t/group_by.test +++ b/mysql-test/t/group_by.test @@ -1247,4 +1247,41 @@ ON 1 WHERE t2.f1 > 1 GROUP BY t2.f1; DROP TABLE t1; +--echo # +--echo # Bug#59839: Aggregation followed by subquery yields wrong result +--echo # + +CREATE TABLE t1 ( + a INT, + b INT, + c INT, + KEY (a, b) +); + +INSERT INTO t1 VALUES + ( 1, 1, 1 ), + ( 1, 2, 2 ), + ( 1, 3, 3 ), + ( 1, 4, 6 ), + ( 1, 5, 5 ), + ( 1, 9, 13 ), + + ( 2, 1, 6 ), + ( 2, 2, 7 ), + ( 2, 3, 8 ); + +EXPLAIN +SELECT a, AVG(t1.b), +(SELECT t11.c FROM t1 t11 WHERE t11.a = t1.a AND t11.b = AVG(t1.b)) AS t11c, +(SELECT t12.c FROM t1 t12 WHERE t12.a = t1.a AND t12.b = AVG(t1.b)) AS t12c +FROM t1 GROUP BY a; + +SELECT a, AVG(t1.b), +(SELECT t11.c FROM t1 t11 WHERE t11.a = t1.a AND t11.b = AVG(t1.b)) AS t11c, +(SELECT t12.c FROM t1 t12 WHERE t12.a = t1.a AND t12.b = AVG(t1.b)) AS t12c +FROM t1 GROUP BY a; + +DROP TABLE t1; + + --echo # End of 5.1 tests diff --git a/sql/sql_select.cc b/sql/sql_select.cc index 869fd01ac60..eb2559fc600 100644 --- a/sql/sql_select.cc +++ b/sql/sql_select.cc @@ -278,61 +278,65 @@ bool handle_select(THD *thd, LEX *lex, select_result *result, } -/* +/** Fix fields referenced from inner selects. - SYNOPSIS - fix_inner_refs() - thd Thread handle - all_fields List of all fields used in select - select Current select - ref_pointer_array Array of references to Items used in current select - group_list GROUP BY list (is NULL by default) + @param thd Thread handle + @param all_fields List of all fields used in select + @param select Current select + @param ref_pointer_array Array of references to Items used in current select + @param group_list GROUP BY list (is NULL by default) - DESCRIPTION - The function serves 3 purposes - adds fields referenced from inner - selects to the current select list, resolves which class to use - to access referenced item (Item_ref of Item_direct_ref) and fixes - references (Item_ref objects) to these fields. + @details + The function serves 3 purposes - If a field isn't already in the select list and the ref_pointer_array + - adds fields referenced from inner query blocks to the current select list + + - Decides which class to use to reference the items (Item_ref or + Item_direct_ref) + + - fixes references (Item_ref objects) to these fields. + + If a field isn't already on the select list and the ref_pointer_array is provided then it is added to the all_fields list and the pointer to it is saved in the ref_pointer_array. The class to access the outer field is determined by the following rules: - 1. If the outer field isn't used under an aggregate function - then the Item_ref class should be used. - 2. If the outer field is used under an aggregate function and this - function is aggregated in the select where the outer field was - resolved or in some more inner select then the Item_direct_ref - class should be used. - Also it should be used if we are grouping by a subquery containing - the outer field. + + -#. If the outer field isn't used under an aggregate function then the + Item_ref class should be used. + + -#. If the outer field is used under an aggregate function and this + function is, in turn, aggregated in the query block where the outer + field was resolved or some query nested therein, then the + Item_direct_ref class should be used. Also it should be used if we are + grouping by a subquery containing the outer field. + The resolution is done here and not at the fix_fields() stage as - it can be done only after sum functions are fixed and pulled up to - selects where they are have to be aggregated. + it can be done only after aggregate functions are fixed and pulled up to + selects where they are to be aggregated. + When the class is chosen it substitutes the original field in the Item_outer_ref object. After this we proceed with fixing references (Item_outer_ref objects) to this field from inner subqueries. - RETURN - TRUE an error occured - FALSE ok -*/ + @return Status + @retval true An error occured. + @retval false OK. + */ bool fix_inner_refs(THD *thd, List &all_fields, SELECT_LEX *select, Item **ref_pointer_array, ORDER *group_list) { Item_outer_ref *ref; - bool res= FALSE; - bool direct_ref= FALSE; List_iterator ref_it(select->inner_refs_list); while ((ref= ref_it++)) { + bool direct_ref= false; Item *item= ref->outer_ref; Item **item_ref= ref->ref; Item_ref *new_ref; @@ -404,7 +408,7 @@ fix_inner_refs(THD *thd, List &all_fields, SELECT_LEX *select, return TRUE; thd->used_tables|= item->used_tables(); } - return res; + return false; } /** From 5f55c23208c746bd1211c09237fe85303dd49567 Mon Sep 17 00:00:00 2001 From: Alexander Barkov Date: Fri, 18 Feb 2011 16:12:36 +0300 Subject: [PATCH 122/202] Bug#11765108 (Bug#58036) client utf32, utf16, ucs2 should be disallowed, they crash server A separate fix for 5.1 (as 5.1 and 5.5 have seriously differged in the related pieces of the code). A patch for 5.5 was approved earlier. Problem: ucs2 was correctly disallowed in "SET NAMES" only, while mysql_real_connect() and mysql_change_user() still allowed to use ucs2, which made server crash. Fix: disallow ucs2 in mysql_real_connect() and mysql_change_user(). @ sql/sql_priv.h - changing return type for thd_init_client_charset() to bool, to return errors to the caller @ sql/sql_var.cc - using new function @ sql/sql_connect.cc - thd_client_charset_init: in case of unsupported client character set send error and return true; in case of success return false - check_connection: Return error if character set initialization failed @ sql/sql_parse.cc - check charset in the very beginnig of the CMD_CHANGE_USER handling code @ tests/mysql_client_test.c - adding tests --- sql/mysql_priv.h | 6 +++- sql/set_var.cc | 2 +- sql/sql_connect.cc | 34 +++++++++++++++++--- sql/sql_parse.cc | 17 ++++++++-- tests/mysql_client_test.c | 67 +++++++++++++++++++++++++++++++++++++++ 5 files changed, 117 insertions(+), 9 deletions(-) diff --git a/sql/mysql_priv.h b/sql/mysql_priv.h index 1838f0c924d..67631b265ab 100644 --- a/sql/mysql_priv.h +++ b/sql/mysql_priv.h @@ -1019,7 +1019,11 @@ void reset_mqh(LEX_USER *lu, bool get_them); bool check_mqh(THD *thd, uint check_command); void time_out_user_resource_limits(THD *thd, USER_CONN *uc); void decrease_user_connections(USER_CONN *uc); -void thd_init_client_charset(THD *thd, uint cs_number); +bool thd_init_client_charset(THD *thd, uint cs_number); +inline bool is_supported_parser_charset(CHARSET_INFO *cs) +{ + return test(cs->mbminlen == 1); +} bool setup_connection_thread_globals(THD *thd); int mysql_create_db(THD *thd, char *db, HA_CREATE_INFO *create, bool silent); diff --git a/sql/set_var.cc b/sql/set_var.cc index 26c9b06a912..831b68bbe14 100644 --- a/sql/set_var.cc +++ b/sql/set_var.cc @@ -2187,7 +2187,7 @@ bool sys_var_character_set_client::check(THD *thd, set_var *var) if (sys_var_character_set_sv::check(thd, var)) return 1; /* Currently, UCS-2 cannot be used as a client character set */ - if (var->save_result.charset->mbminlen > 1) + if (!is_supported_parser_charset(var->save_result.charset)) { my_error(ER_WRONG_VALUE_FOR_VAR, MYF(0), name, var->save_result.charset->csname); diff --git a/sql/sql_connect.cc b/sql/sql_connect.cc index 9fa6966baa2..8129324e300 100644 --- a/sql/sql_connect.cc +++ b/sql/sql_connect.cc @@ -582,8 +582,23 @@ void reset_mqh(LEX_USER *lu, bool get_them= 0) } -void thd_init_client_charset(THD *thd, uint cs_number) +/** + Set thread character set variables from the given ID + + @param thd thread handle + @param cs_number character set and collation ID + + @retval 0 OK; character_set_client, collation_connection and + character_set_results are set to the new value, + or to the default global values. + + @retval 1 error, e.g. the given ID is not supported by parser. + Corresponding SQL error is sent. +*/ + +bool thd_init_client_charset(THD *thd, uint cs_number) { + CHARSET_INFO *cs; /* Use server character set and collation if - opt_character_set_client_handshake is not set @@ -592,10 +607,10 @@ void thd_init_client_charset(THD *thd, uint cs_number) - client character set doesn't exists in server */ if (!opt_character_set_client_handshake || - !(thd->variables.character_set_client= get_charset(cs_number, MYF(0))) || + !(cs= get_charset(cs_number, MYF(0))) || !my_strcasecmp(&my_charset_latin1, global_system_variables.character_set_client->name, - thd->variables.character_set_client->name)) + cs->name)) { thd->variables.character_set_client= global_system_variables.character_set_client; @@ -606,10 +621,18 @@ void thd_init_client_charset(THD *thd, uint cs_number) } else { + if (!is_supported_parser_charset(cs)) + { + /* Disallow non-supported parser character sets: UCS2, UTF16, UTF32 */ + my_error(ER_WRONG_VALUE_FOR_VAR, MYF(0), "character_set_client", + cs->csname); + return true; + } thd->variables.character_set_results= thd->variables.collation_connection= - thd->variables.character_set_client; + thd->variables.character_set_client= cs; } + return false; } @@ -782,7 +805,8 @@ static int check_connection(THD *thd) thd->client_capabilities|= ((ulong) uint2korr(net->read_pos+2)) << 16; thd->max_client_packet_length= uint4korr(net->read_pos+4); DBUG_PRINT("info", ("client_character_set: %d", (uint) net->read_pos[8])); - thd_init_client_charset(thd, (uint) net->read_pos[8]); + if (thd_init_client_charset(thd, (uint) net->read_pos[8])) + return 1; thd->update_charset(); end= (char*) net->read_pos+32; } diff --git a/sql/sql_parse.cc b/sql/sql_parse.cc index 6ce800312ff..9bf55f4dcdd 100644 --- a/sql/sql_parse.cc +++ b/sql/sql_parse.cc @@ -1153,13 +1153,22 @@ bool dispatch_command(enum enum_server_command command, THD *thd, if (ptr < packet_end) { + CHARSET_INFO *cs; if (ptr + 2 > packet_end) { my_message(ER_UNKNOWN_COM_ERROR, ER(ER_UNKNOWN_COM_ERROR), MYF(0)); break; } - cs_number= uint2korr(ptr); + if ((cs_number= uint2korr(ptr)) && + (cs= get_charset(cs_number, MYF(0))) && + !is_supported_parser_charset(cs)) + { + /* Disallow non-supported parser character sets: UCS2, UTF16, UTF32 */ + my_error(ER_WRONG_VALUE_FOR_VAR, MYF(0), "character_set_client", + cs->csname); + break; + } } /* Convert database name to utf8 */ @@ -1205,7 +1214,11 @@ bool dispatch_command(enum enum_server_command command, THD *thd, if (cs_number) { - thd_init_client_charset(thd, cs_number); + /* + We have checked charset earlier, + so thd_init_client_charset cannot fail. + */ + DBUG_ASSERT(!thd_init_client_charset(thd, cs_number)); thd->update_charset(); } } diff --git a/tests/mysql_client_test.c b/tests/mysql_client_test.c index 80c7be64e94..5a45c132a5f 100644 --- a/tests/mysql_client_test.c +++ b/tests/mysql_client_test.c @@ -18398,6 +18398,72 @@ static void test_bug47485() } +/* + Bug#58036 client utf32, utf16, ucs2 should be disallowed, they crash server +*/ +static void test_bug58036() +{ + MYSQL *conn; + DBUG_ENTER("test_bug47485"); + myheader("test_bug58036"); + + /* Part1: try to connect with ucs2 client character set */ + conn= mysql_client_init(NULL); + mysql_options(conn, MYSQL_SET_CHARSET_NAME, "ucs2"); + if (mysql_real_connect(conn, opt_host, opt_user, + opt_password, opt_db ? opt_db : "test", + opt_port, opt_unix_socket, 0)) + { + if (!opt_silent) + printf("mysql_real_connect() succeeded (failure expected)\n"); + mysql_close(conn); + DIE(); + } + + if (!opt_silent) + printf("Got mysql_real_connect() error (expected): %s (%d)\n", + mysql_error(conn), mysql_errno(conn)); + DIE_UNLESS(mysql_errno(conn) == ER_WRONG_VALUE_FOR_VAR); + mysql_close(conn); + + + /* + Part2: + - connect with latin1 + - then change client character set to ucs2 + - then try mysql_change_user() + */ + conn= mysql_client_init(NULL); + mysql_options(conn, MYSQL_SET_CHARSET_NAME, "latin1"); + if (!mysql_real_connect(conn, opt_host, opt_user, + opt_password, opt_db ? opt_db : "test", + opt_port, opt_unix_socket, 0)) + { + if (!opt_silent) + printf("mysql_real_connect() failed: %s (%d)\n", + mysql_error(conn), mysql_errno(conn)); + mysql_close(conn); + DIE(); + } + + mysql_options(conn, MYSQL_SET_CHARSET_NAME, "ucs2"); + if (!mysql_change_user(conn, opt_user, opt_password, NULL)) + { + if (!opt_silent) + printf("mysql_change_user() succedded, error expected!"); + mysql_close(conn); + DIE(); + } + + if (!opt_silent) + printf("Got mysql_change_user() error (expected): %s (%d)\n", + mysql_error(conn), mysql_errno(conn)); + mysql_close(conn); + + DBUG_VOID_RETURN; +} + + /* Read and parse arguments and MySQL options from my.cnf */ @@ -18724,6 +18790,7 @@ static struct my_tests_st my_tests[]= { { "test_bug42373", test_bug42373 }, { "test_bug54041", test_bug54041 }, { "test_bug47485", test_bug47485 }, + { "test_bug58036", test_bug58036 }, { 0, 0 } }; From e2e6eb8f6d3dabbf335870efa29fcb77248ab156 Mon Sep 17 00:00:00 2001 From: Alexander Barkov Date: Fri, 18 Feb 2011 17:17:37 +0300 Subject: [PATCH 123/202] A post-fix for b58036. --- tests/mysql_client_test.c | 6 +++--- 1 file changed, 3 insertions(+), 3 deletions(-) diff --git a/tests/mysql_client_test.c b/tests/mysql_client_test.c index 5a45c132a5f..fc1f2e8293e 100644 --- a/tests/mysql_client_test.c +++ b/tests/mysql_client_test.c @@ -18417,7 +18417,7 @@ static void test_bug58036() if (!opt_silent) printf("mysql_real_connect() succeeded (failure expected)\n"); mysql_close(conn); - DIE(); + DIE(""); } if (!opt_silent) @@ -18443,7 +18443,7 @@ static void test_bug58036() printf("mysql_real_connect() failed: %s (%d)\n", mysql_error(conn), mysql_errno(conn)); mysql_close(conn); - DIE(); + DIE(""); } mysql_options(conn, MYSQL_SET_CHARSET_NAME, "ucs2"); @@ -18452,7 +18452,7 @@ static void test_bug58036() if (!opt_silent) printf("mysql_change_user() succedded, error expected!"); mysql_close(conn); - DIE(); + DIE(""); } if (!opt_silent) From 876502d7439f3cf34d8554d22f28f06bf8b54388 Mon Sep 17 00:00:00 2001 From: Nirbhay Choubey Date: Mon, 21 Feb 2011 12:37:24 +0530 Subject: [PATCH 124/202] Bug#11766310 : 59398: MYSQLDUMP 5.1 CAN'T HANDLE A DASH ("-") IN DATABASE NAMES IN ALTER DATABASE. mysqldump did not quote database name in 'ALTER DATABASE' statements in its output. This can further cause a failure while loading if database name contains a hyphen '-'. This happened as, while printing the 'ALTER DATABASE' statements, the database name was not quoted. Fixed by quoting the database name. client/mysqldump.c: Bug#11766310 : 59398: MYSQLDUMP 5.1 CAN'T HANDLE A DASH ("-") IN DATABASE NAMES IN ALTER DATABASE. Modified the print statement in order to print the quoted database name for 'ALTER DATABASE' statements. mysql-test/r/mysqldump.result: Added a test case for bug#11766310. mysql-test/t/mysqldump.test: Added a test case for bug#11766310. --- client/mysqldump.c | 10 ++++++++-- mysql-test/r/mysqldump.result | 36 +++++++++++++++++++++++++++++++++++ mysql-test/t/mysqldump.test | 21 ++++++++++++++++++++ 3 files changed, 65 insertions(+), 2 deletions(-) diff --git a/client/mysqldump.c b/client/mysqldump.c index 57e3f5b0349..0f2f1562ce5 100644 --- a/client/mysqldump.c +++ b/client/mysqldump.c @@ -1134,6 +1134,9 @@ static int switch_db_collation(FILE *sql_file, { if (strcmp(current_db_cl_name, required_db_cl_name) != 0) { + char quoted_db_buf[NAME_LEN * 2 + 3]; + char *quoted_db_name= quote_name(db_name, quoted_db_buf, FALSE); + CHARSET_INFO *db_cl= get_charset_by_name(required_db_cl_name, MYF(0)); if (!db_cl) @@ -1141,7 +1144,7 @@ static int switch_db_collation(FILE *sql_file, fprintf(sql_file, "ALTER DATABASE %s CHARACTER SET %s COLLATE %s %s\n", - (const char *) db_name, + (const char *) quoted_db_name, (const char *) db_cl->csname, (const char *) db_cl->name, (const char *) delimiter); @@ -1162,6 +1165,9 @@ static int restore_db_collation(FILE *sql_file, const char *delimiter, const char *db_cl_name) { + char quoted_db_buf[NAME_LEN * 2 + 3]; + char *quoted_db_name= quote_name(db_name, quoted_db_buf, FALSE); + CHARSET_INFO *db_cl= get_charset_by_name(db_cl_name, MYF(0)); if (!db_cl) @@ -1169,7 +1175,7 @@ static int restore_db_collation(FILE *sql_file, fprintf(sql_file, "ALTER DATABASE %s CHARACTER SET %s COLLATE %s %s\n", - (const char *) db_name, + (const char *) quoted_db_name, (const char *) db_cl->csname, (const char *) db_cl->name, (const char *) delimiter); diff --git a/mysql-test/r/mysqldump.result b/mysql-test/r/mysqldump.result index 289e7f66406..fb70e0f1731 100644 --- a/mysql-test/r/mysqldump.result +++ b/mysql-test/r/mysqldump.result @@ -4591,5 +4591,41 @@ CREATE TABLE `comment_table` (i INT COMMENT 'FIELD COMMENT') COMMENT = 'TABLE CO DROP TABLE `comment_table`; # +# BUG#11766310 : 59398: MYSQLDUMP 5.1 CAN'T HANDLE A DASH ("-") IN +# DATABASE NAMES IN ALTER DATABASE +# +CREATE DATABASE `test-database`; +USE `test-database`; +CREATE TABLE `test` (`c1` VARCHAR(10)) ENGINE=MYISAM DEFAULT CHARSET=utf8 COLLATE=utf8_unicode_ci; +CREATE TRIGGER `trig` BEFORE INSERT ON `test` FOR EACH ROW BEGIN +END | +ALTER DATABASE `test-database` CHARACTER SET latin1 COLLATE latin1_swedish_ci; +ALTER DATABASE `test-database` CHARACTER SET utf8 COLLATE utf8_unicode_ci ; +/*!40101 SET @saved_cs_client = @@character_set_client */; +/*!40101 SET character_set_client = utf8 */; +CREATE TABLE `test` ( + `c1` varchar(10) COLLATE utf8_unicode_ci DEFAULT NULL +) ENGINE=MyISAM DEFAULT CHARSET=utf8 COLLATE=utf8_unicode_ci; +/*!40101 SET character_set_client = @saved_cs_client */; +ALTER DATABASE `test-database` CHARACTER SET latin1 COLLATE latin1_swedish_ci ; +/*!50003 SET @saved_cs_client = @@character_set_client */ ; +/*!50003 SET @saved_cs_results = @@character_set_results */ ; +/*!50003 SET @saved_col_connection = @@collation_connection */ ; +/*!50003 SET character_set_client = latin1 */ ; +/*!50003 SET character_set_results = latin1 */ ; +/*!50003 SET collation_connection = latin1_swedish_ci */ ; +/*!50003 SET @saved_sql_mode = @@sql_mode */ ; +/*!50003 SET sql_mode = '' */ ; +DELIMITER ;; +/*!50003 CREATE*/ /*!50017 DEFINER=`root`@`localhost`*/ /*!50003 TRIGGER `trig` BEFORE INSERT ON `test` FOR EACH ROW BEGIN +END */;; +DELIMITER ; +/*!50003 SET sql_mode = @saved_sql_mode */ ; +/*!50003 SET character_set_client = @saved_cs_client */ ; +/*!50003 SET character_set_results = @saved_cs_results */ ; +/*!50003 SET collation_connection = @saved_col_connection */ ; +ALTER DATABASE `test-database` CHARACTER SET utf8 COLLATE utf8_unicode_ci ; +DROP DATABASE `test-database`; +# # End of 5.1 tests # diff --git a/mysql-test/t/mysqldump.test b/mysql-test/t/mysqldump.test index fe0b05dbb42..0b533284ffa 100644 --- a/mysql-test/t/mysqldump.test +++ b/mysql-test/t/mysqldump.test @@ -2173,6 +2173,27 @@ CREATE TABLE `comment_table` (i INT COMMENT 'FIELD COMMENT') COMMENT = 'TABLE CO --exec $MYSQL_DUMP --compact --skip-create --xml test DROP TABLE `comment_table`; +--echo # +--echo # BUG#11766310 : 59398: MYSQLDUMP 5.1 CAN'T HANDLE A DASH ("-") IN +--echo # DATABASE NAMES IN ALTER DATABASE +--echo # + +CREATE DATABASE `test-database`; +USE `test-database`; +CREATE TABLE `test` (`c1` VARCHAR(10)) ENGINE=MYISAM DEFAULT CHARSET=utf8 COLLATE=utf8_unicode_ci; + +DELIMITER |; +CREATE TRIGGER `trig` BEFORE INSERT ON `test` FOR EACH ROW BEGIN +END | +DELIMITER ;| + +ALTER DATABASE `test-database` CHARACTER SET latin1 COLLATE latin1_swedish_ci; +ALTER DATABASE `test-database` CHARACTER SET utf8 COLLATE utf8_unicode_ci ; + +--exec $MYSQL_DUMP --quote-names --compact test-database + +DROP DATABASE `test-database`; + --echo # --echo # End of 5.1 tests --echo # From f27a13cf09290c75f9945cca9198fc2a8e2a9d4d Mon Sep 17 00:00:00 2001 From: Nirbhay Choubey Date: Tue, 22 Feb 2011 19:28:50 +0530 Subject: [PATCH 125/202] Postfix for tests failing due to fix for bug#11766310. --- mysql-test/r/ddl_i18n_koi8r.result | 48 +++++++++++++++--------------- mysql-test/r/ddl_i18n_utf8.result | 48 +++++++++++++++--------------- 2 files changed, 48 insertions(+), 48 deletions(-) diff --git a/mysql-test/r/ddl_i18n_koi8r.result b/mysql-test/r/ddl_i18n_koi8r.result index fe24c17a1c5..4a4a425362d 100644 --- a/mysql-test/r/ddl_i18n_koi8r.result +++ b/mysql-test/r/ddl_i18n_koi8r.result @@ -724,7 +724,7 @@ utf8_general_ci utf8_general_ci CREATE DATABASE /*!32312 IF NOT EXISTS*/ `mysqltest1` /*!40100 DEFAULT CHARACTER SET cp866 */; USE `mysqltest1`; -ALTER DATABASE mysqltest1 CHARACTER SET utf8 COLLATE utf8_unicode_ci ; +ALTER DATABASE `mysqltest1` CHARACTER SET utf8 COLLATE utf8_unicode_ci ; /*!50003 SET @saved_cs_client = @@character_set_client */ ; /*!50003 SET @saved_cs_results = @@character_set_results */ ; /*!50003 SET @saved_col_connection = @@collation_connection */ ; @@ -757,8 +757,8 @@ DELIMITER ; /*!50003 SET character_set_client = @saved_cs_client */ ; /*!50003 SET character_set_results = @saved_cs_results */ ; /*!50003 SET collation_connection = @saved_col_connection */ ; -ALTER DATABASE mysqltest1 CHARACTER SET cp866 COLLATE cp866_general_ci ; -ALTER DATABASE mysqltest1 CHARACTER SET utf8 COLLATE utf8_unicode_ci ; +ALTER DATABASE `mysqltest1` CHARACTER SET cp866 COLLATE cp866_general_ci ; +ALTER DATABASE `mysqltest1` CHARACTER SET utf8 COLLATE utf8_unicode_ci ; /*!50003 SET @saved_cs_client = @@character_set_client */ ; /*!50003 SET @saved_cs_results = @@character_set_results */ ; /*!50003 SET @saved_col_connection = @@collation_connection */ ; @@ -791,7 +791,7 @@ DELIMITER ; /*!50003 SET character_set_client = @saved_cs_client */ ; /*!50003 SET character_set_results = @saved_cs_results */ ; /*!50003 SET collation_connection = @saved_col_connection */ ; -ALTER DATABASE mysqltest1 CHARACTER SET cp866 COLLATE cp866_general_ci ; +ALTER DATABASE `mysqltest1` CHARACTER SET cp866 COLLATE cp866_general_ci ; ---> Dumping mysqltest1 to ddl_i18n_koi8r.sp.mysqltest1.sql @@ -800,7 +800,7 @@ ALTER DATABASE mysqltest1 CHARACTER SET cp866 COLLATE cp866_general_ci ; CREATE DATABASE /*!32312 IF NOT EXISTS*/ `mysqltest2` /*!40100 DEFAULT CHARACTER SET cp866 */; USE `mysqltest2`; -ALTER DATABASE mysqltest2 CHARACTER SET utf8 COLLATE utf8_unicode_ci ; +ALTER DATABASE `mysqltest2` CHARACTER SET utf8 COLLATE utf8_unicode_ci ; /*!50003 SET @saved_cs_client = @@character_set_client */ ; /*!50003 SET @saved_cs_results = @@character_set_results */ ; /*!50003 SET @saved_col_connection = @@collation_connection */ ; @@ -833,8 +833,8 @@ DELIMITER ; /*!50003 SET character_set_client = @saved_cs_client */ ; /*!50003 SET character_set_results = @saved_cs_results */ ; /*!50003 SET collation_connection = @saved_col_connection */ ; -ALTER DATABASE mysqltest2 CHARACTER SET cp866 COLLATE cp866_general_ci ; -ALTER DATABASE mysqltest2 CHARACTER SET utf8 COLLATE utf8_unicode_ci ; +ALTER DATABASE `mysqltest2` CHARACTER SET cp866 COLLATE cp866_general_ci ; +ALTER DATABASE `mysqltest2` CHARACTER SET utf8 COLLATE utf8_unicode_ci ; /*!50003 SET @saved_cs_client = @@character_set_client */ ; /*!50003 SET @saved_cs_results = @@character_set_results */ ; /*!50003 SET @saved_col_connection = @@collation_connection */ ; @@ -867,7 +867,7 @@ DELIMITER ; /*!50003 SET character_set_client = @saved_cs_client */ ; /*!50003 SET character_set_results = @saved_cs_results */ ; /*!50003 SET collation_connection = @saved_col_connection */ ; -ALTER DATABASE mysqltest2 CHARACTER SET cp866 COLLATE cp866_general_ci ; +ALTER DATABASE `mysqltest2` CHARACTER SET cp866 COLLATE cp866_general_ci ; ---> Dumping mysqltest2 to ddl_i18n_koi8r.sp.mysqltest2.sql @@ -1742,7 +1742,7 @@ CREATE TABLE `t1` ( ) ENGINE=MyISAM DEFAULT CHARSET=utf8 COLLATE=utf8_unicode_ci; /*!40101 SET character_set_client = @saved_cs_client */; INSERT INTO `t1` VALUES (1),(0),(1); -ALTER DATABASE mysqltest1 CHARACTER SET utf8 COLLATE utf8_unicode_ci ; +ALTER DATABASE `mysqltest1` CHARACTER SET utf8 COLLATE utf8_unicode_ci ; /*!50003 SET @saved_cs_client = @@character_set_client */ ; /*!50003 SET @saved_cs_results = @@character_set_results */ ; /*!50003 SET @saved_col_connection = @@collation_connection */ ; @@ -1770,8 +1770,8 @@ DELIMITER ; /*!50003 SET character_set_client = @saved_cs_client */ ; /*!50003 SET character_set_results = @saved_cs_results */ ; /*!50003 SET collation_connection = @saved_col_connection */ ; -ALTER DATABASE mysqltest1 CHARACTER SET cp866 COLLATE cp866_general_ci ; -ALTER DATABASE mysqltest1 CHARACTER SET utf8 COLLATE utf8_unicode_ci ; +ALTER DATABASE `mysqltest1` CHARACTER SET cp866 COLLATE cp866_general_ci ; +ALTER DATABASE `mysqltest1` CHARACTER SET utf8 COLLATE utf8_unicode_ci ; /*!50003 SET @saved_cs_client = @@character_set_client */ ; /*!50003 SET @saved_cs_results = @@character_set_results */ ; /*!50003 SET @saved_col_connection = @@collation_connection */ ; @@ -1799,7 +1799,7 @@ DELIMITER ; /*!50003 SET character_set_client = @saved_cs_client */ ; /*!50003 SET character_set_results = @saved_cs_results */ ; /*!50003 SET collation_connection = @saved_col_connection */ ; -ALTER DATABASE mysqltest1 CHARACTER SET cp866 COLLATE cp866_general_ci ; +ALTER DATABASE `mysqltest1` CHARACTER SET cp866 COLLATE cp866_general_ci ; ---> Dumping mysqltest1 to ddl_i18n_koi8r.triggers.mysqltest1.sql @@ -1821,7 +1821,7 @@ CREATE TABLE `t1` ( ) ENGINE=MyISAM DEFAULT CHARSET=utf8 COLLATE=utf8_unicode_ci; /*!40101 SET character_set_client = @saved_cs_client */; INSERT INTO `t1` VALUES (1),(0),(1); -ALTER DATABASE mysqltest2 CHARACTER SET utf8 COLLATE utf8_unicode_ci ; +ALTER DATABASE `mysqltest2` CHARACTER SET utf8 COLLATE utf8_unicode_ci ; /*!50003 SET @saved_cs_client = @@character_set_client */ ; /*!50003 SET @saved_cs_results = @@character_set_results */ ; /*!50003 SET @saved_col_connection = @@collation_connection */ ; @@ -1849,8 +1849,8 @@ DELIMITER ; /*!50003 SET character_set_client = @saved_cs_client */ ; /*!50003 SET character_set_results = @saved_cs_results */ ; /*!50003 SET collation_connection = @saved_col_connection */ ; -ALTER DATABASE mysqltest2 CHARACTER SET cp866 COLLATE cp866_general_ci ; -ALTER DATABASE mysqltest2 CHARACTER SET utf8 COLLATE utf8_unicode_ci ; +ALTER DATABASE `mysqltest2` CHARACTER SET cp866 COLLATE cp866_general_ci ; +ALTER DATABASE `mysqltest2` CHARACTER SET utf8 COLLATE utf8_unicode_ci ; /*!50003 SET @saved_cs_client = @@character_set_client */ ; /*!50003 SET @saved_cs_results = @@character_set_results */ ; /*!50003 SET @saved_col_connection = @@collation_connection */ ; @@ -1878,7 +1878,7 @@ DELIMITER ; /*!50003 SET character_set_client = @saved_cs_client */ ; /*!50003 SET character_set_results = @saved_cs_results */ ; /*!50003 SET collation_connection = @saved_col_connection */ ; -ALTER DATABASE mysqltest2 CHARACTER SET cp866 COLLATE cp866_general_ci ; +ALTER DATABASE `mysqltest2` CHARACTER SET cp866 COLLATE cp866_general_ci ; ---> Dumping mysqltest2 to ddl_i18n_koi8r.triggers.mysqltest2.sql @@ -2486,7 +2486,7 @@ CREATE DATABASE /*!32312 IF NOT EXISTS*/ `mysqltest1` /*!40100 DEFAULT CHARACTER USE `mysqltest1`; /*!50106 SET @save_time_zone= @@TIME_ZONE */ ; DELIMITER ;; -ALTER DATABASE mysqltest1 CHARACTER SET utf8 COLLATE utf8_unicode_ci ;; +ALTER DATABASE `mysqltest1` CHARACTER SET utf8 COLLATE utf8_unicode_ci ;; /*!50003 SET @saved_cs_client = @@character_set_client */ ;; /*!50003 SET @saved_cs_results = @@character_set_results */ ;; /*!50003 SET @saved_col_connection = @@collation_connection */ ;; @@ -2512,9 +2512,9 @@ END */ ;; /*!50003 SET character_set_client = @saved_cs_client */ ;; /*!50003 SET character_set_results = @saved_cs_results */ ;; /*!50003 SET collation_connection = @saved_col_connection */ ;; -ALTER DATABASE mysqltest1 CHARACTER SET cp866 COLLATE cp866_general_ci ;; +ALTER DATABASE `mysqltest1` CHARACTER SET cp866 COLLATE cp866_general_ci ;; DELIMITER ;; -ALTER DATABASE mysqltest1 CHARACTER SET utf8 COLLATE utf8_unicode_ci ;; +ALTER DATABASE `mysqltest1` CHARACTER SET utf8 COLLATE utf8_unicode_ci ;; /*!50003 SET @saved_cs_client = @@character_set_client */ ;; /*!50003 SET @saved_cs_results = @@character_set_results */ ;; /*!50003 SET @saved_col_connection = @@collation_connection */ ;; @@ -2540,7 +2540,7 @@ END */ ;; /*!50003 SET character_set_client = @saved_cs_client */ ;; /*!50003 SET character_set_results = @saved_cs_results */ ;; /*!50003 SET collation_connection = @saved_col_connection */ ;; -ALTER DATABASE mysqltest1 CHARACTER SET cp866 COLLATE cp866_general_ci ;; +ALTER DATABASE `mysqltest1` CHARACTER SET cp866 COLLATE cp866_general_ci ;; DELIMITER ; /*!50106 SET TIME_ZONE= @save_time_zone */ ; @@ -2553,7 +2553,7 @@ CREATE DATABASE /*!32312 IF NOT EXISTS*/ `mysqltest2` /*!40100 DEFAULT CHARACTER USE `mysqltest2`; /*!50106 SET @save_time_zone= @@TIME_ZONE */ ; DELIMITER ;; -ALTER DATABASE mysqltest2 CHARACTER SET utf8 COLLATE utf8_unicode_ci ;; +ALTER DATABASE `mysqltest2` CHARACTER SET utf8 COLLATE utf8_unicode_ci ;; /*!50003 SET @saved_cs_client = @@character_set_client */ ;; /*!50003 SET @saved_cs_results = @@character_set_results */ ;; /*!50003 SET @saved_col_connection = @@collation_connection */ ;; @@ -2579,9 +2579,9 @@ END */ ;; /*!50003 SET character_set_client = @saved_cs_client */ ;; /*!50003 SET character_set_results = @saved_cs_results */ ;; /*!50003 SET collation_connection = @saved_col_connection */ ;; -ALTER DATABASE mysqltest2 CHARACTER SET cp866 COLLATE cp866_general_ci ;; +ALTER DATABASE `mysqltest2` CHARACTER SET cp866 COLLATE cp866_general_ci ;; DELIMITER ;; -ALTER DATABASE mysqltest2 CHARACTER SET utf8 COLLATE utf8_unicode_ci ;; +ALTER DATABASE `mysqltest2` CHARACTER SET utf8 COLLATE utf8_unicode_ci ;; /*!50003 SET @saved_cs_client = @@character_set_client */ ;; /*!50003 SET @saved_cs_results = @@character_set_results */ ;; /*!50003 SET @saved_col_connection = @@collation_connection */ ;; @@ -2607,7 +2607,7 @@ END */ ;; /*!50003 SET character_set_client = @saved_cs_client */ ;; /*!50003 SET character_set_results = @saved_cs_results */ ;; /*!50003 SET collation_connection = @saved_col_connection */ ;; -ALTER DATABASE mysqltest2 CHARACTER SET cp866 COLLATE cp866_general_ci ;; +ALTER DATABASE `mysqltest2` CHARACTER SET cp866 COLLATE cp866_general_ci ;; DELIMITER ; /*!50106 SET TIME_ZONE= @save_time_zone */ ; diff --git a/mysql-test/r/ddl_i18n_utf8.result b/mysql-test/r/ddl_i18n_utf8.result index cf4272bf90c..7969ccafa09 100644 --- a/mysql-test/r/ddl_i18n_utf8.result +++ b/mysql-test/r/ddl_i18n_utf8.result @@ -724,7 +724,7 @@ utf8_general_ci utf8_general_ci CREATE DATABASE /*!32312 IF NOT EXISTS*/ `mysqltest1` /*!40100 DEFAULT CHARACTER SET cp866 */; USE `mysqltest1`; -ALTER DATABASE mysqltest1 CHARACTER SET utf8 COLLATE utf8_unicode_ci ; +ALTER DATABASE `mysqltest1` CHARACTER SET utf8 COLLATE utf8_unicode_ci ; /*!50003 SET @saved_cs_client = @@character_set_client */ ; /*!50003 SET @saved_cs_results = @@character_set_results */ ; /*!50003 SET @saved_col_connection = @@collation_connection */ ; @@ -757,8 +757,8 @@ DELIMITER ; /*!50003 SET character_set_client = @saved_cs_client */ ; /*!50003 SET character_set_results = @saved_cs_results */ ; /*!50003 SET collation_connection = @saved_col_connection */ ; -ALTER DATABASE mysqltest1 CHARACTER SET cp866 COLLATE cp866_general_ci ; -ALTER DATABASE mysqltest1 CHARACTER SET utf8 COLLATE utf8_unicode_ci ; +ALTER DATABASE `mysqltest1` CHARACTER SET cp866 COLLATE cp866_general_ci ; +ALTER DATABASE `mysqltest1` CHARACTER SET utf8 COLLATE utf8_unicode_ci ; /*!50003 SET @saved_cs_client = @@character_set_client */ ; /*!50003 SET @saved_cs_results = @@character_set_results */ ; /*!50003 SET @saved_col_connection = @@collation_connection */ ; @@ -791,7 +791,7 @@ DELIMITER ; /*!50003 SET character_set_client = @saved_cs_client */ ; /*!50003 SET character_set_results = @saved_cs_results */ ; /*!50003 SET collation_connection = @saved_col_connection */ ; -ALTER DATABASE mysqltest1 CHARACTER SET cp866 COLLATE cp866_general_ci ; +ALTER DATABASE `mysqltest1` CHARACTER SET cp866 COLLATE cp866_general_ci ; ---> Dumping mysqltest1 to ddl_i18n_utf8sp.mysqltest1.sql @@ -800,7 +800,7 @@ ALTER DATABASE mysqltest1 CHARACTER SET cp866 COLLATE cp866_general_ci ; CREATE DATABASE /*!32312 IF NOT EXISTS*/ `mysqltest2` /*!40100 DEFAULT CHARACTER SET cp866 */; USE `mysqltest2`; -ALTER DATABASE mysqltest2 CHARACTER SET utf8 COLLATE utf8_unicode_ci ; +ALTER DATABASE `mysqltest2` CHARACTER SET utf8 COLLATE utf8_unicode_ci ; /*!50003 SET @saved_cs_client = @@character_set_client */ ; /*!50003 SET @saved_cs_results = @@character_set_results */ ; /*!50003 SET @saved_col_connection = @@collation_connection */ ; @@ -833,8 +833,8 @@ DELIMITER ; /*!50003 SET character_set_client = @saved_cs_client */ ; /*!50003 SET character_set_results = @saved_cs_results */ ; /*!50003 SET collation_connection = @saved_col_connection */ ; -ALTER DATABASE mysqltest2 CHARACTER SET cp866 COLLATE cp866_general_ci ; -ALTER DATABASE mysqltest2 CHARACTER SET utf8 COLLATE utf8_unicode_ci ; +ALTER DATABASE `mysqltest2` CHARACTER SET cp866 COLLATE cp866_general_ci ; +ALTER DATABASE `mysqltest2` CHARACTER SET utf8 COLLATE utf8_unicode_ci ; /*!50003 SET @saved_cs_client = @@character_set_client */ ; /*!50003 SET @saved_cs_results = @@character_set_results */ ; /*!50003 SET @saved_col_connection = @@collation_connection */ ; @@ -867,7 +867,7 @@ DELIMITER ; /*!50003 SET character_set_client = @saved_cs_client */ ; /*!50003 SET character_set_results = @saved_cs_results */ ; /*!50003 SET collation_connection = @saved_col_connection */ ; -ALTER DATABASE mysqltest2 CHARACTER SET cp866 COLLATE cp866_general_ci ; +ALTER DATABASE `mysqltest2` CHARACTER SET cp866 COLLATE cp866_general_ci ; ---> Dumping mysqltest2 to ddl_i18n_utf8sp.mysqltest2.sql @@ -1742,7 +1742,7 @@ CREATE TABLE `t1` ( ) ENGINE=MyISAM DEFAULT CHARSET=utf8 COLLATE=utf8_unicode_ci; /*!40101 SET character_set_client = @saved_cs_client */; INSERT INTO `t1` VALUES (1),(0),(1); -ALTER DATABASE mysqltest1 CHARACTER SET utf8 COLLATE utf8_unicode_ci ; +ALTER DATABASE `mysqltest1` CHARACTER SET utf8 COLLATE utf8_unicode_ci ; /*!50003 SET @saved_cs_client = @@character_set_client */ ; /*!50003 SET @saved_cs_results = @@character_set_results */ ; /*!50003 SET @saved_col_connection = @@collation_connection */ ; @@ -1770,8 +1770,8 @@ DELIMITER ; /*!50003 SET character_set_client = @saved_cs_client */ ; /*!50003 SET character_set_results = @saved_cs_results */ ; /*!50003 SET collation_connection = @saved_col_connection */ ; -ALTER DATABASE mysqltest1 CHARACTER SET cp866 COLLATE cp866_general_ci ; -ALTER DATABASE mysqltest1 CHARACTER SET utf8 COLLATE utf8_unicode_ci ; +ALTER DATABASE `mysqltest1` CHARACTER SET cp866 COLLATE cp866_general_ci ; +ALTER DATABASE `mysqltest1` CHARACTER SET utf8 COLLATE utf8_unicode_ci ; /*!50003 SET @saved_cs_client = @@character_set_client */ ; /*!50003 SET @saved_cs_results = @@character_set_results */ ; /*!50003 SET @saved_col_connection = @@collation_connection */ ; @@ -1799,7 +1799,7 @@ DELIMITER ; /*!50003 SET character_set_client = @saved_cs_client */ ; /*!50003 SET character_set_results = @saved_cs_results */ ; /*!50003 SET collation_connection = @saved_col_connection */ ; -ALTER DATABASE mysqltest1 CHARACTER SET cp866 COLLATE cp866_general_ci ; +ALTER DATABASE `mysqltest1` CHARACTER SET cp866 COLLATE cp866_general_ci ; ---> Dumping mysqltest1 to ddl_i18n_utf8triggers.mysqltest1.sql @@ -1821,7 +1821,7 @@ CREATE TABLE `t1` ( ) ENGINE=MyISAM DEFAULT CHARSET=utf8 COLLATE=utf8_unicode_ci; /*!40101 SET character_set_client = @saved_cs_client */; INSERT INTO `t1` VALUES (1),(0),(1); -ALTER DATABASE mysqltest2 CHARACTER SET utf8 COLLATE utf8_unicode_ci ; +ALTER DATABASE `mysqltest2` CHARACTER SET utf8 COLLATE utf8_unicode_ci ; /*!50003 SET @saved_cs_client = @@character_set_client */ ; /*!50003 SET @saved_cs_results = @@character_set_results */ ; /*!50003 SET @saved_col_connection = @@collation_connection */ ; @@ -1849,8 +1849,8 @@ DELIMITER ; /*!50003 SET character_set_client = @saved_cs_client */ ; /*!50003 SET character_set_results = @saved_cs_results */ ; /*!50003 SET collation_connection = @saved_col_connection */ ; -ALTER DATABASE mysqltest2 CHARACTER SET cp866 COLLATE cp866_general_ci ; -ALTER DATABASE mysqltest2 CHARACTER SET utf8 COLLATE utf8_unicode_ci ; +ALTER DATABASE `mysqltest2` CHARACTER SET cp866 COLLATE cp866_general_ci ; +ALTER DATABASE `mysqltest2` CHARACTER SET utf8 COLLATE utf8_unicode_ci ; /*!50003 SET @saved_cs_client = @@character_set_client */ ; /*!50003 SET @saved_cs_results = @@character_set_results */ ; /*!50003 SET @saved_col_connection = @@collation_connection */ ; @@ -1878,7 +1878,7 @@ DELIMITER ; /*!50003 SET character_set_client = @saved_cs_client */ ; /*!50003 SET character_set_results = @saved_cs_results */ ; /*!50003 SET collation_connection = @saved_col_connection */ ; -ALTER DATABASE mysqltest2 CHARACTER SET cp866 COLLATE cp866_general_ci ; +ALTER DATABASE `mysqltest2` CHARACTER SET cp866 COLLATE cp866_general_ci ; ---> Dumping mysqltest2 to ddl_i18n_utf8triggers.mysqltest2.sql @@ -2486,7 +2486,7 @@ CREATE DATABASE /*!32312 IF NOT EXISTS*/ `mysqltest1` /*!40100 DEFAULT CHARACTER USE `mysqltest1`; /*!50106 SET @save_time_zone= @@TIME_ZONE */ ; DELIMITER ;; -ALTER DATABASE mysqltest1 CHARACTER SET utf8 COLLATE utf8_unicode_ci ;; +ALTER DATABASE `mysqltest1` CHARACTER SET utf8 COLLATE utf8_unicode_ci ;; /*!50003 SET @saved_cs_client = @@character_set_client */ ;; /*!50003 SET @saved_cs_results = @@character_set_results */ ;; /*!50003 SET @saved_col_connection = @@collation_connection */ ;; @@ -2512,9 +2512,9 @@ END */ ;; /*!50003 SET character_set_client = @saved_cs_client */ ;; /*!50003 SET character_set_results = @saved_cs_results */ ;; /*!50003 SET collation_connection = @saved_col_connection */ ;; -ALTER DATABASE mysqltest1 CHARACTER SET cp866 COLLATE cp866_general_ci ;; +ALTER DATABASE `mysqltest1` CHARACTER SET cp866 COLLATE cp866_general_ci ;; DELIMITER ;; -ALTER DATABASE mysqltest1 CHARACTER SET utf8 COLLATE utf8_unicode_ci ;; +ALTER DATABASE `mysqltest1` CHARACTER SET utf8 COLLATE utf8_unicode_ci ;; /*!50003 SET @saved_cs_client = @@character_set_client */ ;; /*!50003 SET @saved_cs_results = @@character_set_results */ ;; /*!50003 SET @saved_col_connection = @@collation_connection */ ;; @@ -2540,7 +2540,7 @@ END */ ;; /*!50003 SET character_set_client = @saved_cs_client */ ;; /*!50003 SET character_set_results = @saved_cs_results */ ;; /*!50003 SET collation_connection = @saved_col_connection */ ;; -ALTER DATABASE mysqltest1 CHARACTER SET cp866 COLLATE cp866_general_ci ;; +ALTER DATABASE `mysqltest1` CHARACTER SET cp866 COLLATE cp866_general_ci ;; DELIMITER ; /*!50106 SET TIME_ZONE= @save_time_zone */ ; @@ -2553,7 +2553,7 @@ CREATE DATABASE /*!32312 IF NOT EXISTS*/ `mysqltest2` /*!40100 DEFAULT CHARACTER USE `mysqltest2`; /*!50106 SET @save_time_zone= @@TIME_ZONE */ ; DELIMITER ;; -ALTER DATABASE mysqltest2 CHARACTER SET utf8 COLLATE utf8_unicode_ci ;; +ALTER DATABASE `mysqltest2` CHARACTER SET utf8 COLLATE utf8_unicode_ci ;; /*!50003 SET @saved_cs_client = @@character_set_client */ ;; /*!50003 SET @saved_cs_results = @@character_set_results */ ;; /*!50003 SET @saved_col_connection = @@collation_connection */ ;; @@ -2579,9 +2579,9 @@ END */ ;; /*!50003 SET character_set_client = @saved_cs_client */ ;; /*!50003 SET character_set_results = @saved_cs_results */ ;; /*!50003 SET collation_connection = @saved_col_connection */ ;; -ALTER DATABASE mysqltest2 CHARACTER SET cp866 COLLATE cp866_general_ci ;; +ALTER DATABASE `mysqltest2` CHARACTER SET cp866 COLLATE cp866_general_ci ;; DELIMITER ;; -ALTER DATABASE mysqltest2 CHARACTER SET utf8 COLLATE utf8_unicode_ci ;; +ALTER DATABASE `mysqltest2` CHARACTER SET utf8 COLLATE utf8_unicode_ci ;; /*!50003 SET @saved_cs_client = @@character_set_client */ ;; /*!50003 SET @saved_cs_results = @@character_set_results */ ;; /*!50003 SET @saved_col_connection = @@collation_connection */ ;; @@ -2607,7 +2607,7 @@ END */ ;; /*!50003 SET character_set_client = @saved_cs_client */ ;; /*!50003 SET character_set_results = @saved_cs_results */ ;; /*!50003 SET collation_connection = @saved_col_connection */ ;; -ALTER DATABASE mysqltest2 CHARACTER SET cp866 COLLATE cp866_general_ci ;; +ALTER DATABASE `mysqltest2` CHARACTER SET cp866 COLLATE cp866_general_ci ;; DELIMITER ; /*!50106 SET TIME_ZONE= @save_time_zone */ ; From 8b3f9560200717a4f06be01e991f4c6ee4758504 Mon Sep 17 00:00:00 2001 From: Bjorn Munch Date: Wed, 23 Feb 2011 10:31:37 +0100 Subject: [PATCH 126/202] Bug #11762407 54999: MTR GLOBAL SUPPRESSION HIDES SQL THREAD EXECUTION UNEXPECTED ERRORS Removed the global suppression, added lots of local ones to affected tests Re-commit, now kept "Slave SQL" at start of patterns. --- mysql-test/extra/binlog_tests/binlog.test | 1 + mysql-test/extra/rpl_tests/rpl_conflicts.test | 2 ++ mysql-test/extra/rpl_tests/rpl_extra_col_master.test | 6 ++++++ mysql-test/extra/rpl_tests/rpl_extra_col_slave.test | 4 ++++ mysql-test/extra/rpl_tests/rpl_loaddata.test | 2 ++ mysql-test/extra/rpl_tests/rpl_row_basic.test | 4 +++- mysql-test/extra/rpl_tests/rpl_row_tabledefs.test | 1 + mysql-test/extra/rpl_tests/rpl_stm_EE_err2.test | 1 + mysql-test/include/mtr_warnings.sql | 1 - mysql-test/suite/binlog/r/binlog_base64_flag.result | 2 ++ mysql-test/suite/binlog/r/binlog_row_binlog.result | 1 + mysql-test/suite/binlog/r/binlog_stm_binlog.result | 1 + mysql-test/suite/binlog/t/binlog_base64_flag.test | 2 ++ mysql-test/suite/rpl/r/rpl_binlog_corruption.result | 1 + .../suite/rpl/r/rpl_binlog_max_cache_size.result | 1 + mysql-test/suite/rpl/r/rpl_bug33931.result | 1 + .../suite/rpl/r/rpl_circular_for_4_hosts.result | 1 + .../suite/rpl/r/rpl_extra_col_master_innodb.result | 12 ++++++++++++ .../suite/rpl/r/rpl_extra_col_master_myisam.result | 12 ++++++++++++ .../suite/rpl/r/rpl_extra_col_slave_innodb.result | 3 +++ .../suite/rpl/r/rpl_extra_col_slave_myisam.result | 3 +++ .../suite/rpl/r/rpl_filter_tables_not_exist.result | 1 + mysql-test/suite/rpl/r/rpl_idempotency.result | 7 ++++--- mysql-test/suite/rpl/r/rpl_ignore_table.result | 1 + mysql-test/suite/rpl/r/rpl_incident.result | 1 + mysql-test/suite/rpl/r/rpl_init_slave_errors.result | 2 +- .../suite/rpl/r/rpl_known_bugs_detection.result | 1 + mysql-test/suite/rpl/r/rpl_loaddata.result | 2 ++ .../suite/rpl/r/rpl_loaddata_concurrent.result | 2 ++ mysql-test/suite/rpl/r/rpl_loaddata_fatal.result | 1 + mysql-test/suite/rpl/r/rpl_rotate_logs.result | 1 + mysql-test/suite/rpl/r/rpl_row_basic_11bugs.result | 1 + mysql-test/suite/rpl/r/rpl_row_basic_2myisam.result | 2 ++ mysql-test/suite/rpl/r/rpl_row_basic_3innodb.result | 2 ++ mysql-test/suite/rpl/r/rpl_row_colSize.result | 1 + mysql-test/suite/rpl/r/rpl_row_conflicts.result | 2 ++ mysql-test/suite/rpl/r/rpl_row_inexist_tbl.result | 1 + .../suite/rpl/r/rpl_row_tabledefs_2myisam.result | 1 + .../suite/rpl/r/rpl_row_tabledefs_3innodb.result | 1 + mysql-test/suite/rpl/r/rpl_skip_error.result | 1 + mysql-test/suite/rpl/r/rpl_slave_grp_exec.result | 1 + .../suite/rpl/r/rpl_slave_load_remove_tmpfile.result | 1 + .../rpl/r/rpl_slave_load_tmpdir_not_exist.result | 1 + mysql-test/suite/rpl/r/rpl_stm_EE_err2.result | 1 + mysql-test/suite/rpl/r/rpl_stm_conflicts.result | 1 + mysql-test/suite/rpl/r/rpl_temporary_errors.result | 1 + mysql-test/suite/rpl/t/rpl_binlog_corruption.test | 2 +- .../suite/rpl/t/rpl_binlog_max_cache_size.test | 1 + mysql-test/suite/rpl/t/rpl_bug33931.test | 1 + mysql-test/suite/rpl/t/rpl_circular_for_4_hosts.test | 1 + .../suite/rpl/t/rpl_filter_tables_not_exist.test | 2 ++ mysql-test/suite/rpl/t/rpl_idempotency.test | 7 ++++--- mysql-test/suite/rpl/t/rpl_ignore_table.test | 1 + mysql-test/suite/rpl/t/rpl_incident.test | 1 + mysql-test/suite/rpl/t/rpl_init_slave_errors.test | 2 +- mysql-test/suite/rpl/t/rpl_known_bugs_detection.test | 1 + mysql-test/suite/rpl/t/rpl_loaddata_fatal.test | 1 + mysql-test/suite/rpl/t/rpl_rotate_logs.test | 1 + mysql-test/suite/rpl/t/rpl_row_basic_11bugs.test | 1 + mysql-test/suite/rpl/t/rpl_row_colSize.test | 3 +++ mysql-test/suite/rpl/t/rpl_row_inexist_tbl.test | 1 + mysql-test/suite/rpl/t/rpl_skip_error.test | 2 ++ mysql-test/suite/rpl/t/rpl_slave_grp_exec.test | 1 + .../suite/rpl/t/rpl_slave_load_remove_tmpfile.test | 1 + .../suite/rpl/t/rpl_slave_load_tmpdir_not_exist.test | 1 + mysql-test/suite/rpl/t/rpl_temporary_errors.test | 3 +++ 66 files changed, 122 insertions(+), 11 deletions(-) diff --git a/mysql-test/extra/binlog_tests/binlog.test b/mysql-test/extra/binlog_tests/binlog.test index fd6ba1c17fa..a776ba5eaf6 100644 --- a/mysql-test/extra/binlog_tests/binlog.test +++ b/mysql-test/extra/binlog_tests/binlog.test @@ -343,6 +343,7 @@ SHOW SESSION VARIABLES LIKE "%_checks"; --echo # INSERT INTO t1 VALUES(2) --echo # foreign_key_checks=1 and unique_checks=1 --echo # It should not change current session's variables, even error happens +call mtr.add_suppression("Slave SQL.*Could not execute Write_rows event on table test.t1; Duplicate entry .2. for key .PRIMARY., Error_code: 1062"); --error 1062 BINLOG ' dfLtTBMBAAAAKQAAAKsBAAAAABcAAAAAAAEABHRlc3QAAnQxAAEDAAE= diff --git a/mysql-test/extra/rpl_tests/rpl_conflicts.test b/mysql-test/extra/rpl_tests/rpl_conflicts.test index 943d254736d..866a31e92b0 100644 --- a/mysql-test/extra/rpl_tests/rpl_conflicts.test +++ b/mysql-test/extra/rpl_tests/rpl_conflicts.test @@ -93,6 +93,7 @@ if (`SELECT @@global.binlog_format != 'ROW' OR @@global.slave_exec_mode = 'STRIC source include/wait_for_slave_sql_error.inc; let $err= query_get_value("SHOW SLAVE STATUS", Last_SQL_Error, 1); --echo Last_SQL_Error = $err (expected "duplicate key" error) + call mtr.add_suppression("Slave SQL.*Duplicate entry .1. for key .PRIMARY.* Error_code: 1062"); SELECT * FROM t1; --echo ---- Resolve the conflict on the slave and restart SQL thread ---- @@ -137,6 +138,7 @@ connection slave; # replication continues. if (`SELECT @@global.binlog_format = 'ROW' AND @@global.slave_exec_mode = 'STRICT'`) { --echo ---- Wait until slave stops with an error ---- + call mtr.add_suppression("Can.t find record in .t1., Error_code: 1032"); let $slave_sql_errno= 1032; # ER_KEY_NOT_FOUND source include/wait_for_slave_sql_error.inc; diff --git a/mysql-test/extra/rpl_tests/rpl_extra_col_master.test b/mysql-test/extra/rpl_tests/rpl_extra_col_master.test index eb50149655e..6dba4202260 100644 --- a/mysql-test/extra/rpl_tests/rpl_extra_col_master.test +++ b/mysql-test/extra/rpl_tests/rpl_extra_col_master.test @@ -121,6 +121,12 @@ SELECT f1,f2,f3,f4,f5,f6,f7,f8,f9, hex(f10),hex(f11) FROM t1 ORDER BY f3 LIMIT 20; #connection slave; + +call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column 2 type mismatch.* 1535"); +call mtr.add_suppression("Slave SQL.*Error .Can.t DROP .c7.; check that column.key exists. on query.* 1091"); +call mtr.add_suppression("Slave SQL.*Error .Unknown column .c7. in .t15.. on query.* 1054"); +call mtr.add_suppression("Slave SQL.*Error .Key column .c6. doesn.t exist in table. on query.* 1072"); + sync_slave_with_master; --echo --echo * Select count and 20 rows from Slave * diff --git a/mysql-test/extra/rpl_tests/rpl_extra_col_slave.test b/mysql-test/extra/rpl_tests/rpl_extra_col_slave.test index 882ef2c4e63..cb2421d5d74 100644 --- a/mysql-test/extra/rpl_tests/rpl_extra_col_slave.test +++ b/mysql-test/extra/rpl_tests/rpl_extra_col_slave.test @@ -766,6 +766,10 @@ RESET MASTER; connection slave; START SLAVE; +call mtr.add_suppression("Slave SQL.*Error .Unknown table .t6.. on query.* Error_code: 1051"); +call mtr.add_suppression("Slave SQL.*Error .Duplicate column name .c6.. on query.* Error_code: 1060"); +call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column . ...e mismatch.* Error_code: 1535"); + --echo *** Master Data Insert *** connection master; set @b1 = 'b1b1b1b1'; diff --git a/mysql-test/extra/rpl_tests/rpl_loaddata.test b/mysql-test/extra/rpl_tests/rpl_loaddata.test index 4a21123e8a1..ae04c1b4aaa 100644 --- a/mysql-test/extra/rpl_tests/rpl_loaddata.test +++ b/mysql-test/extra/rpl_tests/rpl_loaddata.test @@ -63,6 +63,8 @@ eval $lower_stmt_head infile '../../std_data/rpl_loaddata.dat' into table t1; save_master_pos; connection slave; # 1062 = ER_DUP_ENTRY +call mtr.add_suppression("Slave SQL.*Error .Duplicate entry .10. for key .b.. on query.* Error_code: 1062"); +call mtr.add_suppression("Slave SQL.*Query caused different errors on master and slave.*Error on master:.*error code=1062.*Error on slave:.*Error_code: 0"); --let $slave_sql_errno= 1062 --source include/wait_for_slave_sql_error_and_skip.inc diff --git a/mysql-test/extra/rpl_tests/rpl_row_basic.test b/mysql-test/extra/rpl_tests/rpl_row_basic.test index c8de853a297..70b4edceb27 100644 --- a/mysql-test/extra/rpl_tests/rpl_row_basic.test +++ b/mysql-test/extra/rpl_tests/rpl_row_basic.test @@ -371,7 +371,9 @@ INSERT INTO t3 VALUES (1, "", 1); INSERT INTO t3 VALUES (2, repeat(_utf8'a', 128), 2); connection slave; -# 1535 = ER_BINLOG_ROW_WRONG_TABLE_DEF +# 1535 = ER_BINLOG_ROW_WRONG_TABLE_DEF +call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column 1 size mismatch.* Error_code: 1535"); +call mtr.add_suppression("Slave SQL.*Could not execute Delete_rows event on table test.t1.* Error_code: 1032"); --let $slave_sql_errno= 1535 --let $show_slave_sql_error= 1 --source include/wait_for_slave_sql_error.inc diff --git a/mysql-test/extra/rpl_tests/rpl_row_tabledefs.test b/mysql-test/extra/rpl_tests/rpl_row_tabledefs.test index ee6205c79d8..4e15a5a98ff 100644 --- a/mysql-test/extra/rpl_tests/rpl_row_tabledefs.test +++ b/mysql-test/extra/rpl_tests/rpl_row_tabledefs.test @@ -147,6 +147,7 @@ sync_slave_with_master; connection master; INSERT INTO t4 VALUES (4); connection slave; +call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column [012] type mismatch.* Error_code: 1535"); --let $slave_skip_counter= 2 --let $slave_sql_errno= 1535 --let $show_slave_sql_error= 1 diff --git a/mysql-test/extra/rpl_tests/rpl_stm_EE_err2.test b/mysql-test/extra/rpl_tests/rpl_stm_EE_err2.test index d4140785878..cc69c08fe7c 100644 --- a/mysql-test/extra/rpl_tests/rpl_stm_EE_err2.test +++ b/mysql-test/extra/rpl_tests/rpl_stm_EE_err2.test @@ -25,6 +25,7 @@ drop table t1; connection slave; --source include/wait_for_slave_sql_to_stop.inc +call mtr.add_suppression("Slave SQL.*Query caused different errors on master and slave.*Error on master:.* error code=1062.*Error on slave:.* Error_code: 0"); let $error= query_get_value(SHOW SLAVE STATUS, Last_SQL_Error, 1); let $errno= query_get_value(SHOW SLAVE STATUS, Last_SQL_Errno, 1); --echo Error: "$error" (expected different error codes on master and slave) diff --git a/mysql-test/include/mtr_warnings.sql b/mysql-test/include/mtr_warnings.sql index 9dc64952979..30919dd10dc 100644 --- a/mysql-test/include/mtr_warnings.sql +++ b/mysql-test/include/mtr_warnings.sql @@ -107,7 +107,6 @@ INSERT INTO global_suppressions VALUES ("Slave: The incident LOST_EVENTS occured on the master"), ("Slave: Unknown error.* 1105"), ("Slave: Can't drop database.* database doesn't exist"), - ("Slave SQL:.*(Error_code: \[\[:digit:\]\]+|Query:.*)"), ("Sort aborted"), ("Time-out in NDB"), ("Warning:\s+One can only use the --user.*root"), diff --git a/mysql-test/suite/binlog/r/binlog_base64_flag.result b/mysql-test/suite/binlog/r/binlog_base64_flag.result index 7fb5e50a219..a4c610c845a 100644 --- a/mysql-test/suite/binlog/r/binlog_base64_flag.result +++ b/mysql-test/suite/binlog/r/binlog_base64_flag.result @@ -91,6 +91,8 @@ iONkSBcBAAAAKwAAAMQBAAAQABAAAAAAAAEAA//4AQAAAAMAMTIzAQAAAA== '; ERROR HY000: master may suffer from http://bugs.mysql.com/bug.php?id=37426 so slave stops; check error log on slave for more info drop table t1, char63_utf8, char128_utf8; +call mtr.add_suppression("Slave SQL.*master suffers from this bug: http:..bugs.mysql.com.bug.php.id=37426.* Error_code: 1105"); +call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column 1 size mismatch.* Error_code: 1535"); # # Bug #54393: crash and/or valgrind errors in # mysql_client_binlog_statement diff --git a/mysql-test/suite/binlog/r/binlog_row_binlog.result b/mysql-test/suite/binlog/r/binlog_row_binlog.result index 1678f8add58..e726d236323 100644 --- a/mysql-test/suite/binlog/r/binlog_row_binlog.result +++ b/mysql-test/suite/binlog/r/binlog_row_binlog.result @@ -1374,6 +1374,7 @@ unique_checks OFF # INSERT INTO t1 VALUES(2) # foreign_key_checks=1 and unique_checks=1 # It should not change current session's variables, even error happens +call mtr.add_suppression("Slave SQL.*Could not execute Write_rows event on table test.t1; Duplicate entry .2. for key .PRIMARY., Error_code: 1062"); BINLOG ' dfLtTBMBAAAAKQAAAKsBAAAAABcAAAAAAAEABHRlc3QAAnQxAAEDAAE= dfLtTBcBAAAAIgAAAM0BAAAAABcAAAAAAAEAAf/+AgAAAA== diff --git a/mysql-test/suite/binlog/r/binlog_stm_binlog.result b/mysql-test/suite/binlog/r/binlog_stm_binlog.result index 872a93bef43..5a06bb72b90 100644 --- a/mysql-test/suite/binlog/r/binlog_stm_binlog.result +++ b/mysql-test/suite/binlog/r/binlog_stm_binlog.result @@ -845,6 +845,7 @@ unique_checks OFF # INSERT INTO t1 VALUES(2) # foreign_key_checks=1 and unique_checks=1 # It should not change current session's variables, even error happens +call mtr.add_suppression("Slave SQL.*Could not execute Write_rows event on table test.t1; Duplicate entry .2. for key .PRIMARY., Error_code: 1062"); BINLOG ' dfLtTBMBAAAAKQAAAKsBAAAAABcAAAAAAAEABHRlc3QAAnQxAAEDAAE= dfLtTBcBAAAAIgAAAM0BAAAAABcAAAAAAAEAAf/+AgAAAA== diff --git a/mysql-test/suite/binlog/t/binlog_base64_flag.test b/mysql-test/suite/binlog/t/binlog_base64_flag.test index 3f1e4e98bec..296c4bf05aa 100644 --- a/mysql-test/suite/binlog/t/binlog_base64_flag.test +++ b/mysql-test/suite/binlog/t/binlog_base64_flag.test @@ -151,6 +151,8 @@ iONkSBcBAAAAKwAAAMQBAAAQABAAAAAAAAEAA//4AQAAAAMAMTIzAQAAAA== drop table t1, char63_utf8, char128_utf8; +call mtr.add_suppression("Slave SQL.*master suffers from this bug: http:..bugs.mysql.com.bug.php.id=37426.* Error_code: 1105"); +call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column 1 size mismatch.* Error_code: 1535"); --echo # --echo # Bug #54393: crash and/or valgrind errors in diff --git a/mysql-test/suite/rpl/r/rpl_binlog_corruption.result b/mysql-test/suite/rpl/r/rpl_binlog_corruption.result index 4f1eca42e1a..a2a065e0a4f 100644 --- a/mysql-test/suite/rpl/r/rpl_binlog_corruption.result +++ b/mysql-test/suite/rpl/r/rpl_binlog_corruption.result @@ -1,6 +1,7 @@ include/master-slave.inc [connection master] call mtr.add_suppression('Found invalid event in binary log'); +call mtr.add_suppression('Slave SQL.*Relay log read failure: Could not parse relay log event entry.* 1594'); ==== Initialize ==== include/stop_slave.inc RESET SLAVE; diff --git a/mysql-test/suite/rpl/r/rpl_binlog_max_cache_size.result b/mysql-test/suite/rpl/r/rpl_binlog_max_cache_size.result index a7e8b86ac79..2d5676a82d6 100644 --- a/mysql-test/suite/rpl/r/rpl_binlog_max_cache_size.result +++ b/mysql-test/suite/rpl/r/rpl_binlog_max_cache_size.result @@ -125,6 +125,7 @@ include/stop_slave.inc include/start_slave.inc CALL mtr.add_suppression("Multi-statement transaction required more than 'max_binlog_cache_size' bytes of storage.*"); CALL mtr.add_suppression("Writing one row to the row-based binary log failed.*"); +CALL mtr.add_suppression("Slave SQL.*The incident LOST_EVENTS occured on the master. Message: error writing to the binary log"); TRUNCATE t1; SET GLOBAL max_binlog_cache_size= ORIGINAL_VALUE; SET GLOBAL binlog_cache_size= ORIGINAL_VALUE; diff --git a/mysql-test/suite/rpl/r/rpl_bug33931.result b/mysql-test/suite/rpl/r/rpl_bug33931.result index d27308db1d5..ce8b6b169c7 100644 --- a/mysql-test/suite/rpl/r/rpl_bug33931.result +++ b/mysql-test/suite/rpl/r/rpl_bug33931.result @@ -1,6 +1,7 @@ include/master-slave.inc [connection master] call mtr.add_suppression("Failed during slave I/O thread initialization"); +call mtr.add_suppression("Slave SQL.*Failed during slave thread initialization.* 1593"); include/stop_slave.inc reset slave; SET GLOBAL debug="d,simulate_io_slave_error_on_init,simulate_sql_slave_error_on_init"; diff --git a/mysql-test/suite/rpl/r/rpl_circular_for_4_hosts.result b/mysql-test/suite/rpl/r/rpl_circular_for_4_hosts.result index 6981e549918..412021d6446 100644 --- a/mysql-test/suite/rpl/r/rpl_circular_for_4_hosts.result +++ b/mysql-test/suite/rpl/r/rpl_circular_for_4_hosts.result @@ -46,6 +46,7 @@ SET GLOBAL SQL_SLAVE_SKIP_COUNTER = 1; include/start_slave.inc INSERT INTO t1 VALUES(6,'C',2); INSERT INTO t1(b,c) VALUES('B',2); +call mtr.add_suppression("Slave SQL.*Duplicate entry .6. for key .PRIMARY.* Error_code: 1062"); include/wait_for_slave_sql_error.inc [errno=1062] INSERT INTO t1(b,c) VALUES('A',2); INSERT INTO t1(b,c) VALUES('D',2); diff --git a/mysql-test/suite/rpl/r/rpl_extra_col_master_innodb.result b/mysql-test/suite/rpl/r/rpl_extra_col_master_innodb.result index affb179d50e..f235c68cc95 100644 --- a/mysql-test/suite/rpl/r/rpl_extra_col_master_innodb.result +++ b/mysql-test/suite/rpl/r/rpl_extra_col_master_innodb.result @@ -58,6 +58,10 @@ f1 f2 f3 f4 f5 f6 f7 f8 f9 hex(f10) hex(f11) 27 27 27 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 29 29 29 second 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 30 30 30 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 +call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column 2 type mismatch.* 1535"); +call mtr.add_suppression("Slave SQL.*Error .Can.t DROP .c7.; check that column.key exists. on query.* 1091"); +call mtr.add_suppression("Slave SQL.*Error .Unknown column .c7. in .t15.. on query.* 1054"); +call mtr.add_suppression("Slave SQL.*Error .Key column .c6. doesn.t exist in table. on query.* 1072"); * Select count and 20 rows from Slave * @@ -929,6 +933,10 @@ f1 f2 f3 f4 f5 f6 f7 f8 f9 hex(f10) hex(f11) 27 27 27 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 29 29 29 second 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 30 30 30 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 +call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column 2 type mismatch.* 1535"); +call mtr.add_suppression("Slave SQL.*Error .Can.t DROP .c7.; check that column.key exists. on query.* 1091"); +call mtr.add_suppression("Slave SQL.*Error .Unknown column .c7. in .t15.. on query.* 1054"); +call mtr.add_suppression("Slave SQL.*Error .Key column .c6. doesn.t exist in table. on query.* 1072"); * Select count and 20 rows from Slave * @@ -1800,6 +1808,10 @@ f1 f2 f3 f4 f5 f6 f7 f8 f9 hex(f10) hex(f11) 27 27 27 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 29 29 29 second 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 30 30 30 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 +call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column 2 type mismatch.* 1535"); +call mtr.add_suppression("Slave SQL.*Error .Can.t DROP .c7.; check that column.key exists. on query.* 1091"); +call mtr.add_suppression("Slave SQL.*Error .Unknown column .c7. in .t15.. on query.* 1054"); +call mtr.add_suppression("Slave SQL.*Error .Key column .c6. doesn.t exist in table. on query.* 1072"); * Select count and 20 rows from Slave * diff --git a/mysql-test/suite/rpl/r/rpl_extra_col_master_myisam.result b/mysql-test/suite/rpl/r/rpl_extra_col_master_myisam.result index 8aeb5bdc1c9..52f4a7a8453 100644 --- a/mysql-test/suite/rpl/r/rpl_extra_col_master_myisam.result +++ b/mysql-test/suite/rpl/r/rpl_extra_col_master_myisam.result @@ -58,6 +58,10 @@ f1 f2 f3 f4 f5 f6 f7 f8 f9 hex(f10) hex(f11) 27 27 27 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 29 29 29 second 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 30 30 30 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 +call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column 2 type mismatch.* 1535"); +call mtr.add_suppression("Slave SQL.*Error .Can.t DROP .c7.; check that column.key exists. on query.* 1091"); +call mtr.add_suppression("Slave SQL.*Error .Unknown column .c7. in .t15.. on query.* 1054"); +call mtr.add_suppression("Slave SQL.*Error .Key column .c6. doesn.t exist in table. on query.* 1072"); * Select count and 20 rows from Slave * @@ -929,6 +933,10 @@ f1 f2 f3 f4 f5 f6 f7 f8 f9 hex(f10) hex(f11) 27 27 27 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 29 29 29 second 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 30 30 30 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 +call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column 2 type mismatch.* 1535"); +call mtr.add_suppression("Slave SQL.*Error .Can.t DROP .c7.; check that column.key exists. on query.* 1091"); +call mtr.add_suppression("Slave SQL.*Error .Unknown column .c7. in .t15.. on query.* 1054"); +call mtr.add_suppression("Slave SQL.*Error .Key column .c6. doesn.t exist in table. on query.* 1072"); * Select count and 20 rows from Slave * @@ -1800,6 +1808,10 @@ f1 f2 f3 f4 f5 f6 f7 f8 f9 hex(f10) hex(f11) 27 27 27 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 29 29 29 second 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 30 30 30 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 +call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column 2 type mismatch.* 1535"); +call mtr.add_suppression("Slave SQL.*Error .Can.t DROP .c7.; check that column.key exists. on query.* 1091"); +call mtr.add_suppression("Slave SQL.*Error .Unknown column .c7. in .t15.. on query.* 1054"); +call mtr.add_suppression("Slave SQL.*Error .Key column .c6. doesn.t exist in table. on query.* 1072"); * Select count and 20 rows from Slave * diff --git a/mysql-test/suite/rpl/r/rpl_extra_col_slave_innodb.result b/mysql-test/suite/rpl/r/rpl_extra_col_slave_innodb.result index 9ea319379c0..e71f408ae85 100644 --- a/mysql-test/suite/rpl/r/rpl_extra_col_slave_innodb.result +++ b/mysql-test/suite/rpl/r/rpl_extra_col_slave_innodb.result @@ -460,6 +460,9 @@ c4 BLOB, c5 CHAR(5)) ENGINE='InnoDB'; RESET MASTER; *** Start Slave *** START SLAVE; +call mtr.add_suppression("Slave SQL.*Error .Unknown table .t6.. on query.* Error_code: 1051"); +call mtr.add_suppression("Slave SQL.*Error .Duplicate column name .c6.. on query.* Error_code: 1060"); +call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column . ...e mismatch.* Error_code: 1535"); *** Master Data Insert *** set @b1 = 'b1b1b1b1'; set @b1 = concat(@b1,@b1); diff --git a/mysql-test/suite/rpl/r/rpl_extra_col_slave_myisam.result b/mysql-test/suite/rpl/r/rpl_extra_col_slave_myisam.result index 716a35b3464..51ca555b545 100644 --- a/mysql-test/suite/rpl/r/rpl_extra_col_slave_myisam.result +++ b/mysql-test/suite/rpl/r/rpl_extra_col_slave_myisam.result @@ -460,6 +460,9 @@ c4 BLOB, c5 CHAR(5)) ENGINE='MyISAM'; RESET MASTER; *** Start Slave *** START SLAVE; +call mtr.add_suppression("Slave SQL.*Error .Unknown table .t6.. on query.* Error_code: 1051"); +call mtr.add_suppression("Slave SQL.*Error .Duplicate column name .c6.. on query.* Error_code: 1060"); +call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column . ...e mismatch.* Error_code: 1535"); *** Master Data Insert *** set @b1 = 'b1b1b1b1'; set @b1 = concat(@b1,@b1); diff --git a/mysql-test/suite/rpl/r/rpl_filter_tables_not_exist.result b/mysql-test/suite/rpl/r/rpl_filter_tables_not_exist.result index 4eaf61e5f9e..c88dcee9dbc 100644 --- a/mysql-test/suite/rpl/r/rpl_filter_tables_not_exist.result +++ b/mysql-test/suite/rpl/r/rpl_filter_tables_not_exist.result @@ -42,6 +42,7 @@ UPDATE t4 LEFT JOIN (t1, t2, t5) ON (t1.id=t4.id and t2.id=t4.id and t5.id=t4.id UPDATE t4 LEFT JOIN (t1, t6, t7) ON (t4.id=t1.id and t4.id=t6.id and t4.id=t7.id) SET a=0, d=0, f=0, g=0 where t4.id=1; UPDATE t7 LEFT JOIN (t4, t1, t2) ON (t7.id=t4.id and t7.id=t1.id and t7.id=t2.id) SET a=0, b=0, d=0, g=0 where t7.id=1; UPDATE t7 LEFT JOIN (t8, t4, t1) ON (t7.id=t8.id and t7.id=t4.id and t7.id=t1.id) SET a=0, d=0, g=0, h=0 where t7.id=1; +call mtr.add_suppression("Slave SQL.*Error .Table .test.t[47]. doesn.t exist. on query.* Error_code: 1146"); UPDATE t1 LEFT JOIN t4 ON (t1.id=t4.id) SET a=0 where t1.id=1; include/wait_for_slave_sql_error_and_skip.inc [errno=1146] Last_SQL_Error = 'Error 'Table 'test.t4' doesn't exist' on query. Default database: 'test'. Query: 'UPDATE t1 LEFT JOIN t4 ON (t1.id=t4.id) SET a=0 where t1.id=1'' diff --git a/mysql-test/suite/rpl/r/rpl_idempotency.result b/mysql-test/suite/rpl/r/rpl_idempotency.result index 1ae2d0b9ee5..8ccef65a192 100644 --- a/mysql-test/suite/rpl/r/rpl_idempotency.result +++ b/mysql-test/suite/rpl/r/rpl_idempotency.result @@ -1,8 +1,9 @@ include/master-slave.inc [connection master] -call mtr.add_suppression("Slave: Can't find record in 't.' Error_code: 1032"); -call mtr.add_suppression("Slave: Cannot delete or update a parent row: a foreign key constraint fails .* Error_code: 1451"); -call mtr.add_suppression("Slave: Cannot add or update a child row: a foreign key constraint fails .* Error_code: 1452"); +call mtr.add_suppression("Can.t find record in .t[12].* Error_code: 1032"); +call mtr.add_suppression("Cannot delete or update a parent row: a foreign key constraint fails .* Error_code: 1451"); +call mtr.add_suppression("Cannot add or update a child row: a foreign key constraint fails .* Error_code: 1452"); +call mtr.add_suppression("Slave SQL.*Could not execute Write_rows event on table test.* Duplicate entry .1. for key .PRIMARY.* Error_code: 1062"); SET @old_slave_exec_mode= @@global.slave_exec_mode; CREATE TABLE t1 (a INT PRIMARY KEY); CREATE TABLE t2 (a INT); diff --git a/mysql-test/suite/rpl/r/rpl_ignore_table.result b/mysql-test/suite/rpl/r/rpl_ignore_table.result index 2e3fd62fbec..b92f97e24ee 100644 --- a/mysql-test/suite/rpl/r/rpl_ignore_table.result +++ b/mysql-test/suite/rpl/r/rpl_ignore_table.result @@ -112,6 +112,7 @@ show grants for mysqltest4@localhost; Grants for mysqltest4@localhost GRANT USAGE ON *.* TO 'mysqltest4'@'localhost' IDENTIFIED BY PASSWORD '*196BDEDE2AE4F84CA44C47D54D78478C7E2BD7B7' set global slave_exec_mode='IDEMPOTENT'; +call mtr.add_suppression("Slave SQL.*Could not execute Delete_rows event on table mysql.* Error_code: 1032"); drop table t1, mysqltest2.t2; drop table t4; drop database mysqltest2; diff --git a/mysql-test/suite/rpl/r/rpl_incident.result b/mysql-test/suite/rpl/r/rpl_incident.result index b54d7d400f7..d528fb3297a 100644 --- a/mysql-test/suite/rpl/r/rpl_incident.result +++ b/mysql-test/suite/rpl/r/rpl_incident.result @@ -15,6 +15,7 @@ a 2 3 4 +call mtr.add_suppression("Slave SQL.*The incident LOST_EVENTS occured on the master.* 1590"); include/wait_for_slave_sql_error.inc [errno=1590] Last_SQL_Error = 'The incident LOST_EVENTS occured on the master. Message: ' **** On Slave **** diff --git a/mysql-test/suite/rpl/r/rpl_init_slave_errors.result b/mysql-test/suite/rpl/r/rpl_init_slave_errors.result index 46bc66cbb65..a185afc5af2 100644 --- a/mysql-test/suite/rpl/r/rpl_init_slave_errors.result +++ b/mysql-test/suite/rpl/r/rpl_init_slave_errors.result @@ -6,7 +6,7 @@ SET GLOBAL debug= "d,simulate_io_slave_error_on_init,simulate_sql_slave_error_on start slave; include/wait_for_slave_sql_error.inc [errno=1593] Last_SQL_Error = 'Failed during slave thread initialization' -call mtr.add_suppression("Failed during slave I/O thread initialization"); +call mtr.add_suppression("Failed during slave.* thread initialization"); SET GLOBAL debug= ""; reset slave; SET GLOBAL init_slave= "garbage"; diff --git a/mysql-test/suite/rpl/r/rpl_known_bugs_detection.result b/mysql-test/suite/rpl/r/rpl_known_bugs_detection.result index 52980e81523..972e877bf18 100644 --- a/mysql-test/suite/rpl/r/rpl_known_bugs_detection.result +++ b/mysql-test/suite/rpl/r/rpl_known_bugs_detection.result @@ -7,6 +7,7 @@ SELECT * FROM t1; a b 1 10 2 2 +call mtr.add_suppression("Slave SQL.*suffer.*http:..bugs.mysql.com.bug.php.id=24432"); include/wait_for_slave_sql_error.inc [errno=1105] Last_SQL_Error = 'Error 'master may suffer from http://bugs.mysql.com/bug.php?id=24432 so slave stops; check error log on slave for more info' on query. Default database: 'test'. Query: 'INSERT INTO t1(b) VALUES(1),(1),(2) ON DUPLICATE KEY UPDATE t1.b=10'' SELECT * FROM t1; diff --git a/mysql-test/suite/rpl/r/rpl_loaddata.result b/mysql-test/suite/rpl/r/rpl_loaddata.result index bd8bc5093aa..c4bcb692133 100644 --- a/mysql-test/suite/rpl/r/rpl_loaddata.result +++ b/mysql-test/suite/rpl/r/rpl_loaddata.result @@ -27,6 +27,8 @@ drop table t3; create table t1(a int, b int, unique(b)); insert into t1 values(1,10); load data infile '../../std_data/rpl_loaddata.dat' into table t1; +call mtr.add_suppression("Slave SQL.*Error .Duplicate entry .10. for key .b.. on query.* Error_code: 1062"); +call mtr.add_suppression("Slave SQL.*Query caused different errors on master and slave.*Error on master:.*error code=1062.*Error on slave:.*Error_code: 0"); include/wait_for_slave_sql_error_and_skip.inc [errno=1062] include/check_slave_no_error.inc set sql_log_bin=0; diff --git a/mysql-test/suite/rpl/r/rpl_loaddata_concurrent.result b/mysql-test/suite/rpl/r/rpl_loaddata_concurrent.result index bc40f32842d..d1c7bf65624 100644 --- a/mysql-test/suite/rpl/r/rpl_loaddata_concurrent.result +++ b/mysql-test/suite/rpl/r/rpl_loaddata_concurrent.result @@ -38,6 +38,8 @@ drop table t3; create table t1(a int, b int, unique(b)); insert into t1 values(1,10); load data CONCURRENT infile '../../std_data/rpl_loaddata.dat' into table t1; +call mtr.add_suppression("Slave SQL.*Error .Duplicate entry .10. for key .b.. on query.* Error_code: 1062"); +call mtr.add_suppression("Slave SQL.*Query caused different errors on master and slave.*Error on master:.*error code=1062.*Error on slave:.*Error_code: 0"); include/wait_for_slave_sql_error_and_skip.inc [errno=1062] include/check_slave_no_error.inc set sql_log_bin=0; diff --git a/mysql-test/suite/rpl/r/rpl_loaddata_fatal.result b/mysql-test/suite/rpl/r/rpl_loaddata_fatal.result index a81813de19f..b13e2ced183 100644 --- a/mysql-test/suite/rpl/r/rpl_loaddata_fatal.result +++ b/mysql-test/suite/rpl/r/rpl_loaddata_fatal.result @@ -3,6 +3,7 @@ include/master-slave.inc CREATE TABLE t1 (a INT, b INT); INSERT INTO t1 VALUES (1,10); LOAD DATA INFILE '../../std_data/rpl_loaddata.dat' INTO TABLE t1; +call mtr.add_suppression("Slave SQL.*Fatal error: Not enough memory, Error_code: 1593"); include/wait_for_slave_sql_error_and_skip.inc [errno=1593] Last_SQL_Error = 'Fatal error: Not enough memory' DROP TABLE t1; diff --git a/mysql-test/suite/rpl/r/rpl_rotate_logs.result b/mysql-test/suite/rpl/r/rpl_rotate_logs.result index e41f56c0a71..1166b0d18a9 100644 --- a/mysql-test/suite/rpl/r/rpl_rotate_logs.result +++ b/mysql-test/suite/rpl/r/rpl_rotate_logs.result @@ -36,6 +36,7 @@ drop table temp_table, t3; insert into t2 values(1234); set insert_id=1234; insert into t2 values(NULL); +call mtr.add_suppression("Slave SQL.*Error .Duplicate entry .1234. for key .PRIMARY.. on query.* Error_code: 1062"); include/wait_for_slave_sql_error_and_skip.inc [errno=1062] purge master logs to 'master-bin.000002'; show master logs; diff --git a/mysql-test/suite/rpl/r/rpl_row_basic_11bugs.result b/mysql-test/suite/rpl/r/rpl_row_basic_11bugs.result index d769b0b0881..0f2db9cbf1d 100644 --- a/mysql-test/suite/rpl/r/rpl_row_basic_11bugs.result +++ b/mysql-test/suite/rpl/r/rpl_row_basic_11bugs.result @@ -63,6 +63,7 @@ DROP TABLE t1; include/rpl_reset.inc **** On Slave **** SET GLOBAL QUERY_CACHE_SIZE=0; +call mtr.add_suppression("Slave SQL.*Could not execute Update_rows event on table test.t1.* Error_code: 1032"); **** On Master **** CREATE TABLE t1 (a INT); INSERT INTO t1 VALUES (1),(2),(3); diff --git a/mysql-test/suite/rpl/r/rpl_row_basic_2myisam.result b/mysql-test/suite/rpl/r/rpl_row_basic_2myisam.result index 7afc70bfa5c..4f051d19e4b 100644 --- a/mysql-test/suite/rpl/r/rpl_row_basic_2myisam.result +++ b/mysql-test/suite/rpl/r/rpl_row_basic_2myisam.result @@ -478,6 +478,8 @@ include/diff_tables.inc [master:t2, slave:t2] [expecting slave to stop] INSERT INTO t3 VALUES (1, "", 1); INSERT INTO t3 VALUES (2, repeat(_utf8'a', 128), 2); +call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column 1 size mismatch.* Error_code: 1535"); +call mtr.add_suppression("Slave SQL.*Could not execute Delete_rows event on table test.t1.* Error_code: 1032"); include/wait_for_slave_sql_error.inc [errno=1535] Last_SQL_Error = 'Table definition on master and slave does not match: Column 1 size mismatch - master has size 384, test.t3 on slave has size 49. Master's column size should be <= the slave's column size.' include/rpl_reset.inc diff --git a/mysql-test/suite/rpl/r/rpl_row_basic_3innodb.result b/mysql-test/suite/rpl/r/rpl_row_basic_3innodb.result index b8620894bd1..1ae1cd84579 100644 --- a/mysql-test/suite/rpl/r/rpl_row_basic_3innodb.result +++ b/mysql-test/suite/rpl/r/rpl_row_basic_3innodb.result @@ -478,6 +478,8 @@ include/diff_tables.inc [master:t2, slave:t2] [expecting slave to stop] INSERT INTO t3 VALUES (1, "", 1); INSERT INTO t3 VALUES (2, repeat(_utf8'a', 128), 2); +call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column 1 size mismatch.* Error_code: 1535"); +call mtr.add_suppression("Slave SQL.*Could not execute Delete_rows event on table test.t1.* Error_code: 1032"); include/wait_for_slave_sql_error.inc [errno=1535] Last_SQL_Error = 'Table definition on master and slave does not match: Column 1 size mismatch - master has size 384, test.t3 on slave has size 49. Master's column size should be <= the slave's column size.' include/rpl_reset.inc diff --git a/mysql-test/suite/rpl/r/rpl_row_colSize.result b/mysql-test/suite/rpl/r/rpl_row_colSize.result index 49753d2b25c..d31f6d1c54e 100644 --- a/mysql-test/suite/rpl/r/rpl_row_colSize.result +++ b/mysql-test/suite/rpl/r/rpl_row_colSize.result @@ -265,6 +265,7 @@ STOP SLAVE; RESET SLAVE; RESET MASTER; START SLAVE; +call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column 0 ...e mismatch.* Error_code: 1535"); *** Cleanup *** DROP TABLE IF EXISTS t1; include/rpl_end.inc diff --git a/mysql-test/suite/rpl/r/rpl_row_conflicts.result b/mysql-test/suite/rpl/r/rpl_row_conflicts.result index d8fbab98191..25bc9cfe5b3 100644 --- a/mysql-test/suite/rpl/r/rpl_row_conflicts.result +++ b/mysql-test/suite/rpl/r/rpl_row_conflicts.result @@ -22,6 +22,7 @@ a ---- Wait until slave stops with an error ---- include/wait_for_slave_sql_error.inc [errno=1062] Last_SQL_Error = Could not execute Write_rows event on table test.t1; Duplicate entry '1' for key 'PRIMARY', Error_code: 1062; handler error HA_ERR_FOUND_DUPP_KEY; the event's master log master-bin.000001, end_log_pos 346 (expected "duplicate key" error) +call mtr.add_suppression("Slave SQL.*Duplicate entry .1. for key .PRIMARY.* Error_code: 1062"); SELECT * FROM t1; a 1 @@ -48,6 +49,7 @@ SELECT * FROM t1; a [on slave] ---- Wait until slave stops with an error ---- +call mtr.add_suppression("Can.t find record in .t1., Error_code: 1032"); include/wait_for_slave_sql_error.inc [errno=1032] Last_SQL_Error (expected "duplicate key" error) Could not execute Delete_rows event on table test.t1; Can't find record in 't1', Error_code: 1032; handler error HA_ERR_KEY_NOT_FOUND; the event's master log master-bin.000001, end_log_pos END_LOG_POS diff --git a/mysql-test/suite/rpl/r/rpl_row_inexist_tbl.result b/mysql-test/suite/rpl/r/rpl_row_inexist_tbl.result index 148840cc8c5..20fbcbb7763 100644 --- a/mysql-test/suite/rpl/r/rpl_row_inexist_tbl.result +++ b/mysql-test/suite/rpl/r/rpl_row_inexist_tbl.result @@ -10,6 +10,7 @@ DROP TABLE t1; INSERT INTO t1 VALUES (1); ==== Verify error on slave ==== [on slave] +call mtr.add_suppression("Slave SQL.*Error .Table .test.t1. doesn.t exist. on opening tables, Error_code: 1146"); include/wait_for_slave_sql_error.inc [errno=1146] ==== Clean up ==== include/stop_slave_io.inc diff --git a/mysql-test/suite/rpl/r/rpl_row_tabledefs_2myisam.result b/mysql-test/suite/rpl/r/rpl_row_tabledefs_2myisam.result index 5a29acfda1d..593aaa7ae51 100644 --- a/mysql-test/suite/rpl/r/rpl_row_tabledefs_2myisam.result +++ b/mysql-test/suite/rpl/r/rpl_row_tabledefs_2myisam.result @@ -117,6 +117,7 @@ a include/check_slave_is_running.inc INSERT INTO t9 VALUES (4); INSERT INTO t4 VALUES (4); +call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column [012] type mismatch.* Error_code: 1535"); include/wait_for_slave_sql_error_and_skip.inc [errno=1535] Last_SQL_Error = 'Table definition on master and slave does not match: Column 0 type mismatch - received type 3, test.t4 has type 4' INSERT INTO t9 VALUES (5); diff --git a/mysql-test/suite/rpl/r/rpl_row_tabledefs_3innodb.result b/mysql-test/suite/rpl/r/rpl_row_tabledefs_3innodb.result index f6620ecf05f..e89118ac0a7 100644 --- a/mysql-test/suite/rpl/r/rpl_row_tabledefs_3innodb.result +++ b/mysql-test/suite/rpl/r/rpl_row_tabledefs_3innodb.result @@ -117,6 +117,7 @@ a include/check_slave_is_running.inc INSERT INTO t9 VALUES (4); INSERT INTO t4 VALUES (4); +call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column [012] type mismatch.* Error_code: 1535"); include/wait_for_slave_sql_error_and_skip.inc [errno=1535] Last_SQL_Error = 'Table definition on master and slave does not match: Column 0 type mismatch - received type 3, test.t4 has type 4' INSERT INTO t9 VALUES (5); diff --git a/mysql-test/suite/rpl/r/rpl_skip_error.result b/mysql-test/suite/rpl/r/rpl_skip_error.result index d46338fd5b0..f5675b5e25f 100644 --- a/mysql-test/suite/rpl/r/rpl_skip_error.result +++ b/mysql-test/suite/rpl/r/rpl_skip_error.result @@ -56,6 +56,7 @@ t1 CREATE TABLE `t1` ( PRIMARY KEY (`id`) ) ENGINE=InnoDB DEFAULT CHARSET=latin1 SET SQL_LOG_BIN=1; +call mtr.add_suppression("Slave SQL.*Could not execute .*te_rows event on table test.t.; Duplicate entry.* Error_code: 1062"); CREATE TABLE t1(id INT NOT NULL PRIMARY KEY, data INT) Engine=InnoDB; SHOW CREATE TABLE t1; Table Create Table diff --git a/mysql-test/suite/rpl/r/rpl_slave_grp_exec.result b/mysql-test/suite/rpl/r/rpl_slave_grp_exec.result index 25deb65fa0f..a90c3c7b68f 100644 --- a/mysql-test/suite/rpl/r/rpl_slave_grp_exec.result +++ b/mysql-test/suite/rpl/r/rpl_slave_grp_exec.result @@ -29,6 +29,7 @@ a b SELECT * FROM t3 ORDER BY a; a b 1 ZZ +call mtr.add_suppression("Slave SQL.*Error .Table .test.t3. doesn.t exist. on.* Error_code: 1146"); include/wait_for_slave_sql_error.inc [errno=1146] SHOW TABLES LIKE 't%'; Tables_in_test (t%) diff --git a/mysql-test/suite/rpl/r/rpl_slave_load_remove_tmpfile.result b/mysql-test/suite/rpl/r/rpl_slave_load_remove_tmpfile.result index 213ab06f0c1..425611e2175 100644 --- a/mysql-test/suite/rpl/r/rpl_slave_load_remove_tmpfile.result +++ b/mysql-test/suite/rpl/r/rpl_slave_load_remove_tmpfile.result @@ -13,4 +13,5 @@ include/stop_slave_io.inc RESET SLAVE; drop table t1; call mtr.add_suppression("Slave: Error writing file 'UNKNOWN' .Errcode: 9. Error_code: 3"); +call mtr.add_suppression("Slave SQL.*Error in Begin_load_query event: write to.* failed, Error_code: 9"); include/rpl_end.inc diff --git a/mysql-test/suite/rpl/r/rpl_slave_load_tmpdir_not_exist.result b/mysql-test/suite/rpl/r/rpl_slave_load_tmpdir_not_exist.result index 8cd6218dcdc..262404ff6f9 100644 --- a/mysql-test/suite/rpl/r/rpl_slave_load_tmpdir_not_exist.result +++ b/mysql-test/suite/rpl/r/rpl_slave_load_tmpdir_not_exist.result @@ -1,6 +1,7 @@ include/master-slave.inc [connection master] START SLAVE; +call mtr.add_suppression("Slave SQL.*Unable to use slave.s temporary directory.* Error_code: 12"); include/wait_for_slave_sql_error.inc [errno=12] include/stop_slave_io.inc RESET SLAVE; diff --git a/mysql-test/suite/rpl/r/rpl_stm_EE_err2.result b/mysql-test/suite/rpl/r/rpl_stm_EE_err2.result index 0e83f1dfb67..d4a14adc6b8 100644 --- a/mysql-test/suite/rpl/r/rpl_stm_EE_err2.result +++ b/mysql-test/suite/rpl/r/rpl_stm_EE_err2.result @@ -8,6 +8,7 @@ insert into t1 values(1),(2); ERROR 23000: Duplicate entry '2' for key 'a' drop table t1; include/wait_for_slave_sql_to_stop.inc +call mtr.add_suppression("Slave SQL.*Query caused different errors on master and slave.*Error on master:.* error code=1062.*Error on slave:.* Error_code: 0"); Error: "Query caused different errors on master and slave. Error on master: message (format)='Duplicate entry '%-.192s' for key %d' error code=1062 ; Error on slave: actual message='no error', error code=0. Default database: 'test'. Query: 'insert into t1 values(1),(2)'" (expected different error codes on master and slave) Errno: "0" (expected 0) drop table t1; diff --git a/mysql-test/suite/rpl/r/rpl_stm_conflicts.result b/mysql-test/suite/rpl/r/rpl_stm_conflicts.result index b56297a5487..ee137c34fd0 100644 --- a/mysql-test/suite/rpl/r/rpl_stm_conflicts.result +++ b/mysql-test/suite/rpl/r/rpl_stm_conflicts.result @@ -17,6 +17,7 @@ a ---- Wait until slave stops with an error ---- include/wait_for_slave_sql_error.inc [errno=1062] Last_SQL_Error = Error 'Duplicate entry '1' for key 'PRIMARY'' on query. Default database: 'test'. Query: 'INSERT INTO t1 VALUES (1)' (expected "duplicate key" error) +call mtr.add_suppression("Slave SQL.*Duplicate entry .1. for key .PRIMARY.* Error_code: 1062"); SELECT * FROM t1; a 1 diff --git a/mysql-test/suite/rpl/r/rpl_temporary_errors.result b/mysql-test/suite/rpl/r/rpl_temporary_errors.result index 27843e1dcda..f667ea98907 100644 --- a/mysql-test/suite/rpl/r/rpl_temporary_errors.result +++ b/mysql-test/suite/rpl/r/rpl_temporary_errors.result @@ -37,6 +37,7 @@ a b 3 3 4 4 include/check_slave_is_running.inc +call mtr.add_suppression("Slave SQL.*Could not execute Update_rows event on table test.t1"); **** On Master **** DROP TABLE t1; SET SESSION BINLOG_FORMAT=MIXED; diff --git a/mysql-test/suite/rpl/t/rpl_binlog_corruption.test b/mysql-test/suite/rpl/t/rpl_binlog_corruption.test index 2c9ec02764c..6717bda0fa7 100644 --- a/mysql-test/suite/rpl/t/rpl_binlog_corruption.test +++ b/mysql-test/suite/rpl/t/rpl_binlog_corruption.test @@ -22,7 +22,7 @@ source include/have_debug.inc; --connection slave call mtr.add_suppression('Found invalid event in binary log'); - +call mtr.add_suppression('Slave SQL.*Relay log read failure: Could not parse relay log event entry.* 1594'); # # BUG#40482: server/mysqlbinlog crashes when reading invalid Incident_log_event diff --git a/mysql-test/suite/rpl/t/rpl_binlog_max_cache_size.test b/mysql-test/suite/rpl/t/rpl_binlog_max_cache_size.test index 265bde2ccf6..06ba1fdc38e 100644 --- a/mysql-test/suite/rpl/t/rpl_binlog_max_cache_size.test +++ b/mysql-test/suite/rpl/t/rpl_binlog_max_cache_size.test @@ -398,6 +398,7 @@ source include/stop_slave.inc; source include/start_slave.inc; CALL mtr.add_suppression("Multi-statement transaction required more than 'max_binlog_cache_size' bytes of storage.*"); CALL mtr.add_suppression("Writing one row to the row-based binary log failed.*"); +CALL mtr.add_suppression("Slave SQL.*The incident LOST_EVENTS occured on the master. Message: error writing to the binary log"); connection master; TRUNCATE t1; diff --git a/mysql-test/suite/rpl/t/rpl_bug33931.test b/mysql-test/suite/rpl/t/rpl_bug33931.test index c2cf5811938..7ee6da94357 100644 --- a/mysql-test/suite/rpl/t/rpl_bug33931.test +++ b/mysql-test/suite/rpl/t/rpl_bug33931.test @@ -9,6 +9,7 @@ connection slave; # Add suppression for expected warnings in slaves error log call mtr.add_suppression("Failed during slave I/O thread initialization"); +call mtr.add_suppression("Slave SQL.*Failed during slave thread initialization.* 1593"); --source include/stop_slave.inc reset slave; diff --git a/mysql-test/suite/rpl/t/rpl_circular_for_4_hosts.test b/mysql-test/suite/rpl/t/rpl_circular_for_4_hosts.test index 820ffc42933..1380b3d97cf 100644 --- a/mysql-test/suite/rpl/t/rpl_circular_for_4_hosts.test +++ b/mysql-test/suite/rpl/t/rpl_circular_for_4_hosts.test @@ -82,6 +82,7 @@ INSERT INTO t1(b,c) VALUES('B',2); # Wait while C will stop. --connection server_3 # 1062 = ER_DUP_ENTRY +call mtr.add_suppression("Slave SQL.*Duplicate entry .6. for key .PRIMARY.* Error_code: 1062"); --let $slave_sql_errno= 1062 --source include/wait_for_slave_sql_error.inc --connection server_1 diff --git a/mysql-test/suite/rpl/t/rpl_filter_tables_not_exist.test b/mysql-test/suite/rpl/t/rpl_filter_tables_not_exist.test index 8e1c9eb98b2..13c66f9f64b 100644 --- a/mysql-test/suite/rpl/t/rpl_filter_tables_not_exist.test +++ b/mysql-test/suite/rpl/t/rpl_filter_tables_not_exist.test @@ -122,6 +122,8 @@ UPDATE t7 LEFT JOIN (t8, t4, t1) ON (t7.id=t8.id and t7.id=t4.id and t7.id=t1.id # if any of the above statement are not ignored, it would cause error # and stop slave sql thread. sync_slave_with_master; +connection slave; +call mtr.add_suppression("Slave SQL.*Error .Table .test.t[47]. doesn.t exist. on query.* Error_code: 1146"); connection master; # Parameters for include/wait_for_slave_sql_error_and_skip.inc: diff --git a/mysql-test/suite/rpl/t/rpl_idempotency.test b/mysql-test/suite/rpl/t/rpl_idempotency.test index 141f3699b14..c72f19dec56 100644 --- a/mysql-test/suite/rpl/t/rpl_idempotency.test +++ b/mysql-test/suite/rpl/t/rpl_idempotency.test @@ -8,9 +8,10 @@ connection slave; source include/have_innodb.inc; # Add suppression for expected warning(s) in slaves error log -call mtr.add_suppression("Slave: Can't find record in 't.' Error_code: 1032"); -call mtr.add_suppression("Slave: Cannot delete or update a parent row: a foreign key constraint fails .* Error_code: 1451"); -call mtr.add_suppression("Slave: Cannot add or update a child row: a foreign key constraint fails .* Error_code: 1452"); +call mtr.add_suppression("Can.t find record in .t[12].* Error_code: 1032"); +call mtr.add_suppression("Cannot delete or update a parent row: a foreign key constraint fails .* Error_code: 1451"); +call mtr.add_suppression("Cannot add or update a child row: a foreign key constraint fails .* Error_code: 1452"); +call mtr.add_suppression("Slave SQL.*Could not execute Write_rows event on table test.* Duplicate entry .1. for key .PRIMARY.* Error_code: 1062"); SET @old_slave_exec_mode= @@global.slave_exec_mode; diff --git a/mysql-test/suite/rpl/t/rpl_ignore_table.test b/mysql-test/suite/rpl/t/rpl_ignore_table.test index 1ab7393d8fc..53a772aea8f 100644 --- a/mysql-test/suite/rpl/t/rpl_ignore_table.test +++ b/mysql-test/suite/rpl/t/rpl_ignore_table.test @@ -125,6 +125,7 @@ show grants for mysqltest4@localhost; # where mysqltest1 does not exist on slave, # to succeed on slave the mode is temporarily changed set global slave_exec_mode='IDEMPOTENT'; +call mtr.add_suppression("Slave SQL.*Could not execute Delete_rows event on table mysql.* Error_code: 1032"); connection master; drop table t1, mysqltest2.t2; diff --git a/mysql-test/suite/rpl/t/rpl_incident.test b/mysql-test/suite/rpl/t/rpl_incident.test index b65441c7d50..d6034009f4f 100644 --- a/mysql-test/suite/rpl/t/rpl_incident.test +++ b/mysql-test/suite/rpl/t/rpl_incident.test @@ -15,6 +15,7 @@ SELECT * FROM t1; connection slave; # Wait until SQL thread stops with error LOST_EVENT on master +call mtr.add_suppression("Slave SQL.*The incident LOST_EVENTS occured on the master.* 1590"); let $slave_sql_errno= 1590; let $show_slave_sql_error= 1; source include/wait_for_slave_sql_error.inc; diff --git a/mysql-test/suite/rpl/t/rpl_init_slave_errors.test b/mysql-test/suite/rpl/t/rpl_init_slave_errors.test index cf72de18e13..4dab13856d4 100644 --- a/mysql-test/suite/rpl/t/rpl_init_slave_errors.test +++ b/mysql-test/suite/rpl/t/rpl_init_slave_errors.test @@ -58,7 +58,7 @@ start slave; --let $show_slave_sql_error= 1 --source include/wait_for_slave_sql_error.inc -call mtr.add_suppression("Failed during slave I/O thread initialization"); +call mtr.add_suppression("Failed during slave.* thread initialization"); SET GLOBAL debug= ""; diff --git a/mysql-test/suite/rpl/t/rpl_known_bugs_detection.test b/mysql-test/suite/rpl/t/rpl_known_bugs_detection.test index a8c7c2c1f5b..09bc715f9a5 100644 --- a/mysql-test/suite/rpl/t/rpl_known_bugs_detection.test +++ b/mysql-test/suite/rpl/t/rpl_known_bugs_detection.test @@ -30,6 +30,7 @@ connection slave; #1105 = ER_UNKNOWN_ERROR --let $slave_sql_errno= 1105 --let $show_slave_sql_error= 1 +call mtr.add_suppression("Slave SQL.*suffer.*http:..bugs.mysql.com.bug.php.id=24432"); --source include/wait_for_slave_sql_error.inc # show that it was not replicated SELECT * FROM t1; diff --git a/mysql-test/suite/rpl/t/rpl_loaddata_fatal.test b/mysql-test/suite/rpl/t/rpl_loaddata_fatal.test index ecbaddb6995..be099c1b6c4 100644 --- a/mysql-test/suite/rpl/t/rpl_loaddata_fatal.test +++ b/mysql-test/suite/rpl/t/rpl_loaddata_fatal.test @@ -15,6 +15,7 @@ connection master; LOAD DATA INFILE '../../std_data/rpl_loaddata.dat' INTO TABLE t1; connection slave; +call mtr.add_suppression("Slave SQL.*Fatal error: Not enough memory, Error_code: 1593"); let $slave_sql_errno= 1593; let $show_slave_sql_error= 1; source include/wait_for_slave_sql_error_and_skip.inc; diff --git a/mysql-test/suite/rpl/t/rpl_rotate_logs.test b/mysql-test/suite/rpl/t/rpl_rotate_logs.test index 6ed690f91bf..4d48190cdf2 100644 --- a/mysql-test/suite/rpl/t/rpl_rotate_logs.test +++ b/mysql-test/suite/rpl/t/rpl_rotate_logs.test @@ -93,6 +93,7 @@ set insert_id=1234; insert into t2 values(NULL); connection slave; # 1062 = ER_DUP_ENTRY +call mtr.add_suppression("Slave SQL.*Error .Duplicate entry .1234. for key .PRIMARY.. on query.* Error_code: 1062"); --let $slave_sql_errno= 1062 --source include/wait_for_slave_sql_error_and_skip.inc diff --git a/mysql-test/suite/rpl/t/rpl_row_basic_11bugs.test b/mysql-test/suite/rpl/t/rpl_row_basic_11bugs.test index 915e747dd45..a78a6e8b8d1 100644 --- a/mysql-test/suite/rpl/t/rpl_row_basic_11bugs.test +++ b/mysql-test/suite/rpl/t/rpl_row_basic_11bugs.test @@ -62,6 +62,7 @@ DROP TABLE t1; --echo **** On Slave **** connection slave; SET GLOBAL QUERY_CACHE_SIZE=0; +call mtr.add_suppression("Slave SQL.*Could not execute Update_rows event on table test.t1.* Error_code: 1032"); --echo **** On Master **** connection master; diff --git a/mysql-test/suite/rpl/t/rpl_row_colSize.test b/mysql-test/suite/rpl/t/rpl_row_colSize.test index 04434517518..be7d72e858e 100644 --- a/mysql-test/suite/rpl/t/rpl_row_colSize.test +++ b/mysql-test/suite/rpl/t/rpl_row_colSize.test @@ -160,6 +160,9 @@ let $test_table_slave = CREATE TABLE t1 (a TINYBLOB); let $test_insert = INSERT INTO t1 VALUES ('This is a test.'); source include/test_fieldsize.inc; +connection slave; +call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column 0 ...e mismatch.* Error_code: 1535"); + --echo *** Cleanup *** connection master; DROP TABLE IF EXISTS t1; diff --git a/mysql-test/suite/rpl/t/rpl_row_inexist_tbl.test b/mysql-test/suite/rpl/t/rpl_row_inexist_tbl.test index b695428dd38..4c8e56d626f 100644 --- a/mysql-test/suite/rpl/t/rpl_row_inexist_tbl.test +++ b/mysql-test/suite/rpl/t/rpl_row_inexist_tbl.test @@ -30,6 +30,7 @@ INSERT INTO t1 VALUES (1); connection slave; # slave should have stopped because can't find table t1 # 1146 = ER_NO_SUCH_TABLE +call mtr.add_suppression("Slave SQL.*Error .Table .test.t1. doesn.t exist. on opening tables, Error_code: 1146"); --let $slave_sql_errno= 1146 --source include/wait_for_slave_sql_error.inc diff --git a/mysql-test/suite/rpl/t/rpl_skip_error.test b/mysql-test/suite/rpl/t/rpl_skip_error.test index 2853c95b212..82d6e61a2cd 100644 --- a/mysql-test/suite/rpl/t/rpl_skip_error.test +++ b/mysql-test/suite/rpl/t/rpl_skip_error.test @@ -102,6 +102,8 @@ SET SQL_LOG_BIN=1; connection slave; +call mtr.add_suppression("Slave SQL.*Could not execute .*te_rows event on table test.t.; Duplicate entry.* Error_code: 1062"); + CREATE TABLE t1(id INT NOT NULL PRIMARY KEY, data INT) Engine=InnoDB; SHOW CREATE TABLE t1; diff --git a/mysql-test/suite/rpl/t/rpl_slave_grp_exec.test b/mysql-test/suite/rpl/t/rpl_slave_grp_exec.test index 70ebba0047b..8525718283e 100644 --- a/mysql-test/suite/rpl/t/rpl_slave_grp_exec.test +++ b/mysql-test/suite/rpl/t/rpl_slave_grp_exec.test @@ -63,6 +63,7 @@ SELECT * FROM t3 ORDER BY a; --connection slave # 1146 = ER_NO_SUCH_TABLE +call mtr.add_suppression("Slave SQL.*Error .Table .test.t3. doesn.t exist. on.* Error_code: 1146"); --let $slave_sql_errno= 1146 --source include/wait_for_slave_sql_error.inc SHOW TABLES LIKE 't%'; diff --git a/mysql-test/suite/rpl/t/rpl_slave_load_remove_tmpfile.test b/mysql-test/suite/rpl/t/rpl_slave_load_remove_tmpfile.test index d80a2ed9e25..c718f072e11 100644 --- a/mysql-test/suite/rpl/t/rpl_slave_load_remove_tmpfile.test +++ b/mysql-test/suite/rpl/t/rpl_slave_load_remove_tmpfile.test @@ -49,5 +49,6 @@ RESET SLAVE; drop table t1; call mtr.add_suppression("Slave: Error writing file 'UNKNOWN' .Errcode: 9. Error_code: 3"); +call mtr.add_suppression("Slave SQL.*Error in Begin_load_query event: write to.* failed, Error_code: 9"); --let $rpl_only_running_threads= 1 --source include/rpl_end.inc diff --git a/mysql-test/suite/rpl/t/rpl_slave_load_tmpdir_not_exist.test b/mysql-test/suite/rpl/t/rpl_slave_load_tmpdir_not_exist.test index 0481581998c..b99c71b1ca0 100644 --- a/mysql-test/suite/rpl/t/rpl_slave_load_tmpdir_not_exist.test +++ b/mysql-test/suite/rpl/t/rpl_slave_load_tmpdir_not_exist.test @@ -11,6 +11,7 @@ --connection slave START SLAVE; # Why 12??? +call mtr.add_suppression("Slave SQL.*Unable to use slave.s temporary directory.* Error_code: 12"); --let $slave_sql_errno= 12 source include/wait_for_slave_sql_error.inc; diff --git a/mysql-test/suite/rpl/t/rpl_temporary_errors.test b/mysql-test/suite/rpl/t/rpl_temporary_errors.test index 7ebaa10e9db..e85bf6ab753 100644 --- a/mysql-test/suite/rpl/t/rpl_temporary_errors.test +++ b/mysql-test/suite/rpl/t/rpl_temporary_errors.test @@ -28,6 +28,9 @@ SHOW STATUS LIKE 'Slave_retried_transactions'; SELECT * FROM t1; source include/check_slave_is_running.inc; +connection slave; +call mtr.add_suppression("Slave SQL.*Could not execute Update_rows event on table test.t1"); + --echo **** On Master **** connection master; DROP TABLE t1; From 5a805fe7c4b0ec4907376c4439c677d88b2bb0dd Mon Sep 17 00:00:00 2001 From: Vasil Dimov Date: Fri, 25 Feb 2011 11:50:18 +0200 Subject: [PATCH 127/202] Fix BUG#11798085 - INCORRECT INTEGER TYPES USED IN CALCULATION RESULT IN OVERFLOW Do not assign the result of the difference to a signed variable and checking whether it is negative afterwards because this limits the max diff to 2G on 32 bit systems. E.g. "signed = 3.5G - 1G" would be negative and the code would assume that 3.5G < 1G. Instead compare the two variables directly and assign to unsigned only if we know that the result of the subtraction will be positive. Discussed with: Jimmy and Sunny (via IRC) --- storage/innodb_plugin/buf/buf0buf.c | 9 ++++++--- 1 file changed, 6 insertions(+), 3 deletions(-) diff --git a/storage/innodb_plugin/buf/buf0buf.c b/storage/innodb_plugin/buf/buf0buf.c index 6bbd5565c58..51a3a393d36 100644 --- a/storage/innodb_plugin/buf/buf0buf.c +++ b/storage/innodb_plugin/buf/buf0buf.c @@ -1893,16 +1893,19 @@ buf_block_align( /* TODO: protect buf_pool->chunks with a mutex (it will currently remain constant after buf_pool_init()) */ for (chunk = buf_pool->chunks, i = buf_pool->n_chunks; i--; chunk++) { - lint offs = ptr - chunk->blocks->frame; + ulint offs; - if (UNIV_UNLIKELY(offs < 0)) { + if (UNIV_UNLIKELY(ptr < chunk->blocks->frame)) { continue; } + /* else */ + + offs = ptr - chunk->blocks->frame; offs >>= UNIV_PAGE_SIZE_SHIFT; - if (UNIV_LIKELY((ulint) offs < chunk->size)) { + if (UNIV_LIKELY(offs < chunk->size)) { buf_block_t* block = &chunk->blocks[offs]; /* The function buf_chunk_init() invokes From 0f8ae318c7203158e1ea70cbf3a6bba41fd2dde6 Mon Sep 17 00:00:00 2001 From: =?UTF-8?q?Marko=20M=C3=A4kel=C3=A4?= Date: Mon, 28 Feb 2011 13:51:18 +0200 Subject: [PATCH 128/202] Bug #58549 Race condition in buf_LRU_drop_page_hash_for_tablespace() and compressed tables buf_LRU_drop_page_hash_for_tablespace(): after releasing and reacquiring the buffer pool mutex, do not dereference any block descriptor pointer that is not known to be a pointer to an uncompressed page frame (type buf_block_t; state == BUF_BLOCK_FILE_PAGE). Also, defer the acquisition of the block_mutex until it is needed. buf_page_get_gen(): Add mode == BUF_GET_IF_IN_POOL_PEEK for buffer-fixing a block without making it young in the LRU list. buf_page_get_gen(), buf_page_init(), buf_LRU_block_remove_hashed_page(): Set bpage->state = BUF_BLOCK_ZIP_FREE before buf_buddy_free(bpage), so that similar race conditions might be detected a little easier. btr_search_drop_page_hash_when_freed(): Use BUF_GET_IF_IN_POOL_PEEK when dropping the hash indexes. rb://528 approved by Jimmy Yang --- storage/innodb_plugin/ChangeLog | 6 ++ storage/innodb_plugin/btr/btr0sea.c | 4 +- storage/innodb_plugin/buf/buf0buf.c | 32 ++++++--- storage/innodb_plugin/buf/buf0lru.c | 87 +++++++++++++------------ storage/innodb_plugin/include/buf0buf.h | 4 +- 5 files changed, 81 insertions(+), 52 deletions(-) diff --git a/storage/innodb_plugin/ChangeLog b/storage/innodb_plugin/ChangeLog index 1b2747ab012..1ece3ad1825 100644 --- a/storage/innodb_plugin/ChangeLog +++ b/storage/innodb_plugin/ChangeLog @@ -1,3 +1,9 @@ +2011-02-28 The InnoDB Team + + * btr/btr0sea.c, buf/buf0buf.c, buf/buf0lru.c: + Fix Bug#58549 Race condition in buf_LRU_drop_page_hash_for_tablespace() + and compressed tables + 2011-02-15 The InnoDB Team * sync/sync0rw.c, innodb_bug59307.test: diff --git a/storage/innodb_plugin/btr/btr0sea.c b/storage/innodb_plugin/btr/btr0sea.c index 9835efcf712..cd0eadbb1b8 100644 --- a/storage/innodb_plugin/btr/btr0sea.c +++ b/storage/innodb_plugin/btr/btr0sea.c @@ -1201,8 +1201,8 @@ btr_search_drop_page_hash_when_freed( having to fear a deadlock. */ block = buf_page_get_gen(space, zip_size, page_no, RW_S_LATCH, NULL, - BUF_GET_IF_IN_POOL, __FILE__, __LINE__, - &mtr); + BUF_PEEK_IF_IN_POOL, __FILE__, __LINE__, + &mtr); /* Because the buffer pool mutex was released by buf_page_peek_if_search_hashed(), it is possible that the block was removed from the buffer pool by another thread diff --git a/storage/innodb_plugin/buf/buf0buf.c b/storage/innodb_plugin/buf/buf0buf.c index 51a3a393d36..14ec7b75911 100644 --- a/storage/innodb_plugin/buf/buf0buf.c +++ b/storage/innodb_plugin/buf/buf0buf.c @@ -2031,7 +2031,7 @@ buf_page_get_gen( ulint rw_latch,/*!< in: RW_S_LATCH, RW_X_LATCH, RW_NO_LATCH */ buf_block_t* guess, /*!< in: guessed block or NULL */ ulint mode, /*!< in: BUF_GET, BUF_GET_IF_IN_POOL, - BUF_GET_NO_LATCH */ + BUF_PEEK_IF_IN_POOL, BUF_GET_NO_LATCH */ const char* file, /*!< in: file name */ ulint line, /*!< in: line where called */ mtr_t* mtr) /*!< in: mini-transaction */ @@ -2047,9 +2047,19 @@ buf_page_get_gen( ut_ad((rw_latch == RW_S_LATCH) || (rw_latch == RW_X_LATCH) || (rw_latch == RW_NO_LATCH)); - ut_ad((mode != BUF_GET_NO_LATCH) || (rw_latch == RW_NO_LATCH)); - ut_ad((mode == BUF_GET) || (mode == BUF_GET_IF_IN_POOL) - || (mode == BUF_GET_NO_LATCH)); +#ifdef UNIV_DEBUG + switch (mode) { + case BUF_GET_NO_LATCH: + ut_ad(rw_latch == RW_NO_LATCH); + break; + case BUF_GET: + case BUF_GET_IF_IN_POOL: + case BUF_PEEK_IF_IN_POOL: + break; + default: + ut_error; + } +#endif /* UNIV_DEBUG */ ut_ad(zip_size == fil_space_get_zip_size(space)); ut_ad(ut_is_2pow(zip_size)); #ifndef UNIV_LOG_DEBUG @@ -2091,7 +2101,8 @@ loop2: buf_pool_mutex_exit(); - if (mode == BUF_GET_IF_IN_POOL) { + if (mode == BUF_GET_IF_IN_POOL + || mode == BUF_PEEK_IF_IN_POOL) { return(NULL); } @@ -2130,7 +2141,8 @@ loop2: must_read = buf_block_get_io_fix(block) == BUF_IO_READ; - if (must_read && mode == BUF_GET_IF_IN_POOL) { + if (must_read && (mode == BUF_GET_IF_IN_POOL + || mode == BUF_PEEK_IF_IN_POOL)) { /* The page is only being read to buffer */ buf_pool_mutex_exit(); @@ -2248,6 +2260,7 @@ wait_until_unfixed: mutex_exit(&buf_pool_zip_mutex); buf_pool->n_pend_unzip++; + bpage->state = BUF_BLOCK_ZIP_FREE; buf_buddy_free(bpage, sizeof *bpage); buf_pool_mutex_exit(); @@ -2324,7 +2337,9 @@ wait_until_unfixed: buf_pool_mutex_exit(); - buf_page_set_accessed_make_young(&block->page, access_time); + if (UNIV_LIKELY(mode != BUF_PEEK_IF_IN_POOL)) { + buf_page_set_accessed_make_young(&block->page, access_time); + } #if defined UNIV_DEBUG_FILE_ACCESSES || defined UNIV_DEBUG ut_a(!block->page.file_page_was_freed); @@ -2377,7 +2392,7 @@ wait_until_unfixed: mtr_memo_push(mtr, block, fix_type); - if (!access_time) { + if (UNIV_LIKELY(mode != BUF_PEEK_IF_IN_POOL) && !access_time) { /* In the case of a first access, try to apply linear read-ahead */ @@ -2926,6 +2941,7 @@ err_exit: && UNIV_LIKELY_NULL(buf_page_hash_get(space, offset))) { /* The block was added by some other thread. */ + bpage->state = BUF_BLOCK_ZIP_FREE; buf_buddy_free(bpage, sizeof *bpage); buf_buddy_free(data, zip_size); diff --git a/storage/innodb_plugin/buf/buf0lru.c b/storage/innodb_plugin/buf/buf0lru.c index 39feb06ff23..a69b2658c51 100644 --- a/storage/innodb_plugin/buf/buf0lru.c +++ b/storage/innodb_plugin/buf/buf0lru.c @@ -246,71 +246,75 @@ buf_LRU_drop_page_hash_for_tablespace( page_arr = ut_malloc(sizeof(ulint) * BUF_LRU_DROP_SEARCH_HASH_SIZE); buf_pool_mutex_enter(); + num_entries = 0; scan_again: - num_entries = 0; bpage = UT_LIST_GET_LAST(buf_pool->LRU); while (bpage != NULL) { - mutex_t* block_mutex = buf_page_get_mutex(bpage); buf_page_t* prev_bpage; + ibool is_fixed; - mutex_enter(block_mutex); prev_bpage = UT_LIST_GET_PREV(LRU, bpage); ut_a(buf_page_in_file(bpage)); if (buf_page_get_state(bpage) != BUF_BLOCK_FILE_PAGE || bpage->space != id - || bpage->buf_fix_count > 0 || bpage->io_fix != BUF_IO_NONE) { - /* We leave the fixed pages as is in this scan. - To be dealt with later in the final scan. */ - mutex_exit(block_mutex); + /* Compressed pages are never hashed. + Skip blocks of other tablespaces. + Skip I/O-fixed blocks (to be dealt with later). */ +next_page: + bpage = prev_bpage; + continue; + } + + mutex_enter(&((buf_block_t*) bpage)->mutex); + is_fixed = bpage->buf_fix_count > 0 + || !((buf_block_t*) bpage)->is_hashed; + mutex_exit(&((buf_block_t*) bpage)->mutex); + + if (is_fixed) { goto next_page; } - if (((buf_block_t*) bpage)->is_hashed) { + /* Store the page number so that we can drop the hash + index in a batch later. */ + page_arr[num_entries] = bpage->offset; + ut_a(num_entries < BUF_LRU_DROP_SEARCH_HASH_SIZE); + ++num_entries; - /* Store the offset(i.e.: page_no) in the array - so that we can drop hash index in a batch - later. */ - page_arr[num_entries] = bpage->offset; - mutex_exit(block_mutex); - ut_a(num_entries < BUF_LRU_DROP_SEARCH_HASH_SIZE); - ++num_entries; - - if (num_entries < BUF_LRU_DROP_SEARCH_HASH_SIZE) { - goto next_page; - } - /* Array full. We release the buf_pool_mutex to - obey the latching order. */ - buf_pool_mutex_exit(); - - buf_LRU_drop_page_hash_batch(id, zip_size, page_arr, - num_entries); - num_entries = 0; - buf_pool_mutex_enter(); - } else { - mutex_exit(block_mutex); + if (num_entries < BUF_LRU_DROP_SEARCH_HASH_SIZE) { + goto next_page; } -next_page: - /* Note that we may have released the buf_pool mutex - above after reading the prev_bpage during processing - of a page_hash_batch (i.e.: when the array was full). - This means that prev_bpage can change in LRU list. - This is OK because this function is a 'best effort' - to drop as many search hash entries as possible and - it does not guarantee that ALL such entries will be - dropped. */ - bpage = prev_bpage; + /* Array full. We release the buf_pool_mutex to + obey the latching order. */ + buf_pool_mutex_exit(); + buf_LRU_drop_page_hash_batch(id, zip_size, page_arr, + num_entries); + buf_pool_mutex_enter(); + num_entries = 0; + + /* Note that we released the buf_pool mutex above + after reading the prev_bpage during processing of a + page_hash_batch (i.e.: when the array was full). + Because prev_bpage could belong to a compressed-only + block, it may have been relocated, and thus the + pointer cannot be trusted. Because bpage is of type + buf_block_t, it is safe to dereference. + + bpage can change in the LRU list. This is OK because + this function is a 'best effort' to drop as many + search hash entries as possible and it does not + guarantee that ALL such entries will be dropped. */ /* If, however, bpage has been removed from LRU list to the free list then we should restart the scan. bpage->state is protected by buf_pool mutex. */ - if (bpage && !buf_page_in_file(bpage)) { - ut_a(num_entries == 0); + if (bpage + && buf_page_get_state(bpage) != BUF_BLOCK_FILE_PAGE) { goto scan_again; } } @@ -1799,6 +1803,7 @@ buf_LRU_block_remove_hashed_page( buf_pool_mutex_exit_forbid(); buf_buddy_free(bpage->zip.data, page_zip_get_size(&bpage->zip)); + bpage->state = BUF_BLOCK_ZIP_FREE; buf_buddy_free(bpage, sizeof(*bpage)); buf_pool_mutex_exit_allow(); UNIV_MEM_UNDESC(bpage); diff --git a/storage/innodb_plugin/include/buf0buf.h b/storage/innodb_plugin/include/buf0buf.h index a16de67aa3a..05dead5ac9e 100644 --- a/storage/innodb_plugin/include/buf0buf.h +++ b/storage/innodb_plugin/include/buf0buf.h @@ -41,6 +41,8 @@ Created 11/5/1995 Heikki Tuuri /* @{ */ #define BUF_GET 10 /*!< get always */ #define BUF_GET_IF_IN_POOL 11 /*!< get if in pool */ +#define BUF_PEEK_IF_IN_POOL 12 /*!< get if in pool, do not make + the block young in the LRU list */ #define BUF_GET_NO_LATCH 14 /*!< get and bufferfix, but set no latch; we have separated this case, because @@ -284,7 +286,7 @@ buf_page_get_gen( ulint rw_latch,/*!< in: RW_S_LATCH, RW_X_LATCH, RW_NO_LATCH */ buf_block_t* guess, /*!< in: guessed block or NULL */ ulint mode, /*!< in: BUF_GET, BUF_GET_IF_IN_POOL, - BUF_GET_NO_LATCH */ + BUF_PEEK_IF_IN_POOL, BUF_GET_NO_LATCH */ const char* file, /*!< in: file name */ ulint line, /*!< in: line where called */ mtr_t* mtr); /*!< in: mini-transaction */ From 4a54e5adb157a7eb9bbee84d7aa233ad1fb087a0 Mon Sep 17 00:00:00 2001 From: Bjorn Munch Date: Mon, 28 Feb 2011 16:10:35 +0100 Subject: [PATCH 129/202] Attempt at solving missing end of mtr output on Windows --- mysql-test/lib/mtr_report.pm | 2 ++ 1 file changed, 2 insertions(+) diff --git a/mysql-test/lib/mtr_report.pm b/mysql-test/lib/mtr_report.pm index 0090316cf7b..bbf1002c123 100644 --- a/mysql-test/lib/mtr_report.pm +++ b/mysql-test/lib/mtr_report.pm @@ -32,6 +32,7 @@ our @EXPORT= qw(report_option mtr_print_line mtr_print_thick_line use mtr_match; use My::Platform; use POSIX qw[ _exit ]; +use IO::Handle qw[ flush ]; require "mtr_io.pl"; my $tot_real_time= 0; @@ -477,6 +478,7 @@ sub mtr_warning (@) { # Print error to screen and then exit sub mtr_error (@) { + IO::Handle::flush(\*STDOUT) if IS_WINDOWS; print STDERR _name(). _timestamp(). "mysql-test-run: *** ERROR: ". join(" ", @_). "\n"; if (IS_WINDOWS) From fd1e3b03ff8837e8af1a8aa486cc2b13f872861f Mon Sep 17 00:00:00 2001 From: Alexander Barkov Date: Tue, 1 Mar 2011 15:30:18 +0300 Subject: [PATCH 130/202] Bug#11766725 (Bug#59901) EXTRACTVALUE STILL BROKEN AFTER FIX FOR BUG #44332 Problem: a byte behind the end of input string was read in case of a broken XML not having a quote or doublequote character closing a string value. Fix: changing condition not to read behind the end of input string @ mysql-test/r/xml.result @ mysql-test/t/xml.test Adding tests @ strings/xml.c When checking if the closing quote/doublequote was found, using p->cur[0] us unsafe, as p->cur can point to the byte after the value. Comparing p->cur to p->beg instead. --- mysql-test/r/xml.result | 8 ++++++++ mysql-test/t/xml.test | 5 +++++ strings/xml.c | 7 ++++++- 3 files changed, 19 insertions(+), 1 deletion(-) diff --git a/mysql-test/r/xml.result b/mysql-test/r/xml.result index 0a71a596505..dda77cba04c 100644 --- a/mysql-test/r/xml.result +++ b/mysql-test/r/xml.result @@ -1124,4 +1124,12 @@ Warning 1525 Incorrect XML value: 'parse error at line 1 pos 2: END-OF-INPUT une SELECT UPDATEXML(CONVERT(_latin1' SLAVE BREAK WITH ERROR HA_ERR_END_OF_ The slave was not able to find the correct row in the innodb table, because the row fetched from the innodb table would not match the before image. This happened because the (don't care) bytes in the NULLed fields would change once the row was stored in the storage engine (from zero to the default value). This would make bulk memory comparison (using memcmp) to fail. We fix this by taking a preventing measure and avoiding memcmp for tables that contain nullable fields. Therefore, we protect the slave search routine from engines that return arbitrary values for don't care bytes (in the nulled fields). Instead, the slave thread will only check null_bits and those fields that are not set to NULL when comparing the before image against the storage engine row. mysql-test/extra/rpl_tests/rpl_record_compare.test: Added test case to the include file so that this is tested with more than one engine. mysql-test/suite/rpl/r/rpl_row_rec_comp_innodb.result: Result update. mysql-test/suite/rpl/r/rpl_row_rec_comp_myisam.result: Result update. mysql-test/suite/rpl/t/rpl_row_rec_comp_myisam.test: Moved the include file last, so that the result from BUG#11766865 is not intermixed with the result for BUG#11760454. sql/log_event.cc: Skips memory comparison if the table has nullable columns and compares only non-nulled fields in the field comparison loop. --- .../extra/rpl_tests/rpl_record_compare.test | 20 ++++++++++++ .../rpl/r/rpl_row_rec_comp_innodb.result | 6 ++++ .../rpl/r/rpl_row_rec_comp_myisam.result | 20 +++++++----- .../suite/rpl/t/rpl_row_rec_comp_myisam.test | 6 ++-- sql/log_event.cc | 31 ++++++++++++++++--- 5 files changed, 69 insertions(+), 14 deletions(-) diff --git a/mysql-test/extra/rpl_tests/rpl_record_compare.test b/mysql-test/extra/rpl_tests/rpl_record_compare.test index f29e4fb791a..210aee025d0 100644 --- a/mysql-test/extra/rpl_tests/rpl_record_compare.test +++ b/mysql-test/extra/rpl_tests/rpl_record_compare.test @@ -62,4 +62,24 @@ UPDATE t1 SET c1= 0; DROP TABLE t1; -- sync_slave_with_master +# +# BUG#11766865: 60091: RBR + NO PK + UPDATE NULL VALUE --> SLAVE BREAK WITH ERROR HA_ERR_END_OF_ +# +--connection master +--source include/rpl_reset.inc +--connection master + +--eval CREATE TABLE t1 (c1 int(11) NOT NULL, c2 int(11) NOT NULL, c3 int(11) DEFAULT '-1') ENGINE=$engine DEFAULT CHARSET=latin1 + +INSERT INTO t1 VALUES (1,2,NULL); +UPDATE t1 SET c1=1, c2=2, c3=-1 WHERE c1=1 AND c2=2 AND ISNULL(c3); + +--sync_slave_with_master + +--let $diff_tables=master:test.t1, slave:test.t1 +--source include/diff_tables.inc + +--connection master +DROP TABLE t1; +--sync_slave_with_master diff --git a/mysql-test/suite/rpl/r/rpl_row_rec_comp_innodb.result b/mysql-test/suite/rpl/r/rpl_row_rec_comp_innodb.result index d9ebb52493b..523564a222e 100644 --- a/mysql-test/suite/rpl/r/rpl_row_rec_comp_innodb.result +++ b/mysql-test/suite/rpl/r/rpl_row_rec_comp_innodb.result @@ -25,4 +25,10 @@ INSERT INTO t1(c1) VALUES (NULL); UPDATE t1 SET c1= 0; include/diff_tables.inc [master:t1, slave:t1] DROP TABLE t1; +include/rpl_reset.inc +CREATE TABLE t1 (c1 int(11) NOT NULL, c2 int(11) NOT NULL, c3 int(11) DEFAULT '-1') ENGINE=InnoDB DEFAULT CHARSET=latin1; +INSERT INTO t1 VALUES (1,2,NULL); +UPDATE t1 SET c1=1, c2=2, c3=-1 WHERE c1=1 AND c2=2 AND ISNULL(c3); +include/diff_tables.inc [master:test.t1, slave:test.t1] +DROP TABLE t1; include/rpl_end.inc diff --git a/mysql-test/suite/rpl/r/rpl_row_rec_comp_myisam.result b/mysql-test/suite/rpl/r/rpl_row_rec_comp_myisam.result index e9ffcc927be..4dc7c0bc7a3 100644 --- a/mysql-test/suite/rpl/r/rpl_row_rec_comp_myisam.result +++ b/mysql-test/suite/rpl/r/rpl_row_rec_comp_myisam.result @@ -1,5 +1,14 @@ include/master-slave.inc [connection master] +## coverage purposes - Field_bits +## 1 X bit + 2 Null bits + 5 bits => last_null_bit_pos==0 +include/rpl_reset.inc +CREATE TABLE t1 (c1 bigint(20) DEFAULT 0, c2 bit(5)) ENGINE=MyISAM DEFAULT CHARSET=latin1; +INSERT INTO t1(c1,c2) VALUES (10, b'1'); +INSERT INTO t1(c1,c2) VALUES (NULL, b'1'); +UPDATE t1 SET c1= 0; +include/diff_tables.inc [master:t1, slave:t1] +DROP TABLE t1; ## case #1 - last_null_bit_pos==0 in record_compare without X bit include/rpl_reset.inc CREATE TABLE t1 (c1 bigint(20) DEFAULT 0, c2 bigint(20) DEFAULT 0, c3 bigint(20) DEFAULT 0, c4 varchar(1) DEFAULT '', c5 bigint(20) DEFAULT 0, c6 bigint(20) DEFAULT 0, c7 bigint(20) DEFAULT 0, c8 bigint(20) DEFAULT 0) ENGINE=MyISAM DEFAULT CHARSET=latin1; @@ -25,13 +34,10 @@ INSERT INTO t1(c1) VALUES (NULL); UPDATE t1 SET c1= 0; include/diff_tables.inc [master:t1, slave:t1] DROP TABLE t1; -## coverage purposes - Field_bits -## 1 X bit + 2 Null bits + 5 bits => last_null_bit_pos==0 include/rpl_reset.inc -CREATE TABLE t1 (c1 bigint(20) DEFAULT 0, c2 bit(5)) ENGINE=MyISAM DEFAULT CHARSET=latin1; -INSERT INTO t1(c1,c2) VALUES (10, b'1'); -INSERT INTO t1(c1,c2) VALUES (NULL, b'1'); -UPDATE t1 SET c1= 0; -include/diff_tables.inc [master:t1, slave:t1] +CREATE TABLE t1 (c1 int(11) NOT NULL, c2 int(11) NOT NULL, c3 int(11) DEFAULT '-1') ENGINE=MyISAM DEFAULT CHARSET=latin1; +INSERT INTO t1 VALUES (1,2,NULL); +UPDATE t1 SET c1=1, c2=2, c3=-1 WHERE c1=1 AND c2=2 AND ISNULL(c3); +include/diff_tables.inc [master:test.t1, slave:test.t1] DROP TABLE t1; include/rpl_end.inc diff --git a/mysql-test/suite/rpl/t/rpl_row_rec_comp_myisam.test b/mysql-test/suite/rpl/t/rpl_row_rec_comp_myisam.test index e40cd615ca6..f96603f69ed 100644 --- a/mysql-test/suite/rpl/t/rpl_row_rec_comp_myisam.test +++ b/mysql-test/suite/rpl/t/rpl_row_rec_comp_myisam.test @@ -1,12 +1,11 @@ -- source include/have_binlog_format_row.inc -- source include/master-slave.inc +-- let $engine= MyISAM # # BUG#52868 Wrong handling of NULL value during update, replication out of sync # --- let $engine= MyISAM --- source extra/rpl_tests/rpl_record_compare.test -- echo ## coverage purposes - Field_bits -- echo ## 1 X bit + 2 Null bits + 5 bits => last_null_bit_pos==0 @@ -28,4 +27,7 @@ UPDATE t1 SET c1= 0; -- connection master DROP TABLE t1; -- sync_slave_with_master + +-- source extra/rpl_tests/rpl_record_compare.test + --source include/rpl_end.inc diff --git a/sql/log_event.cc b/sql/log_event.cc index 0b938df1987..19f82b69048 100644 --- a/sql/log_event.cc +++ b/sql/log_event.cc @@ -8888,7 +8888,19 @@ static bool record_compare(TABLE *table) } } - if (table->s->blob_fields + table->s->varchar_fields == 0) + /** + Compare full record only if: + - there are no blob fields (otherwise we would also need + to compare blobs contents as well); + - there are no varchar fields (otherwise we would also need + to compare varchar contents as well); + - there are no null fields, otherwise NULLed fields + contents (i.e., the don't care bytes) may show arbitrary + values, depending on how each engine handles internally. + */ + if ((table->s->blob_fields + + table->s->varchar_fields + + table->s->null_fields) == 0) { result= cmp_record(table,record[1]); goto record_compare_exit; @@ -8903,13 +8915,22 @@ static bool record_compare(TABLE *table) goto record_compare_exit; } - /* Compare updated fields */ + /* Compare fields */ for (Field **ptr=table->field ; *ptr ; ptr++) { - if ((*ptr)->cmp_binary_offset(table->s->rec_buff_length)) + + /** + We only compare field contents that are not null. + NULL fields (i.e., their null bits) were compared + earlier. + */ + if (!(*(ptr))->is_null()) { - result= TRUE; - goto record_compare_exit; + if ((*ptr)->cmp_binary_offset(table->s->rec_buff_length)) + { + result= TRUE; + goto record_compare_exit; + } } } From dcf6b68d08acfbfdc3183b0a13f041af51573eb1 Mon Sep 17 00:00:00 2001 From: Georgi Kodinov Date: Fri, 25 Mar 2011 12:57:27 +0200 Subject: [PATCH 152/202] Bug #11766769: 59959: SMALL VALUES OF --MAX-ALLOWED-PACKET ARE NOT BEING HONORED max_allowed_packet works in conjunction with net_buffer_length. max_allowed_packet is an upper bound of net_buffer_length. So it doesn't make sense to set the upper limit lower than the value. Added a warning (using ER_UNKNOWN_ERRROR and a specific message) when this is done (in the log at startup and when setting either max_allowed_packet or the net_buffer_length variables) Added a test case. Fixed several tests that broke the above rule. --- mysql-test/r/packet.result | 1 + mysql-test/r/variables.result | 27 +++++++++++++ mysql-test/suite/rpl/r/rpl_packet.result | 2 + .../suite/rpl/t/rpl_loaddata_map-master.opt | 2 +- .../suite/rpl/t/rpl_loaddata_map-slave.opt | 2 +- mysql-test/t/variables.test | 26 +++++++++++++ sql/mysqld.cc | 8 ++++ sql/set_var.cc | 38 ++++++++++++++++++- 8 files changed, 102 insertions(+), 4 deletions(-) diff --git a/mysql-test/r/packet.result b/mysql-test/r/packet.result index ecbb47d4ee0..d673ab42691 100644 --- a/mysql-test/r/packet.result +++ b/mysql-test/r/packet.result @@ -3,6 +3,7 @@ set @net_buffer_length=@@global.net_buffer_length; set global max_allowed_packet=100; Warnings: Warning 1292 Truncated incorrect max_allowed_packet value: '100' +Warning 1105 The value of 'max_allowed_packet' should be no less than the value of 'net_buffer_length' set global net_buffer_length=100; Warnings: Warning 1292 Truncated incorrect net_buffer_length value: '100' diff --git a/mysql-test/r/variables.result b/mysql-test/r/variables.result index f4e2a8c08fc..af3b76b09f3 100644 --- a/mysql-test/r/variables.result +++ b/mysql-test/r/variables.result @@ -280,6 +280,7 @@ NET_BUFFER_LENGTH 1024 set global net_buffer_length=2000000000; Warnings: Warning 1292 Truncated incorrect net_buffer_length value: '2000000000' +Warning 1105 The value of 'max_allowed_packet' should be no less than the value of 'net_buffer_length' show global variables like 'net_buffer_length'; Variable_name Value net_buffer_length 1048576 @@ -502,6 +503,7 @@ set low_priority_updates=1; set global max_allowed_packet=100; Warnings: Warning 1292 Truncated incorrect max_allowed_packet value: '100' +Warning 1105 The value of 'max_allowed_packet' should be no less than the value of 'net_buffer_length' set global max_binlog_cache_size=100; Warnings: Warning 1292 Truncated incorrect max_binlog_cache_size value: '100' @@ -1059,6 +1061,8 @@ set global max_write_lock_count =default; set global myisam_data_pointer_size =@my_myisam_data_pointer_size; set global myisam_max_sort_file_size =@my_myisam_max_sort_file_size; set global net_buffer_length =@my_net_buffer_length; +Warnings: +Warning 1105 The value of 'max_allowed_packet' should be no less than the value of 'net_buffer_length' set global net_write_timeout =@my_net_write_timeout; set global net_read_timeout =@my_net_read_timeout; set global query_cache_limit =@my_query_cache_limit; @@ -1547,4 +1551,27 @@ SET @@global.max_binlog_cache_size=DEFAULT; SET @@global.max_join_size=DEFAULT; SET @@global.key_buffer_size=@kbs; SET @@global.key_cache_block_size=@kcbs; +# +# Bug #11766769 : 59959: SMALL VALUES OF --MAX-ALLOWED-PACKET +# ARE NOT BEING HONORED +# +CREATE TABLE t1 (a MEDIUMTEXT); +SET GLOBAL max_allowed_packet=2048; +Warnings: +Warning 1105 The value of 'max_allowed_packet' should be no less than the value of 'net_buffer_length' +SET GLOBAL net_buffer_length=4096; +Warnings: +Warning 1105 The value of 'max_allowed_packet' should be no less than the value of 'net_buffer_length' +SHOW SESSION VARIABLES LIKE 'max_allowed_packet'; +Variable_name Value +max_allowed_packet 2048 +SHOW SESSION VARIABLES LIKE 'net_buffer_length'; +Variable_name Value +net_buffer_length 4096 +ERROR 08S01: Got a packet bigger than 'max_allowed_packet' bytes +SELECT LENGTH(a) FROM t1; +LENGTH(a) +SET GLOBAL max_allowed_packet=default; +SET GLOBAL net_buffer_length=default; +DROP TABLE t1; End of 5.1 tests diff --git a/mysql-test/suite/rpl/r/rpl_packet.result b/mysql-test/suite/rpl/r/rpl_packet.result index 9239a718504..7a7f8141ac8 100644 --- a/mysql-test/suite/rpl/r/rpl_packet.result +++ b/mysql-test/suite/rpl/r/rpl_packet.result @@ -49,6 +49,8 @@ SET @max_allowed_packet_2= @@session.max_allowed_packet; ==== clean up ==== DROP TABLE t1; SET @@global.max_allowed_packet= 1024; +Warnings: +Warning 1105 The value of 'max_allowed_packet' should be no less than the value of 'net_buffer_length' SET @@global.net_buffer_length= 1024; DROP TABLE t1; RESET SLAVE; diff --git a/mysql-test/suite/rpl/t/rpl_loaddata_map-master.opt b/mysql-test/suite/rpl/t/rpl_loaddata_map-master.opt index 831680eb5ef..5fdeb855110 100644 --- a/mysql-test/suite/rpl/t/rpl_loaddata_map-master.opt +++ b/mysql-test/suite/rpl/t/rpl_loaddata_map-master.opt @@ -1 +1 @@ ---read_buffer_size=12K --max_allowed_packet=8K +--read_buffer_size=12K --max_allowed_packet=8K --net-buffer-length=8K diff --git a/mysql-test/suite/rpl/t/rpl_loaddata_map-slave.opt b/mysql-test/suite/rpl/t/rpl_loaddata_map-slave.opt index 95f55bcf7d8..7d404fae240 100644 --- a/mysql-test/suite/rpl/t/rpl_loaddata_map-slave.opt +++ b/mysql-test/suite/rpl/t/rpl_loaddata_map-slave.opt @@ -1 +1 @@ ---max_allowed_packet=8K +--max_allowed_packet=8K --net-buffer-length=8K diff --git a/mysql-test/t/variables.test b/mysql-test/t/variables.test index c61e2aa3708..383bdfc79a9 100644 --- a/mysql-test/t/variables.test +++ b/mysql-test/t/variables.test @@ -1304,4 +1304,30 @@ SET @@global.max_join_size=DEFAULT; SET @@global.key_buffer_size=@kbs; SET @@global.key_cache_block_size=@kcbs; + +--echo # +--echo # Bug #11766769 : 59959: SMALL VALUES OF --MAX-ALLOWED-PACKET +--echo # ARE NOT BEING HONORED +--echo # + +CREATE TABLE t1 (a MEDIUMTEXT); + +SET GLOBAL max_allowed_packet=2048; +SET GLOBAL net_buffer_length=4096; +CONNECT (con1,localhost,root,,test); +SHOW SESSION VARIABLES LIKE 'max_allowed_packet'; +SHOW SESSION VARIABLES LIKE 'net_buffer_length'; +--disable_query_log +--error ER_NET_PACKET_TOO_LARGE +INSERT INTO t1 VALUES ('123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890'); +--enable_query_log +SELECT LENGTH(a) FROM t1; + +CONNECTION default; +DISCONNECT con1; +SET GLOBAL max_allowed_packet=default; +SET GLOBAL net_buffer_length=default; +DROP TABLE t1; + + --echo End of 5.1 tests diff --git a/sql/mysqld.cc b/sql/mysqld.cc index 46376a08ec9..54850f36d10 100644 --- a/sql/mysqld.cc +++ b/sql/mysqld.cc @@ -8795,6 +8795,14 @@ static int get_options(int *argc,char **argv) opt_log_slow_slave_statements) && !opt_slow_log) sql_print_warning("options --log-slow-admin-statements, --log-queries-not-using-indexes and --log-slow-slave-statements have no effect if --log_slow_queries is not set"); + if (global_system_variables.net_buffer_length > + global_system_variables.max_allowed_packet) + { + sql_print_warning("net_buffer_length (%lu) is set to be larger " + "than max_allowed_packet (%lu). Please rectify.", + global_system_variables.net_buffer_length, + global_system_variables.max_allowed_packet); + } #if defined(HAVE_BROKEN_REALPATH) my_use_symdir=0; diff --git a/sql/set_var.cc b/sql/set_var.cc index 333fb90c795..76957e32536 100644 --- a/sql/set_var.cc +++ b/sql/set_var.cc @@ -147,6 +147,8 @@ static void sys_default_general_log_path(THD *thd, enum_var_type type); static bool sys_update_slow_log_path(THD *thd, set_var * var); static void sys_default_slow_log_path(THD *thd, enum_var_type type); static uchar *get_myisam_mmap_size(THD *thd); +static int check_max_allowed_packet(THD *thd, set_var *var); +static int check_net_buffer_length(THD *thd, set_var *var); /* Variable definition list @@ -360,7 +362,8 @@ static sys_var_const sys_lower_case_table_names(&vars, (uchar*) &lower_case_table_names); static sys_var_thd_ulong_session_readonly sys_max_allowed_packet(&vars, "max_allowed_packet", - &SV::max_allowed_packet); + &SV::max_allowed_packet, + check_max_allowed_packet); static sys_var_ulonglong_ptr sys_max_binlog_cache_size(&vars, "max_binlog_cache_size", &max_binlog_cache_size); static sys_var_long_ptr sys_max_binlog_size(&vars, "max_binlog_size", @@ -450,7 +453,8 @@ static sys_var_const sys_named_pipe(&vars, "named_pipe", /* purecov: end */ #endif static sys_var_thd_ulong_session_readonly sys_net_buffer_length(&vars, "net_buffer_length", - &SV::net_buffer_length); + &SV::net_buffer_length, + check_net_buffer_length); static sys_var_thd_ulong sys_net_read_timeout(&vars, "net_read_timeout", &SV::net_read_timeout, 0, fix_net_read_timeout); @@ -4312,6 +4316,36 @@ uchar *sys_var_event_scheduler::value_ptr(THD *thd, enum_var_type type, } #endif + +int +check_max_allowed_packet(THD *thd, set_var *var) +{ + longlong val= var->value->val_int(); + if (val < (longlong) global_system_variables.net_buffer_length) + { + push_warning(thd, MYSQL_ERROR::WARN_LEVEL_WARN, + ER_UNKNOWN_ERROR, + "The value of 'max_allowed_packet' should be no less than " + "the value of 'net_buffer_length'"); + } + return 0; +} + + +int +check_net_buffer_length(THD *thd, set_var *var) +{ + longlong val= var->value->val_int(); + if (val > (longlong) global_system_variables.max_allowed_packet) + { + push_warning(thd, MYSQL_ERROR::WARN_LEVEL_WARN, + ER_UNKNOWN_ERROR, + "The value of 'max_allowed_packet' should be no less than " + "the value of 'net_buffer_length'"); + } + return 0; +} + /**************************************************************************** Used templates ****************************************************************************/ From e0887df8e1127c0f1410b9d4ad61647cb5f93be2 Mon Sep 17 00:00:00 2001 From: Mattias Jonsson Date: Fri, 25 Mar 2011 12:36:02 +0100 Subject: [PATCH 153/202] Bug#11766249 bug#59316: PARTITIONING AND INDEX_MERGE MEMORY LEAK When executing row-ordered-retrieval index merge, the handler was cloned, but it used the wrong memory root, so instead of allocating memory on the thread/query's mem_root, it used the table's mem_root, resulting in non released memory in the table object, and was not freed until the table was closed. Solution was to ensure that memory used during cloning of a handler was allocated from the correct memory root. This was implemented by fixing handler::clone() to also take a name argument, so it can be used with partitioning. And in ha_partition only allocate the ha_partition's ref, and call the original ha_partition partitions clone() and set at cloned partitions. Fix of .bzrignore on Windows with VS 2010 --- .bzrignore | 12 ++ sql/ha_partition.cc | 230 ++++++++++++++++++++++-------- sql/ha_partition.h | 20 ++- sql/handler.cc | 6 +- sql/handler.h | 2 +- sql/opt_range.cc | 2 +- storage/heap/ha_heap.cc | 4 +- storage/heap/ha_heap.h | 2 +- storage/myisam/ha_myisam.cc | 5 +- storage/myisam/ha_myisam.h | 2 +- storage/myisammrg/ha_myisammrg.cc | 9 +- storage/myisammrg/ha_myisammrg.h | 2 +- 12 files changed, 214 insertions(+), 82 deletions(-) diff --git a/.bzrignore b/.bzrignore index 3d27c001e2b..9287e9499e3 100644 --- a/.bzrignore +++ b/.bzrignore @@ -37,7 +37,13 @@ *.user *.vcproj *.vcproj.cmake +*.vcxproj +*.vcxproj.filters */*.dir/* +*.dir +Debug +MySql.sdf +Win32 */*_pure_*warnings */.deps */.libs/* @@ -46,6 +52,7 @@ */minsizerel/* */release/* */relwithdebinfo/* +RelWithDebInfo *~ .*.swp ./CMakeCache.txt @@ -607,6 +614,7 @@ include/mysql_h.ic include/mysql_version.h include/mysqld_ername.h include/mysqld_error.h +include/mysqld_error.h.rule include/openssl include/readline include/readline/*.h @@ -1879,7 +1887,9 @@ scripts/mysql_find_rows scripts/mysql_fix_extensions scripts/mysql_fix_privilege_tables scripts/mysql_fix_privilege_tables.sql +scripts/mysql_fix_privilege_tables.sql.rule scripts/mysql_fix_privilege_tables_sql.c +scripts/mysql_fix_privilege_tables_sql.c.rule scripts/mysql_install_db scripts/mysql_secure_installation scripts/mysql_setpermission @@ -2116,6 +2126,7 @@ sql/handlerton.cc sql/html sql/latex sql/lex_hash.h +sql/lex_hash.h.rule sql/link_sources sql/max/* sql/message.h @@ -2147,6 +2158,7 @@ sql/sql_builtin.cc sql/sql_select.cc.orig sql/sql_yacc.cc sql/sql_yacc.h +sql/sql_yacc.h.rule sql/sql_yacc.output sql/sql_yacc.yy.orig sql/test_time diff --git a/sql/ha_partition.cc b/sql/ha_partition.cc index 7bcbd241541..946ecc652ef 100644 --- a/sql/ha_partition.cc +++ b/sql/ha_partition.cc @@ -163,10 +163,14 @@ const uint ha_partition::NO_CURRENT_PART_ID= 0xFFFFFFFF; */ ha_partition::ha_partition(handlerton *hton, TABLE_SHARE *share) - :handler(hton, share), m_part_info(NULL), m_create_handler(FALSE), - m_is_sub_partitioned(0) + :handler(hton, share) { DBUG_ENTER("ha_partition::ha_partition(table)"); + m_part_info= NULL; + m_create_handler= FALSE; + m_is_sub_partitioned= 0; + m_is_clone_of= NULL; + m_clone_mem_root= NULL; init_handler_variables(); DBUG_VOID_RETURN; } @@ -184,15 +188,46 @@ ha_partition::ha_partition(handlerton *hton, TABLE_SHARE *share) */ ha_partition::ha_partition(handlerton *hton, partition_info *part_info) - :handler(hton, NULL), m_part_info(part_info), m_create_handler(TRUE), - m_is_sub_partitioned(m_part_info->is_sub_partitioned()) + :handler(hton, NULL) { DBUG_ENTER("ha_partition::ha_partition(part_info)"); + DBUG_ASSERT(part_info); + m_part_info= part_info; + m_create_handler= TRUE; + m_is_sub_partitioned= m_part_info->is_sub_partitioned(); init_handler_variables(); - DBUG_ASSERT(m_part_info); DBUG_VOID_RETURN; } +/** + ha_partition constructor method used by ha_partition::clone() + + @param hton Handlerton (partition_hton) + @param share Table share object + @param part_info_arg partition_info to use + @param clone_arg ha_partition to clone + @param clme_mem_root_arg MEM_ROOT to use + + @return New partition handler +*/ + +ha_partition::ha_partition(handlerton *hton, TABLE_SHARE *share, + partition_info *part_info_arg, + ha_partition *clone_arg, + MEM_ROOT *clone_mem_root_arg) + :handler(hton, share) +{ + DBUG_ENTER("ha_partition::ha_partition(clone)"); + m_part_info= part_info_arg; + m_create_handler= TRUE; + m_is_sub_partitioned= m_part_info->is_sub_partitioned(); + m_is_clone_of= clone_arg; + m_clone_mem_root= clone_mem_root_arg; + init_handler_variables(); + m_tot_parts= clone_arg->m_tot_parts; + DBUG_ASSERT(m_tot_parts); + DBUG_VOID_RETURN; +} /* Initialize handler object @@ -244,7 +279,6 @@ void ha_partition::init_handler_variables() m_rec0= 0; m_curr_key_info[0]= NULL; m_curr_key_info[1]= NULL; - is_clone= FALSE, m_part_func_monotonicity_info= NON_MONOTONIC; auto_increment_lock= FALSE; auto_increment_safe_stmt_log_lock= FALSE; @@ -359,7 +393,8 @@ bool ha_partition::initialize_partition(MEM_ROOT *mem_root) */ DBUG_RETURN(0); } - else if (get_from_handler_file(table_share->normalized_path.str, mem_root)) + else if (get_from_handler_file(table_share->normalized_path.str, + mem_root, false)) { my_message(ER_UNKNOWN_ERROR, "Failed to read from the .par file", MYF(0)); DBUG_RETURN(1); @@ -1848,7 +1883,7 @@ uint ha_partition::del_ren_cre_table(const char *from, DBUG_RETURN(TRUE); } - if (get_from_handler_file(from, ha_thd()->mem_root)) + if (get_from_handler_file(from, ha_thd()->mem_root, false)) DBUG_RETURN(TRUE); DBUG_ASSERT(m_file_buffer); DBUG_PRINT("enter", ("from: (%s) to: (%s)", from, to)); @@ -2368,7 +2403,8 @@ error_end: partitions. */ -bool ha_partition::get_from_handler_file(const char *name, MEM_ROOT *mem_root) +bool ha_partition::get_from_handler_file(const char *name, MEM_ROOT *mem_root, + bool clone) { char buff[FN_REFLEN], *address_tot_name_len; File file; @@ -2403,15 +2439,18 @@ bool ha_partition::get_from_handler_file(const char *name, MEM_ROOT *mem_root) m_tot_parts= uint4korr((file_buffer) + 8); DBUG_PRINT("info", ("No of parts = %u", m_tot_parts)); tot_partition_words= (m_tot_parts + 3) / 4; - engine_array= (handlerton **) my_alloca(m_tot_parts * sizeof(handlerton*)); - for (i= 0; i < m_tot_parts; i++) + if (!clone) { - engine_array[i]= ha_resolve_by_legacy_type(ha_thd(), - (enum legacy_db_type) - *(uchar *) ((file_buffer) + - 12 + i)); - if (!engine_array[i]) - goto err3; + engine_array= (handlerton **) my_alloca(m_tot_parts * sizeof(handlerton*)); + for (i= 0; i < m_tot_parts; i++) + { + engine_array[i]= ha_resolve_by_legacy_type(ha_thd(), + (enum legacy_db_type) + *(uchar *) ((file_buffer) + + 12 + i)); + if (!engine_array[i]) + goto err3; + } } address_tot_name_len= file_buffer + 12 + 4 * tot_partition_words; tot_name_words= (uint4korr(address_tot_name_len) + 3) / 4; @@ -2422,16 +2461,19 @@ bool ha_partition::get_from_handler_file(const char *name, MEM_ROOT *mem_root) m_file_buffer= file_buffer; // Will be freed in clear_handler_file() m_name_buffer_ptr= name_buffer_ptr; - if (!(m_engine_array= (plugin_ref*) - my_malloc(m_tot_parts * sizeof(plugin_ref), MYF(MY_WME)))) - goto err3; + if (!clone) + { + if (!(m_engine_array= (plugin_ref*) + my_malloc(m_tot_parts * sizeof(plugin_ref), MYF(MY_WME)))) + goto err3; - for (i= 0; i < m_tot_parts; i++) - m_engine_array[i]= ha_lock_engine(NULL, engine_array[i]); + for (i= 0; i < m_tot_parts; i++) + m_engine_array[i]= ha_lock_engine(NULL, engine_array[i]); - my_afree((gptr) engine_array); + my_afree((gptr) engine_array); + } - if (!m_file && create_handlers(mem_root)) + if (!clone && !m_file && create_handlers(mem_root)) { clear_handler_file(); DBUG_RETURN(TRUE); @@ -2439,7 +2481,8 @@ bool ha_partition::get_from_handler_file(const char *name, MEM_ROOT *mem_root) DBUG_RETURN(FALSE); err3: - my_afree((gptr) engine_array); + if (!clone) + my_afree((gptr) engine_array); err2: my_free(file_buffer, MYF(0)); err1: @@ -2491,13 +2534,13 @@ void ha_data_partition_destroy(void *ha_data) int ha_partition::open(const char *name, int mode, uint test_if_locked) { - char *name_buffer_ptr= m_name_buffer_ptr; + char *name_buffer_ptr; int error; uint alloc_len; handler **file; char name_buff[FN_REFLEN]; bool is_not_tmp_table= (table_share->tmp_table == NO_TMP_TABLE); - ulonglong check_table_flags= 0; + ulonglong check_table_flags; DBUG_ENTER("ha_partition::open"); DBUG_ASSERT(table->s == table_share); @@ -2505,8 +2548,9 @@ int ha_partition::open(const char *name, int mode, uint test_if_locked) m_mode= mode; m_open_test_lock= test_if_locked; m_part_field_array= m_part_info->full_part_field_array; - if (get_from_handler_file(name, &table->mem_root)) + if (get_from_handler_file(name, &table->mem_root, test(m_is_clone_of))) DBUG_RETURN(1); + name_buffer_ptr= m_name_buffer_ptr; m_start_key.length= 0; m_rec0= table->record[0]; m_rec_length= table_share->reclength; @@ -2542,8 +2586,9 @@ int ha_partition::open(const char *name, int mode, uint test_if_locked) DBUG_RETURN(1); bitmap_clear_all(&m_bulk_insert_started); /* Initialize the bitmap we use to determine what partitions are used */ - if (!is_clone) + if (!m_is_clone_of) { + DBUG_ASSERT(!m_clone_mem_root); if (bitmap_init(&(m_part_info->used_partitions), NULL, m_tot_parts, TRUE)) { bitmap_free(&m_bulk_insert_started); @@ -2552,32 +2597,70 @@ int ha_partition::open(const char *name, int mode, uint test_if_locked) bitmap_set_all(&(m_part_info->used_partitions)); } + if (m_is_clone_of) + { + uint i; + DBUG_ASSERT(m_clone_mem_root); + /* Allocate an array of handler pointers for the partitions handlers. */ + alloc_len= (m_tot_parts + 1) * sizeof(handler*); + if (!(m_file= (handler **) alloc_root(m_clone_mem_root, alloc_len))) + goto err_alloc; + memset(m_file, 0, alloc_len); + /* + Populate them by cloning the original partitions. This also opens them. + Note that file->ref is allocated too. + */ + file= m_is_clone_of->m_file; + for (i= 0; i < m_tot_parts; i++) + { + create_partition_name(name_buff, name, name_buffer_ptr, NORMAL_PART_NAME, + FALSE); + if (!(m_file[i]= file[i]->clone((const char*) name_buff, + m_clone_mem_root))) + { + error= HA_ERR_INITIALIZATION; + file= &m_file[i]; + goto err_handler; + } + name_buffer_ptr+= strlen(name_buffer_ptr) + 1; + } + } + else + { + file= m_file; + do + { + create_partition_name(name_buff, name, name_buffer_ptr, NORMAL_PART_NAME, + FALSE); + if ((error= (*file)->ha_open(table, (const char*) name_buff, mode, + test_if_locked))) + goto err_handler; + m_no_locks+= (*file)->lock_count(); + name_buffer_ptr+= strlen(name_buffer_ptr) + 1; + } while (*(++file)); + } + file= m_file; + ref_length= (*file)->ref_length; + check_table_flags= (((*file)->ha_table_flags() & + ~(PARTITION_DISABLED_TABLE_FLAGS)) | + (PARTITION_ENABLED_TABLE_FLAGS)); + file++; do { - create_partition_name(name_buff, name, name_buffer_ptr, NORMAL_PART_NAME, - FALSE); - if ((error= (*file)->ha_open(table, (const char*) name_buff, mode, - test_if_locked))) - goto err_handler; - m_no_locks+= (*file)->lock_count(); - name_buffer_ptr+= strlen(name_buffer_ptr) + 1; + DBUG_ASSERT(ref_length >= (*file)->ref_length); set_if_bigger(ref_length, ((*file)->ref_length)); /* Verify that all partitions have the same set of table flags. Mask all flags that partitioning enables/disables. */ - if (!check_table_flags) - { - check_table_flags= (((*file)->ha_table_flags() & - ~(PARTITION_DISABLED_TABLE_FLAGS)) | - (PARTITION_ENABLED_TABLE_FLAGS)); - } - else if (check_table_flags != (((*file)->ha_table_flags() & - ~(PARTITION_DISABLED_TABLE_FLAGS)) | - (PARTITION_ENABLED_TABLE_FLAGS))) + if (check_table_flags != (((*file)->ha_table_flags() & + ~(PARTITION_DISABLED_TABLE_FLAGS)) | + (PARTITION_ENABLED_TABLE_FLAGS))) { error= HA_ERR_INITIALIZATION; + /* set file to last handler, so all of them is closed */ + file = &m_file[m_tot_parts - 1]; goto err_handler; } } while (*(++file)); @@ -2589,6 +2672,7 @@ int ha_partition::open(const char *name, int mode, uint test_if_locked) */ ref_length+= PARTITION_BYTES_IN_POS; m_ref_length= ref_length; + /* Release buffer read from .par file. It will not be reused again after being opened once. @@ -2646,25 +2730,55 @@ err_handler: DEBUG_SYNC(ha_thd(), "partition_open_error"); while (file-- != m_file) (*file)->close(); +err_alloc: bitmap_free(&m_bulk_insert_started); - if (!is_clone) + if (!m_is_clone_of) bitmap_free(&(m_part_info->used_partitions)); DBUG_RETURN(error); } -handler *ha_partition::clone(MEM_ROOT *mem_root) + +/** + Clone the open and locked partitioning handler. + + @param mem_root MEM_ROOT to use. + + @return Pointer to the successfully created clone or NULL + + @details + This function creates a new ha_partition handler as a clone/copy. The + original (this) must already be opened and locked. The clone will use + the originals m_part_info. + It also allocates memory to ref + ref_dup. + In ha_partition::open() it will clone its original handlers partitions + which will allocate then om the correct MEM_ROOT and also open them. +*/ + +handler *ha_partition::clone(const char *name, MEM_ROOT *mem_root) { - handler *new_handler= get_new_handler(table->s, mem_root, - table->s->db_type()); - ((ha_partition*)new_handler)->m_part_info= m_part_info; - ((ha_partition*)new_handler)->is_clone= TRUE; - if (new_handler && !new_handler->ha_open(table, - table->s->normalized_path.str, - table->db_stat, - HA_OPEN_IGNORE_IF_LOCKED)) - return new_handler; - return NULL; + ha_partition *new_handler; + + DBUG_ENTER("ha_partition::clone"); + new_handler= new (mem_root) ha_partition(ht, table_share, m_part_info, + this, mem_root); + if (!new_handler) + DBUG_RETURN(NULL); + + /* + Allocate new_handler->ref here because otherwise ha_open will allocate it + on this->table->mem_root and we will not be able to reclaim that memory + when the clone handler object is destroyed. + */ + new_handler->ref= (uchar*) alloc_root(mem_root, ALIGN_SIZE(m_ref_length)*2); + if (!new_handler->ref) + DBUG_RETURN(NULL); + + if (new_handler->ha_open(table, name, + table->db_stat, HA_OPEN_IGNORE_IF_LOCKED)) + DBUG_RETURN(NULL); + + DBUG_RETURN((handler*) new_handler); } @@ -2695,7 +2809,7 @@ int ha_partition::close(void) DBUG_ASSERT(table->s == table_share); delete_queue(&m_queue); bitmap_free(&m_bulk_insert_started); - if (!is_clone) + if (!m_is_clone_of) bitmap_free(&(m_part_info->used_partitions)); file= m_file; diff --git a/sql/ha_partition.h b/sql/ha_partition.h index 76b91e160ca..a38d56af8ff 100644 --- a/sql/ha_partition.h +++ b/sql/ha_partition.h @@ -133,6 +133,13 @@ private: bool m_is_sub_partitioned; // Is subpartitioned bool m_ordered_scan_ongoing; + /* + If set, this object was created with ha_partition::clone and doesn't + "own" the m_part_info structure. + */ + ha_partition *m_is_clone_of; + MEM_ROOT *m_clone_mem_root; + /* We keep track if all underlying handlers are MyISAM since MyISAM has a great number of extra flags not needed by other handlers. @@ -169,11 +176,6 @@ private: PARTITION_SHARE *share; /* Shared lock info */ #endif - /* - TRUE <=> this object was created with ha_partition::clone and doesn't - "own" the m_part_info structure. - */ - bool is_clone; bool auto_increment_lock; /**< lock reading/updating auto_inc */ /** Flag to keep the auto_increment lock through out the statement. @@ -186,7 +188,7 @@ private: /** used for prediction of start_bulk_insert rows */ enum_monotonicity_info m_part_func_monotonicity_info; public: - handler *clone(MEM_ROOT *mem_root); + handler *clone(const char *name, MEM_ROOT *mem_root); virtual void set_part_info(partition_info *part_info) { m_part_info= part_info; @@ -205,6 +207,10 @@ public: */ ha_partition(handlerton *hton, TABLE_SHARE * table); ha_partition(handlerton *hton, partition_info * part_info); + ha_partition(handlerton *hton, TABLE_SHARE *share, + partition_info *part_info_arg, + ha_partition *clone_arg, + MEM_ROOT *clone_mem_root_arg); ~ha_partition(); /* A partition handler has no characteristics in itself. It only inherits @@ -275,7 +281,7 @@ private: And one method to read it in. */ bool create_handler_file(const char *name); - bool get_from_handler_file(const char *name, MEM_ROOT *mem_root); + bool get_from_handler_file(const char *name, MEM_ROOT *mem_root, bool clone); bool new_handlers_from_part_info(MEM_ROOT *mem_root); bool create_handlers(MEM_ROOT *mem_root); void clear_handler_file(); diff --git a/sql/handler.cc b/sql/handler.cc index 5968a78b587..8adb8e061a3 100644 --- a/sql/handler.cc +++ b/sql/handler.cc @@ -2037,9 +2037,9 @@ int ha_delete_table(THD *thd, handlerton *table_type, const char *path, /**************************************************************************** ** General handler functions ****************************************************************************/ -handler *handler::clone(MEM_ROOT *mem_root) +handler *handler::clone(const char *name, MEM_ROOT *mem_root) { - handler *new_handler= get_new_handler(table->s, mem_root, table->s->db_type()); + handler *new_handler= get_new_handler(table->s, mem_root, ht); /* Allocate handler->ref here because otherwise ha_open will allocate it on this->table->mem_root and we will not be able to reclaim that memory @@ -2048,7 +2048,7 @@ handler *handler::clone(MEM_ROOT *mem_root) if (!(new_handler->ref= (uchar*) alloc_root(mem_root, ALIGN_SIZE(ref_length)*2))) return NULL; if (new_handler && !new_handler->ha_open(table, - table->s->normalized_path.str, + name, table->db_stat, HA_OPEN_IGNORE_IF_LOCKED)) return new_handler; diff --git a/sql/handler.h b/sql/handler.h index dabc179079a..3de901dec62 100644 --- a/sql/handler.h +++ b/sql/handler.h @@ -1166,7 +1166,7 @@ public: DBUG_ASSERT(locked == FALSE); /* TODO: DBUG_ASSERT(inited == NONE); */ } - virtual handler *clone(MEM_ROOT *mem_root); + virtual handler *clone(const char *name, MEM_ROOT *mem_root); /** This is called after create to allow us to set up cached variables */ void init() { diff --git a/sql/opt_range.cc b/sql/opt_range.cc index 9edd4f58f04..fd71166dc23 100644 --- a/sql/opt_range.cc +++ b/sql/opt_range.cc @@ -1335,7 +1335,7 @@ int QUICK_RANGE_SELECT::init_ror_merged_scan(bool reuse_handler) } thd= head->in_use; - if (!(file= head->file->clone(thd->mem_root))) + if (!(file= head->file->clone(head->s->normalized_path.str, thd->mem_root))) { /* Manually set the error flag. Note: there seems to be quite a few diff --git a/storage/heap/ha_heap.cc b/storage/heap/ha_heap.cc index fb7c13e4e41..9f29dee2030 100644 --- a/storage/heap/ha_heap.cc +++ b/storage/heap/ha_heap.cc @@ -142,11 +142,11 @@ int ha_heap::close(void) DESCRIPTION Do same as default implementation but use file->s->name instead of table->s->path. This is needed by Windows where the clone() call sees - '/'-delimited path in table->s->path, while ha_peap::open() was called + '/'-delimited path in table->s->path, while ha_heap::open() was called with '\'-delimited path. */ -handler *ha_heap::clone(MEM_ROOT *mem_root) +handler *ha_heap::clone(const char *name, MEM_ROOT *mem_root) { handler *new_handler= get_new_handler(table->s, mem_root, table->s->db_type()); if (new_handler && !new_handler->ha_open(table, file->s->name, table->db_stat, diff --git a/storage/heap/ha_heap.h b/storage/heap/ha_heap.h index 22722129f4c..69751101645 100644 --- a/storage/heap/ha_heap.h +++ b/storage/heap/ha_heap.h @@ -34,7 +34,7 @@ class ha_heap: public handler public: ha_heap(handlerton *hton, TABLE_SHARE *table); ~ha_heap() {} - handler *clone(MEM_ROOT *mem_root); + handler *clone(const char *name, MEM_ROOT *mem_root); const char *table_type() const { return (table->in_use->variables.sql_mode & MODE_MYSQL323) ? diff --git a/storage/myisam/ha_myisam.cc b/storage/myisam/ha_myisam.cc index 2650cc850a8..e5b657a4630 100644 --- a/storage/myisam/ha_myisam.cc +++ b/storage/myisam/ha_myisam.cc @@ -552,9 +552,10 @@ ha_myisam::ha_myisam(handlerton *hton, TABLE_SHARE *table_arg) can_enable_indexes(1) {} -handler *ha_myisam::clone(MEM_ROOT *mem_root) +handler *ha_myisam::clone(const char *name, MEM_ROOT *mem_root) { - ha_myisam *new_handler= static_cast (handler::clone(mem_root)); + ha_myisam *new_handler= static_cast (handler::clone(name, + mem_root)); if (new_handler) new_handler->file->state= file->state; return new_handler; diff --git a/storage/myisam/ha_myisam.h b/storage/myisam/ha_myisam.h index 55a5eac92de..54801bfd0b8 100644 --- a/storage/myisam/ha_myisam.h +++ b/storage/myisam/ha_myisam.h @@ -44,7 +44,7 @@ class ha_myisam: public handler public: ha_myisam(handlerton *hton, TABLE_SHARE *table_arg); ~ha_myisam() {} - handler *clone(MEM_ROOT *mem_root); + handler *clone(const char *name, MEM_ROOT *mem_root); const char *table_type() const { return "MyISAM"; } const char *index_type(uint key_number); const char **bas_ext() const; diff --git a/storage/myisammrg/ha_myisammrg.cc b/storage/myisammrg/ha_myisammrg.cc index 4c8d45d1fe1..3beabd83512 100644 --- a/storage/myisammrg/ha_myisammrg.cc +++ b/storage/myisammrg/ha_myisammrg.cc @@ -459,8 +459,7 @@ int ha_myisammrg::open(const char *name, int mode __attribute__((unused)), problem because all locking is handled by the original MERGE table from which this is cloned of. */ - if (!(file= myrg_open(table->s->normalized_path.str, table->db_stat, - HA_OPEN_IGNORE_IF_LOCKED))) + if (!(file= myrg_open(name, table->db_stat, HA_OPEN_IGNORE_IF_LOCKED))) { DBUG_PRINT("error", ("my_errno %d", my_errno)); DBUG_RETURN(my_errno ? my_errno : -1); @@ -484,7 +483,7 @@ int ha_myisammrg::open(const char *name, int mode __attribute__((unused)), @return A cloned handler instance. */ -handler *ha_myisammrg::clone(MEM_ROOT *mem_root) +handler *ha_myisammrg::clone(const char *name, MEM_ROOT *mem_root) { MYRG_TABLE *u_table,*newu_table; ha_myisammrg *new_handler= @@ -505,8 +504,8 @@ handler *ha_myisammrg::clone(MEM_ROOT *mem_root) return NULL; } - if (new_handler->ha_open(table, table->s->normalized_path.str, table->db_stat, - HA_OPEN_IGNORE_IF_LOCKED)) + if (new_handler->ha_open(table, name, table->db_stat, + HA_OPEN_IGNORE_IF_LOCKED)) { delete new_handler; return NULL; diff --git a/storage/myisammrg/ha_myisammrg.h b/storage/myisammrg/ha_myisammrg.h index 790aa15e90a..a1272c633a1 100644 --- a/storage/myisammrg/ha_myisammrg.h +++ b/storage/myisammrg/ha_myisammrg.h @@ -62,7 +62,7 @@ class ha_myisammrg: public handler int open(const char *name, int mode, uint test_if_locked); int attach_children(void); int detach_children(void); - virtual handler *clone(MEM_ROOT *mem_root); + virtual handler *clone(const char *name, MEM_ROOT *mem_root); int close(void); int write_row(uchar * buf); int update_row(const uchar * old_data, uchar * new_data); From f1b638d33cdf95b70fa925cce304864c96fdf7ee Mon Sep 17 00:00:00 2001 From: Sven Sandberg Date: Fri, 25 Mar 2011 15:16:13 +0100 Subject: [PATCH 154/202] BUG#11766427, BUG#59539: Filter by server id in mysqlbinlog fails Problem: mysqlbinlog --server-id may filter out Format_description_log_events. If mysqlbinlog does not process the Format_description_log_event, then mysqlbinlog cannot read the rest of the binary log correctly. This can have the effect that mysqlbinlog crashes, generates an error, or generates output that causes mysqld to crash, generate an error, or corrupt data. Fix: Never filter out Format_description_log_events. Also, never filter out Rotate_log_events. client/mysqlbinlog.cc: Process Format_description_log_events even when the server_id does not match the number given by --server-id. mysql-test/t/mysqlbinlog.test: Add test case. --- client/mysqlbinlog.cc | 14 +++++++++++--- mysql-test/r/mysqlbinlog.result | 12 ++++++++++++ mysql-test/t/mysqlbinlog.test | 20 ++++++++++++++++++++ 3 files changed, 43 insertions(+), 3 deletions(-) diff --git a/client/mysqlbinlog.cc b/client/mysqlbinlog.cc index dec3f142798..30a8bddc17c 100644 --- a/client/mysqlbinlog.cc +++ b/client/mysqlbinlog.cc @@ -705,10 +705,18 @@ Exit_status process_event(PRINT_EVENT_INFO *print_event_info, Log_event *ev, */ start_datetime= 0; offset= 0; // print everything and protect against cycling rec_count + /* + Skip events according to the --server-id flag. However, don't + skip format_description or rotate events, because they they + are really "global" events that are relevant for the entire + binlog, even if they have a server_id. Also, we have to read + the format_description event so that we can parse subsequent + events. + */ + if (ev_type != ROTATE_EVENT && + server_id && (server_id != ev->server_id)) + goto end; } - if (server_id && (server_id != ev->server_id)) - /* skip just this event, continue processing the log. */ - goto end; if (((my_time_t)(ev->when) >= stop_datetime) || (pos >= stop_position_mot)) { diff --git a/mysql-test/r/mysqlbinlog.result b/mysql-test/r/mysqlbinlog.result index 1f2e1ed67e0..45068ddfaec 100644 --- a/mysql-test/r/mysqlbinlog.result +++ b/mysql-test/r/mysqlbinlog.result @@ -658,3 +658,15 @@ master-bin.000002 # Query # # CREATE DATABASE test1 master-bin.000002 # Query # # use `test1`; CREATE TABLE t1(id int) master-bin.000002 # Query # # use `test1`; DROP TABLE t1 master-bin.000002 # Query # # DROP DATABASE test1 +RESET MASTER; +USE test; +CREATE TABLE t1 (a INT); +SET GLOBAL SERVER_ID = 2; +DROP TABLE t1; +FLUSH LOGS; +SHOW TABLES IN test; +Tables_in_test +t1 +SHOW TABLES IN test; +Tables_in_test +SET GLOBAL SERVER_ID = 1; diff --git a/mysql-test/t/mysqlbinlog.test b/mysql-test/t/mysqlbinlog.test index d5dd3052269..98ee18b554e 100644 --- a/mysql-test/t/mysqlbinlog.test +++ b/mysql-test/t/mysqlbinlog.test @@ -501,3 +501,23 @@ exec $MYSQL_BINLOG $MYSQLD_DATADIR/$master_binlog | $MYSQL test 2>&1; let $binlog_file= query_get_value(SHOW MASTER STATUS, File, 1); source include/show_binlog_events.inc; +# +# BUG#11766427 BUG#59530: Filter by server id in mysqlbinlog fails +# This test checks that the format description log event is not +# filtered out by the --server-id option. +# +RESET MASTER; +USE test; +CREATE TABLE t1 (a INT); +--let $old_server_id= `SELECT @@GLOBAL.SERVER_ID` +SET GLOBAL SERVER_ID = 2; +DROP TABLE t1; +--let $master_binlog= query_get_value(SHOW MASTER STATUS, File, 1) +FLUSH LOGS; +# The following should only create t1, not drop it. +--exec $MYSQL_BINLOG --server-id=1 $MYSQLD_DATADIR/$master_binlog | $MYSQL +SHOW TABLES IN test; +# The following should only drop t1, not create it. +--exec $MYSQL_BINLOG --server-id=2 $MYSQLD_DATADIR/$master_binlog | $MYSQL +SHOW TABLES IN test; +eval SET GLOBAL SERVER_ID = $old_server_id; From d499851be03a2a20f7cb230d9b2d69e169aa81c8 Mon Sep 17 00:00:00 2001 From: Sergey Glukhov Date: Mon, 28 Mar 2011 11:53:18 +0400 Subject: [PATCH 155/202] Bug#11766112 59151:UNINITIALIZED VALUES IN EXTRACT_DATE_TIME WITH STR_TO_DATE(SPACE(..) ... Valgrind warining happens due to missing 'end of the string' check. The fix is to check if we reached the end of the string. mysql-test/r/func_time.result: test case mysql-test/t/func_time.test: test case sql/item_timefunc.cc: check if we reached the end of the string after leading spaces skipping. --- mysql-test/r/func_time.result | 6 ++++++ mysql-test/t/func_time.test | 6 ++++++ sql/item_timefunc.cc | 4 ++-- 3 files changed, 14 insertions(+), 2 deletions(-) diff --git a/mysql-test/r/func_time.result b/mysql-test/r/func_time.result index 0d4ce9414e5..f63860039d7 100644 --- a/mysql-test/r/func_time.result +++ b/mysql-test/r/func_time.result @@ -1375,4 +1375,10 @@ Warning 1292 Truncated incorrect time value: '' Warning 1292 Truncated incorrect time value: '' Warning 1292 Truncated incorrect time value: '' DROP TABLE t1; +# +# Bug#11766112 59151:UNINITIALIZED VALUES IN EXTRACT_DATE_TIME WITH STR_TO_DATE(SPACE(..) ... +# +SELECT STR_TO_DATE(SPACE(2),'1'); +STR_TO_DATE(SPACE(2),'1') +0000-00-00 End of 5.1 tests diff --git a/mysql-test/t/func_time.test b/mysql-test/t/func_time.test index f32110ef87c..c48351d33f2 100644 --- a/mysql-test/t/func_time.test +++ b/mysql-test/t/func_time.test @@ -881,4 +881,10 @@ INSERT INTO t1 VALUES (''),(''); SELECT COUNT(*) FROM t1 GROUP BY TIME_TO_SEC(a); DROP TABLE t1; +--echo # +--echo # Bug#11766112 59151:UNINITIALIZED VALUES IN EXTRACT_DATE_TIME WITH STR_TO_DATE(SPACE(..) ... +--echo # + +SELECT STR_TO_DATE(SPACE(2),'1'); + --echo End of 5.1 tests diff --git a/sql/item_timefunc.cc b/sql/item_timefunc.cc index 6335199b8de..71b2baf4fee 100644 --- a/sql/item_timefunc.cc +++ b/sql/item_timefunc.cc @@ -294,8 +294,8 @@ static bool extract_date_time(DATE_TIME_FORMAT *format, for (; ptr != end && val != val_end; ptr++) { /* Skip pre-space between each argument */ - while (val != val_end && my_isspace(cs, *val)) - val++; + if ((val+= cs->cset->scan(cs, val, val_end, MY_SEQ_SPACES)) >= val_end) + break; if (*ptr == '%' && ptr+1 != end) { From ff23f5360ee328bd6adb14436e68e080cfe1d110 Mon Sep 17 00:00:00 2001 From: Sergey Glukhov Date: Mon, 28 Mar 2011 12:28:30 +0400 Subject: [PATCH 156/202] Bug#11766424 59527: DECIMAL_BIN_SIZE: ASSERTION `SCALE >= 0 && PRECISION > 0 && SCALE <= PRE Assertion happens due to missing initialization of unsigned_flag for Item_func_set_user_var object. It leads to incorrect calculation of decimal field size. The fix is to add initialization of unsigned_flag. mysql-test/r/variables.result: test case mysql-test/t/variables.test: test case sql/item_func.cc: add initialization of unsigned_flag. --- mysql-test/r/variables.result | 16 ++++++++++++++++ mysql-test/t/variables.test | 13 +++++++++++++ sql/item_func.cc | 1 + 3 files changed, 30 insertions(+) diff --git a/mysql-test/r/variables.result b/mysql-test/r/variables.result index af3b76b09f3..f92e1dec4c9 100644 --- a/mysql-test/r/variables.result +++ b/mysql-test/r/variables.result @@ -1547,6 +1547,22 @@ Warning 1292 Truncated incorrect key_cache_block_size value: '0' select @@max_long_data_size; @@max_long_data_size 1048576 +# +# Bug#11766424 59527: DECIMAL_BIN_SIZE: ASSERTION `SCALE >= 0 && PRECISION > 0 && SCALE <= PRE +# +CREATE TABLE t1(f1 DECIMAL(1,1) UNSIGNED); +INSERT INTO t1 VALUES (0.2),(0.1); +SELECT 1 FROM t1 GROUP BY @a:= (SELECT ROUND(f1) FROM t1 WHERE @a=f1); +1 +1 +DROP TABLE t1; +CREATE TABLE t1 AS SELECT @a:= CAST(1 AS UNSIGNED) AS a; +SHOW CREATE TABLE t1; +Table Create Table +t1 CREATE TABLE `t1` ( + `a` int(1) unsigned NOT NULL DEFAULT '0' +) ENGINE=MyISAM DEFAULT CHARSET=latin1 +DROP TABLE t1; SET @@global.max_binlog_cache_size=DEFAULT; SET @@global.max_join_size=DEFAULT; SET @@global.key_buffer_size=@kbs; diff --git a/mysql-test/t/variables.test b/mysql-test/t/variables.test index 383bdfc79a9..8f111e7cf3b 100644 --- a/mysql-test/t/variables.test +++ b/mysql-test/t/variables.test @@ -1298,6 +1298,19 @@ SET @@global.key_cache_block_size=0; # select @@max_long_data_size; +--echo # +--echo # Bug#11766424 59527: DECIMAL_BIN_SIZE: ASSERTION `SCALE >= 0 && PRECISION > 0 && SCALE <= PRE +--echo # + +CREATE TABLE t1(f1 DECIMAL(1,1) UNSIGNED); +INSERT INTO t1 VALUES (0.2),(0.1); +SELECT 1 FROM t1 GROUP BY @a:= (SELECT ROUND(f1) FROM t1 WHERE @a=f1); +DROP TABLE t1; + +CREATE TABLE t1 AS SELECT @a:= CAST(1 AS UNSIGNED) AS a; +SHOW CREATE TABLE t1; +DROP TABLE t1; + # cleanup SET @@global.max_binlog_cache_size=DEFAULT; SET @@global.max_join_size=DEFAULT; diff --git a/sql/item_func.cc b/sql/item_func.cc index efae928a8b6..d4fd2c94e1d 100644 --- a/sql/item_func.cc +++ b/sql/item_func.cc @@ -3840,6 +3840,7 @@ Item_func_set_user_var::fix_length_and_dec() maybe_null=args[0]->maybe_null; max_length=args[0]->max_length; decimals=args[0]->decimals; + unsigned_flag= args[0]->unsigned_flag; collation.set(args[0]->collation.collation, DERIVATION_IMPLICIT); } From 08d598fb98e0f7e5c34f47c6510577a375d0fab2 Mon Sep 17 00:00:00 2001 From: Vasil Dimov Date: Mon, 28 Mar 2011 11:34:12 +0300 Subject: [PATCH 157/202] Store the '\0'-terminated query in row->trx_query This problem was introduced in marko.makela@oracle.com-20100514130815-ym7j7cfu88ro6km4 and is probably the reason for the following valgrind warning: from http://bugs.mysql.com/52691 , http://bugs.mysql.com/file.php?id=16880 : Version: '5.6.3-m5-valgrind-max-debug' socket: '/tmp/mysql.sock' port: 3306 Source distribution ==14947== Thread 18: ==14947== Conditional jump or move depends on uninitialised value(s) ==14947== at 0x4A06318: __GI_strlen (mc_replace_strmem.c:284) ==14947== by 0x9F3D7A: fill_innodb_trx_from_cache(trx_i_s_cache_struct*, THD*, TABLE*) (i_s.cc:591) ==14947== by 0x9F4D7D: trx_i_s_common_fill_table(THD*, TABLE_LIST*, Item*) (i_s.cc:1238) ==14947== by 0x7689F3: get_schema_tables_result(JOIN*, enum_schema_table_state) (sql_show.cc:6745) ==14947== by 0x715A75: JOIN::exec() (sql_select.cc:2861) ==14947== by 0x7185BD: mysql_select(THD*, Item***, TABLE_LIST*, unsigned int, List&, Item*, unsigned int, st_order*, st_order*, Item*, st_order*, unsigned long long, select_result*, st_select_lex_unit*, st_select_lex*) (sql_select.cc:3609) ==14947== by 0x70E823: handle_select(THD*, LEX*, select_result*, unsigned long) (sql_select.cc:319) ==14947== by 0x6F2305: execute_sqlcom_select(THD*, TABLE_LIST*) (sql_parse.cc:4557) ==14947== by 0x6EAED4: mysql_execute_command(THD*) (sql_parse.cc:2135) ==14947== by 0x6F44C9: mysql_parse(THD*, char*, unsigned int, Parser_state*) (sql_parse.cc:5597) ==14947== by 0x6E864B: dispatch_command(enum_server_command, THD*, char*, unsigned int) (sql_parse.cc:1093) ==14947== by 0x6E785E: do_command(THD*) (sql_parse.cc:815) ==14947== by 0x6C18DD: do_handle_one_connection(THD*) (sql_connect.cc:771) ==14947== by 0x6C146E: handle_one_connection (sql_connect.cc:707) ==14947== by 0x30E1807760: start_thread (pthread_create.c:301) ==14947== by 0x35EA670F: ??? ==14947== Uninitialised value was created by a heap allocation ==14947== at 0x4A0515D: malloc (vg_replace_malloc.c:195) ==14947== by 0xB4B948: mem_area_alloc (mem0pool.c:385) ==14947== by 0xB4A27C: mem_heap_create_block (mem0mem.c:333) ==14947== by 0xB4A530: mem_heap_add_block (mem0mem.c:446) ==14947== by 0xB0D2A4: mem_heap_alloc (mem0mem.ic:186) ==14947== by 0xB0D9C2: ha_storage_put_memlim (ha0storage.c:118) ==14947== by 0xA479D8: fill_trx_row (trx0i_s.c:521) ==14947== by 0xA490E9: fetch_data_into_cache (trx0i_s.c:1319) ==14947== by 0xA491BA: trx_i_s_possibly_fetch_data_into_cache (trx0i_s.c:1352) ==14947== by 0x9F4CE7: trx_i_s_common_fill_table(THD*, TABLE_LIST*, Item*) (i_s.cc:1221) ==14947== by 0x7689F3: get_schema_tables_result(JOIN*, enum_schema_table_state) (sql_show.cc:6745) ==14947== by 0x715A75: JOIN::exec() (sql_select.cc:2861) ==14947== by 0x7185BD: mysql_select(THD*, Item***, TABLE_LIST*, unsigned int, List&, Item*, unsigned int, st_order*, st_order*, Item*, st_order*, unsigned long long, select_result*, st_select_lex_unit*, st_select_lex*) (sql_select.cc:3609) ==14947== by 0x70E823: handle_select(THD*, LEX*, select_result*, unsigned long) (sql_select.cc:319) ==14947== by 0x6F2305: execute_sqlcom_select(THD*, TABLE_LIST*) (sql_parse.cc:4557) ==14947== by 0x6EAED4: mysql_execute_command(THD*) (sql_parse.cc:2135) ==14947== by 0x6F44C9: mysql_parse(THD*, char*, unsigned int, Parser_state*) (sql_parse.cc:5597) ==14947== by 0x6E864B: dispatch_command(enum_server_command, THD*, char*, unsigned int) (sql_parse.cc:1093) ==14947== by 0x6E785E: do_command(THD*) (sql_parse.cc:815) ==14947== by 0x6C18DD: do_handle_one_connection(THD*) (sql_connect.cc:771) ==14947== by 0x6C146E: handle_one_connection (sql_connect.cc:707) ==14947== by 0x30E1807760: start_thread (pthread_create.c:301) ==14947== by 0x35EA670F: ??? (gdb) bt #0 0x0000000004a06318 in _vgrZU_libcZdsoZa___GI_strlen (str=0x3026bfa0 "insert into `blobtest` set `data`='pkefxxpkalpabzgrczlxefkreqljeqbvzrcnhvhsjsfnvxzjsltfuincffigdkmhvvcmnseluzgbtedrfmxvnrdmzesbinjgwvharkpgjplrlnqudfidbqwgbykupycxzyikzqincnsjrxgncqzlgyqwjdbjulztgsffxpjgymsnntdibvklwqylmwhsmdskmllxuwafabdjnwlyofknwuixiyrgnplmerfdewgizkdhznitesfqepsqbbwkdepkmjoseyxjofmmjaqdipwopfrwidmhqbtovdslvayxcnpewzhppeetblccppniamezibuoinvlxkafpcmozawtplfpepxwlwhymsuraezcwvjqzwogsozodlsfzjiyrcaljjhqwdrcjawvelhefzzaexvcbyorlcyupqwgjuamiqpiputtndjwcsuyzdfhuxswuowhrzdvriwrxqmcqthvzzzvivbabbnhdbtcfdtgssvmirrcddnytnctcvqplwytxxzxelldhwahalzxvgynaiwjyezhxqhlsqudngekocfvlbqprxqhyhwbaomgqiwkpfguohuvlnhtrsszgacxhhzeppyqwfwabiqzgyzkperiidyunrykopysvlcxwhrcboetjltawdjergalsfvaxncmzoznryumrjmncvhvxqvqhhbznnifkguuiffmlrbmgwtzvnuwlaguixqadkupfhasbbxnwkrvsfhrqanfmvjtzfqodtutkjlxfcogtsjywrdgmzgszjtsmimaelsveayqrwviqwwefeziuaqsqpauxpnzhaxjtkdfvvodniwezskbxfxszyniyzkzxngcfwgjlyrlskmrzxqnptwlilsxybuguafxxkvryyjrnkhhcmxuusitaflaiuxjhyfnzkahlgmaszujqmfdhyppdnpweqanmvzgjfyzjolbmprhnuuxextcaxzicfvsuochprmlf"...) at mc_replace_strmem.c:284 #1 0x00000000009f3d7b in fill_innodb_trx_from_cache (cache=0x1462440, thd=0x2a495000, table=0x2a422500) at /home/sbester/build/bzr/mysql-trunk/storage/innobase/handler/i_s.cc:591 #2 0x00000000009f4d7e in trx_i_s_common_fill_table (thd=0x2a495000, tables=0x2a4c3ec0) at /home/sbester/build/bzr/mysql-trunk/storage/innobase/handler/i_s.cc:1238 #3 0x00000000007689f4 in get_schema_tables_result (join=0x30f90c40, executed_place=PROCESSED_BY_JOIN_EXEC) at /home/sbester/build/bzr/mysql-trunk/sql/sql_show.cc:6745 #4 0x0000000000715a76 in JOIN::exec (this=0x30f90c40) at /home/sbester/build/bzr/mysql-trunk/sql/sql_select.cc:2861 #5 0x00000000007185be in mysql_select (thd=0x2a495000, rref_pointer_array=0x2a497590, tables=0x2a4c3ec0, wild_num=1, fields=..., conds=0x0, og_num=0, order=0x0, group=0x0, having=0x0, proc_param=0x0, select_options=2684619520, result=0x30319720, unit=0x2a496d28, select_lex=0x2a497378) at /home/sbester/build/bzr/mysql-trunk/sql/sql_select.cc:3609 #6 0x000000000070e824 in handle_select (thd=0x2a495000, lex=0x2a496c78, result=0x30319720, setup_tables_done_option=0) at /home/sbester/build/bzr/mysql-trunk/sql/sql_select.cc:319 #7 0x00000000006f2306 in execute_sqlcom_select (thd=0x2a495000, all_tables=0x2a4c3ec0) at /home/sbester/build/bzr/mysql-trunk/sql/sql_parse.cc:4557 #8 0x00000000006eaed5 in mysql_execute_command (thd=0x2a495000) at /home/sbester/build/bzr/mysql-trunk/sql/sql_parse.cc:2135 #9 0x00000000006f44ca in mysql_parse (thd=0x2a495000, rawbuf=0x30d80060 "select * from innodb_trx", length=24, parser_state=0x35ea5540) at /home/sbester/build/bzr/mysql-trunk/sql/sql_parse.cc:5597 #10 0x00000000006e864c in dispatch_command (command=COM_QUERY, thd=0x2a495000, packet=0x30bb4e31 "select * from innodb_trx", packet_length=24) at /home/sbester/build/bzr/mysql-trunk/sql/sql_parse.cc:1093 #11 0x00000000006e785f in do_command (thd=0x2a495000) at /home/sbester/build/bzr/mysql-trunk/sql/sql_parse.cc:815 #12 0x00000000006c18de in do_handle_one_connection (thd_arg=0x2a495000) at /home/sbester/build/bzr/mysql-trunk/sql/sql_connect.cc:771 #13 0x00000000006c146f in handle_one_connection (arg=0x2a495000) at /home/sbester/build/bzr/mysql-trunk/sql/sql_connect.cc:707 #14 0x00000030e1807761 in start_thread (arg=0x35ea6710) at pthread_create.c:301 #15 0x00000030e14e14ed in clone () at ../sysdeps/unix/sysv/linux/x86_64/clone.S:115 (gdb) frame 1 #1 0x00000000009f3d7b in fill_innodb_trx_from_cache (cache=0x1462440, thd=0x2a495000, table=0x2a422500) at /home/sbester/build/bzr/mysql-trunk/storage/innobase/handler/i_s.cc:591 591 row->trx_query_cs); (gdb) list 586 if (row->trx_query) { 587 /* store will do appropriate character set 588 conversion check */ 589 fields[IDX_TRX_QUERY]->store( 590 row->trx_query, strlen(row->trx_query), 591 row->trx_query_cs); 592 fields[IDX_TRX_QUERY]->set_notnull(); 593 } else { 594 fields[IDX_TRX_QUERY]->set_null(); 595 } --- storage/innodb_plugin/trx/trx0i_s.c | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) diff --git a/storage/innodb_plugin/trx/trx0i_s.c b/storage/innodb_plugin/trx/trx0i_s.c index 267e91db22e..53f4dcb0bef 100644 --- a/storage/innodb_plugin/trx/trx0i_s.c +++ b/storage/innodb_plugin/trx/trx0i_s.c @@ -508,7 +508,7 @@ fill_trx_row( query[stmt_len] = '\0'; row->trx_query = ha_storage_put_memlim( - cache->storage, stmt, stmt_len + 1, + cache->storage, query, stmt_len + 1, MAX_ALLOWED_FOR_STORAGE(cache)); row->trx_query_cs = innobase_get_charset(trx->mysql_thd); From a88faf2a4af5f60722647a8e01de6aac20305bb7 Mon Sep 17 00:00:00 2001 From: Sergey Glukhov Date: Mon, 28 Mar 2011 12:35:50 +0400 Subject: [PATCH 158/202] Bug#11764994 57900: CREATE TABLE .. SELECT ASSERTS SCALE >= 0 && PRECISION > 0 && SCALE <= PR Assert fails due to overflow which happens in Item_func_int_val::fix_num_length_and_dec() as geometry functions have max_length value equal to max_field_size(4294967295U). The fix is to skip max_length calculation for some boundary cases. mysql-test/r/func_math.result: test case mysql-test/t/func_math.test: test case sql/item_func.cc: skip max_length calculation if argument max_length is near max_field_size. --- mysql-test/r/func_math.result | 7 +++++++ mysql-test/t/func_math.test | 9 +++++++++ sql/item_func.cc | 7 ++++--- 3 files changed, 20 insertions(+), 3 deletions(-) diff --git a/mysql-test/r/func_math.result b/mysql-test/r/func_math.result index 3a626084c9e..ad0b872145b 100644 --- a/mysql-test/r/func_math.result +++ b/mysql-test/r/func_math.result @@ -511,4 +511,11 @@ t1 CREATE TABLE `t1` ( `C` varchar(23) DEFAULT NULL ) ENGINE=MyISAM DEFAULT CHARSET=latin1 DROP TABLE t1; +# +# Bug#11764994 57900: CREATE TABLE .. SELECT ASSERTS SCALE >= 0 && PRECISION > 0 && SCALE <= PR +# +CREATE TABLE t1 SELECT CEIL(LINESTRINGFROMWKB(1) DIV NULL); +DROP TABLE t1; +CREATE TABLE t1 SELECT FLOOR(LINESTRINGFROMWKB(1) DIV NULL); +DROP TABLE t1; End of 5.1 tests diff --git a/mysql-test/t/func_math.test b/mysql-test/t/func_math.test index c8ea11c7490..64b6a3a4ea6 100644 --- a/mysql-test/t/func_math.test +++ b/mysql-test/t/func_math.test @@ -324,4 +324,13 @@ CREATE TABLE t1 SELECT CAST((CASE(('')) WHEN (CONVERT(1, CHAR(1))) THEN (('' / 1 SHOW CREATE TABLE t1; DROP TABLE t1; +--echo # +--echo # Bug#11764994 57900: CREATE TABLE .. SELECT ASSERTS SCALE >= 0 && PRECISION > 0 && SCALE <= PR +--echo # + +CREATE TABLE t1 SELECT CEIL(LINESTRINGFROMWKB(1) DIV NULL); +DROP TABLE t1; +CREATE TABLE t1 SELECT FLOOR(LINESTRINGFROMWKB(1) DIV NULL); +DROP TABLE t1; + --echo End of 5.1 tests diff --git a/sql/item_func.cc b/sql/item_func.cc index d4fd2c94e1d..79fa37bd372 100644 --- a/sql/item_func.cc +++ b/sql/item_func.cc @@ -1803,9 +1803,10 @@ void Item_func_integer::fix_length_and_dec() void Item_func_int_val::fix_num_length_and_dec() { - max_length= args[0]->max_length - (args[0]->decimals ? - args[0]->decimals + 1 : - 0) + 2; + ulonglong tmp_max_length= (ulonglong ) args[0]->max_length - + (args[0]->decimals ? args[0]->decimals + 1 : 0) + 2; + max_length= tmp_max_length > (ulonglong) max_field_size ? + max_field_size : (uint32) tmp_max_length; uint tmp= float_length(decimals); set_if_smaller(max_length,tmp); decimals= 0; From 9ff72a1acfffe95cd5e6d9e06c61c5ee9b0000e0 Mon Sep 17 00:00:00 2001 From: Magne Mahre Date: Mon, 28 Mar 2011 10:47:30 +0200 Subject: [PATCH 159/202] Bug#11900714 REMOVE LGPL LICENSED FILES IN MYSQL 5.1 The LGPL license is used in some legacy code, and to adhere to current licensing polity, we remove those files that are no longer used, and reorganize the remaining LGPL code so it will be GPL licensed from now on. Note: This patch only removed LGPL licensed files in MySQL 5.1, and is the second of a set of patches to remove LGPL from all trees. (See Bug# 11840513 for details) --- extra/perror.c | 31 +++++- include/Makefile.am | 2 +- include/heap.h | 2 +- include/my_compare.h | 89 +++++++++++++++ include/my_global.h | 2 +- include/my_handler.h | 128 ---------------------- include/myisam.h | 24 +++- libmysql/CMakeLists.txt | 2 +- libmysql/Makefile.shared | 2 +- mysys/CMakeLists.txt | 4 +- mysys/Makefile.am | 6 +- mysys/{my_handler.c => my_compare.c} | 157 +++------------------------ mysys/my_gethostbyname.c | 113 ------------------- mysys/my_net.c | 89 +++++++++++++++ mysys/my_port.c | 40 ------- sql/field.h | 2 + sql/handler.h | 1 - storage/myisam/ft_stopwords.c | 2 +- storage/myisam/mi_check.c | 87 +++++++++++++++ storage/myisam/mi_test1.c | 1 + storage/myisam/mi_write.c | 1 + storage/myisam/myisamdef.h | 2 + storage/myisam/sp_test.c | 1 + 23 files changed, 350 insertions(+), 438 deletions(-) create mode 100644 include/my_compare.h delete mode 100644 include/my_handler.h rename mysys/{my_handler.c => my_compare.c} (78%) delete mode 100644 mysys/my_gethostbyname.c delete mode 100644 mysys/my_port.c diff --git a/extra/perror.c b/extra/perror.c index c32ad2bc791..5162f5e03dc 100644 --- a/extra/perror.c +++ b/extra/perror.c @@ -32,7 +32,6 @@ static my_bool verbose, print_all_codes; #include "../include/my_base.h" #include "../mysys/my_handler_errors.h" -#include "../include/my_handler.h" #ifdef WITH_NDBCLUSTER_STORAGE_ENGINE static my_bool ndb_code; @@ -185,6 +184,36 @@ static const char *get_ha_error_msg(int code) } +/* + Register handler error messages for usage with my_error() + + NOTES + This is safe to call multiple times as my_error_register() + will ignore calls to register already registered error numbers. +*/ +void my_handler_error_register(void) +{ + /* + If you got compilation error here about compile_time_assert array, check + that every HA_ERR_xxx constant has a corresponding error message in + handler_error_messages[] list (check mysys/ma_handler_errors.h and + include/my_base.h). + */ + compile_time_assert(HA_ERR_FIRST + array_elements(handler_error_messages) == + HA_ERR_LAST + 1); + my_error_register(handler_error_messages, HA_ERR_FIRST, + HA_ERR_FIRST+ array_elements(handler_error_messages)-1); +} + + +void my_handler_error_unregister(void) +{ + my_error_unregister(HA_ERR_FIRST, + HA_ERR_FIRST+ array_elements(handler_error_messages)-1); +} + + + #if defined(__WIN__) static my_bool print_win_error_msg(DWORD error, my_bool verbose) { diff --git a/include/Makefile.am b/include/Makefile.am index a3dbc386857..2e29806e0df 100644 --- a/include/Makefile.am +++ b/include/Makefile.am @@ -37,7 +37,7 @@ noinst_HEADERS = config-win.h config-netware.h my_bit.h \ my_nosys.h my_alarm.h queues.h rijndael.h sha1.h \ my_aes.h my_tree.h my_trie.h hash.h thr_alarm.h \ thr_lock.h t_ctype.h violite.h my_md5.h base64.h \ - my_handler.h my_time.h my_vle.h my_user.h \ + my_compare.h my_time.h my_vle.h my_user.h \ my_libwrap.h my_stacktrace.h EXTRA_DIST = mysql.h.pp mysql/plugin.h.pp diff --git a/include/heap.h b/include/heap.h index 4a1c7d419ed..126ce4fa12d 100644 --- a/include/heap.h +++ b/include/heap.h @@ -30,7 +30,7 @@ extern "C" { #include #endif -#include "my_handler.h" +#include "my_compare.h" #include "my_tree.h" /* defines used by heap-funktions */ diff --git a/include/my_compare.h b/include/my_compare.h new file mode 100644 index 00000000000..dedae5c8052 --- /dev/null +++ b/include/my_compare.h @@ -0,0 +1,89 @@ +/* Copyright (c) 2011, Oracle and/or its affiliates. All rights reserved. + + This program is free software; you can redistribute it and/or modify + it under the terms of the GNU General Public License as published by + the Free Software Foundation; version 2 of the License. + + This program is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the + GNU General Public License for more details. + + You should have received a copy of the GNU General Public License + along with this program; if not, write to the Free Software + Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA */ + +#ifndef _my_compare_h +#define _my_compare_h + +#include "my_base.h" +#include "m_ctype.h" +#include "myisampack.h" + +typedef struct st_HA_KEYSEG /* Key-portion */ +{ + CHARSET_INFO *charset; + uint32 start; /* Start of key in record */ + uint32 null_pos; /* position to NULL indicator */ + uint16 bit_pos; /* Position to bit part */ + uint16 flag; + uint16 length; /* Keylength */ + uint8 type; /* Type of key (for sort) */ + uint8 language; + uint8 null_bit; /* bitmask to test for NULL */ + uint8 bit_start,bit_end; /* if bit field */ + uint8 bit_length; /* Length of bit part */ +} HA_KEYSEG; + +#define get_key_length(length,key) \ +{ if ((uchar) *(key) != 255) \ + length= (uint) (uchar) *((key)++); \ + else \ + { length=mi_uint2korr((key)+1); (key)+=3; } \ +} + +#define get_key_length_rdonly(length,key) \ +{ if ((uchar) *(key) != 255) \ + length= ((uint) (uchar) *((key))); \ + else \ + { length=mi_uint2korr((key)+1); } \ +} + +#define get_key_pack_length(length,length_pack,key) \ +{ if ((uchar) *(key) != 255) \ + { length= (uint) (uchar) *((key)++); length_pack=1; }\ + else \ + { length=mi_uint2korr((key)+1); (key)+=3; length_pack=3; } \ +} + +#define store_key_length_inc(key,length) \ +{ if ((length) < 255) \ + { *(key)++=(length); } \ + else \ + { *(key)=255; mi_int2store((key)+1,(length)); (key)+=3; } \ +} + +#define get_rec_bits(bit_ptr, bit_ofs, bit_len) \ + (((((uint16) (bit_ptr)[1] << 8) | (uint16) (bit_ptr)[0]) >> (bit_ofs)) & \ + ((1 << (bit_len)) - 1)) + +#define set_rec_bits(bits, bit_ptr, bit_ofs, bit_len) \ +{ \ + (bit_ptr)[0]= ((bit_ptr)[0] & ~(((1 << (bit_len)) - 1) << (bit_ofs))) | \ + ((bits) << (bit_ofs)); \ + if ((bit_ofs) + (bit_len) > 8) \ + (bit_ptr)[1]= ((bit_ptr)[1] & ~((1 << ((bit_len) - 8 + (bit_ofs))) - 1)) | \ + ((bits) >> (8 - (bit_ofs))); \ +} + +#define clr_rec_bits(bit_ptr, bit_ofs, bit_len) \ + set_rec_bits(0, bit_ptr, bit_ofs, bit_len) + +extern int ha_compare_text(CHARSET_INFO *, uchar *, uint, uchar *, uint , + my_bool, my_bool); +extern int ha_key_cmp(register HA_KEYSEG *keyseg, register uchar *a, + register uchar *b, uint key_length, uint nextflag, + uint *diff_pos); + + +#endif /* _my_compare_h */ diff --git a/include/my_global.h b/include/my_global.h index ac5d72249f2..005180dae3b 100644 --- a/include/my_global.h +++ b/include/my_global.h @@ -359,7 +359,7 @@ C_MODE_END #define ulonglong2double(A) my_ulonglong2double(A) #define my_off_t2double(A) my_ulonglong2double(A) C_MODE_START -double my_ulonglong2double(unsigned long long A); +inline double my_ulonglong2double(unsigned long long A) { return (double) A; } C_MODE_END #endif /* _AIX */ diff --git a/include/my_handler.h b/include/my_handler.h deleted file mode 100644 index 7dfdb345a89..00000000000 --- a/include/my_handler.h +++ /dev/null @@ -1,128 +0,0 @@ -/* Copyright (C) 2002-2006 MySQL AB - - This program is free software; you can redistribute it and/or - modify it under the terms of the GNU Library General Public - License as published by the Free Software Foundation; version 2 - of the License. - - This program is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Library General Public License for more details. - - You should have received a copy of the GNU Library General Public - License along with this library; if not, write to the Free - Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, - MA 02111-1307, USA */ - -#ifndef _my_handler_h -#define _my_handler_h - -#include "myisampack.h" -#ifdef __cplusplus -extern "C" { -#endif - -/* - There is a hard limit for the maximum number of keys as there are only - 8 bits in the index file header for the number of keys in a table. - This means that 0..255 keys can exist for a table. The idea of - HA_MAX_POSSIBLE_KEY is to ensure that one can use myisamchk & tools on - a MyISAM table for which one has more keys than MyISAM is normally - compiled for. If you don't have this, you will get a core dump when - running myisamchk compiled for 128 keys on a table with 255 keys. -*/ - -#define HA_MAX_POSSIBLE_KEY 255 /* For myisamchk */ -/* - The following defines can be increased if necessary. - But beware the dependency of MI_MAX_POSSIBLE_KEY_BUFF and HA_MAX_KEY_LENGTH. -*/ - -#define HA_MAX_KEY_LENGTH 1000 /* Max length in bytes */ -#define HA_MAX_KEY_SEG 16 /* Max segments for key */ - -#define HA_MAX_POSSIBLE_KEY_BUFF (HA_MAX_KEY_LENGTH + 24+ 6+6) -#define HA_MAX_KEY_BUFF (HA_MAX_KEY_LENGTH+HA_MAX_KEY_SEG*6+8+8) - -typedef struct st_HA_KEYSEG /* Key-portion */ -{ - CHARSET_INFO *charset; - uint32 start; /* Start of key in record */ - uint32 null_pos; /* position to NULL indicator */ - uint16 bit_pos; /* Position to bit part */ - uint16 flag; - uint16 length; /* Keylength */ - uint8 type; /* Type of key (for sort) */ - uint8 language; - uint8 null_bit; /* bitmask to test for NULL */ - uint8 bit_start,bit_end; /* if bit field */ - uint8 bit_length; /* Length of bit part */ -} HA_KEYSEG; - -#define get_key_length(length,key) \ -{ if (*(uchar*) (key) != 255) \ - length= (uint) *(uchar*) ((key)++); \ - else \ - { length= mi_uint2korr((key)+1); (key)+=3; } \ -} - -#define get_key_length_rdonly(length,key) \ -{ if (*(uchar*) (key) != 255) \ - length= ((uint) *(uchar*) ((key))); \ - else \ - { length= mi_uint2korr((key)+1); } \ -} - -#define get_key_pack_length(length,length_pack,key) \ -{ if (*(uchar*) (key) != 255) \ - { length= (uint) *(uchar*) ((key)++); length_pack= 1; }\ - else \ - { length=mi_uint2korr((key)+1); (key)+= 3; length_pack= 3; } \ -} - -#define store_key_length_inc(key,length) \ -{ if ((length) < 255) \ - { *(key)++= (length); } \ - else \ - { *(key)=255; mi_int2store((key)+1,(length)); (key)+=3; } \ -} - -#define size_to_store_key_length(length) ((length) < 255 ? 1 : 3) - -#define get_rec_bits(bit_ptr, bit_ofs, bit_len) \ - (((((uint16) (bit_ptr)[1] << 8) | (uint16) (bit_ptr)[0]) >> (bit_ofs)) & \ - ((1 << (bit_len)) - 1)) - -#define set_rec_bits(bits, bit_ptr, bit_ofs, bit_len) \ -{ \ - (bit_ptr)[0]= ((bit_ptr)[0] & ~(((1 << (bit_len)) - 1) << (bit_ofs))) | \ - ((bits) << (bit_ofs)); \ - if ((bit_ofs) + (bit_len) > 8) \ - (bit_ptr)[1]= ((bit_ptr)[1] & ~((1 << ((bit_len) - 8 + (bit_ofs))) - 1)) | \ - ((bits) >> (8 - (bit_ofs))); \ -} - -#define clr_rec_bits(bit_ptr, bit_ofs, bit_len) \ - set_rec_bits(0, bit_ptr, bit_ofs, bit_len) - -extern int ha_compare_text(CHARSET_INFO *, uchar *, uint, uchar *, uint , - my_bool, my_bool); -extern int ha_key_cmp(register HA_KEYSEG *keyseg, register uchar *a, - register uchar *b, uint key_length, uint nextflag, - uint *diff_pos); - -extern HA_KEYSEG *ha_find_null(HA_KEYSEG *keyseg, uchar *a); -extern void my_handler_error_register(void); -extern void my_handler_error_unregister(void); -/* - Inside an in-memory data record, memory pointers to pieces of the - record (like BLOBs) are stored in their native byte order and in - this amount of bytes. -*/ -#define portable_sizeof_char_ptr 8 -#ifdef __cplusplus -} -#endif - -#endif /* _my_handler_h */ diff --git a/include/myisam.h b/include/myisam.h index e502daa2f17..09f54ef0019 100644 --- a/include/myisam.h +++ b/include/myisam.h @@ -30,8 +30,30 @@ extern "C" { #ifndef _keycache_h #include "keycache.h" #endif -#include "my_handler.h" #include +#include "my_compare.h" + +/* + There is a hard limit for the maximum number of keys as there are only + 8 bits in the index file header for the number of keys in a table. + This means that 0..255 keys can exist for a table. The idea of + HA_MAX_POSSIBLE_KEY is to ensure that one can use myisamchk & tools on + a MyISAM table for which one has more keys than MyISAM is normally + compiled for. If you don't have this, you will get a core dump when + running myisamchk compiled for 128 keys on a table with 255 keys. +*/ + +#define HA_MAX_POSSIBLE_KEY 255 /* For myisamchk */ +/* + The following defines can be increased if necessary. + But beware the dependency of MI_MAX_POSSIBLE_KEY_BUFF and HA_MAX_KEY_LENGTH. +*/ + +#define HA_MAX_KEY_LENGTH 1000 /* Max length in bytes */ +#define HA_MAX_KEY_SEG 16 /* Max segments for key */ + +#define HA_MAX_POSSIBLE_KEY_BUFF (HA_MAX_KEY_LENGTH + 24+ 6+6) +#define HA_MAX_KEY_BUFF (HA_MAX_KEY_LENGTH+HA_MAX_KEY_SEG*6+8+8) /* Limit max keys according to HA_MAX_POSSIBLE_KEY diff --git a/libmysql/CMakeLists.txt b/libmysql/CMakeLists.txt index 55138e4aa06..129b923dd27 100755 --- a/libmysql/CMakeLists.txt +++ b/libmysql/CMakeLists.txt @@ -82,7 +82,7 @@ SET(CLIENT_SOURCES ../mysys/array.c ../strings/bchange.c ../strings/bmove.c ../mysys/mf_wcomp.c ../mysys/mulalloc.c ../mysys/my_access.c ../mysys/my_alloc.c ../mysys/my_chsize.c ../mysys/my_compress.c ../mysys/my_create.c ../mysys/my_delete.c ../mysys/my_div.c ../mysys/my_error.c ../mysys/my_file.c - ../mysys/my_fopen.c ../mysys/my_fstream.c ../mysys/my_gethostbyname.c + ../mysys/my_fopen.c ../mysys/my_fstream.c ../mysys/my_getopt.c ../mysys/my_getwd.c ../mysys/my_init.c ../mysys/my_lib.c ../mysys/my_malloc.c ../mysys/my_messnc.c ../mysys/my_net.c ../mysys/my_once.c ../mysys/my_open.c ../mysys/my_pread.c ../mysys/my_pthread.c ../mysys/my_read.c diff --git a/libmysql/Makefile.shared b/libmysql/Makefile.shared index a27949eb7ca..7249bcab19a 100644 --- a/libmysql/Makefile.shared +++ b/libmysql/Makefile.shared @@ -66,7 +66,7 @@ mysysobjects1 = my_init.lo my_static.lo my_malloc.lo my_realloc.lo \ charset.lo charset-def.lo hash.lo mf_iocache.lo \ mf_iocache2.lo my_seek.lo my_sleep.lo \ my_pread.lo mf_cache.lo md5.lo sha1.lo \ - my_getopt.lo my_gethostbyname.lo my_port.lo \ + my_getopt.lo \ my_rename.lo my_chsize.lo my_sync.lo my_getsystime.lo sqlobjects = net.lo sql_cmn_objects = pack.lo client.lo my_time.lo diff --git a/mysys/CMakeLists.txt b/mysys/CMakeLists.txt index 7afb800643c..9db8a40407e 100755 --- a/mysys/CMakeLists.txt +++ b/mysys/CMakeLists.txt @@ -33,8 +33,8 @@ SET(MYSYS_SOURCES array.c charset-def.c charset.c checksum.c default.c default_ mf_tempfile.c mf_unixpath.c mf_wcomp.c mf_wfile.c mulalloc.c my_access.c my_aes.c my_alarm.c my_alloc.c my_append.c my_bit.c my_bitmap.c my_chsize.c my_clock.c my_compress.c my_conio.c my_copy.c my_crc32.c my_create.c my_delete.c - my_div.c my_error.c my_file.c my_fopen.c my_fstream.c my_gethostbyname.c - my_gethwaddr.c my_getopt.c my_getsystime.c my_getwd.c my_handler.c my_init.c + my_div.c my_error.c my_file.c my_fopen.c my_fstream.c + my_gethwaddr.c my_getopt.c my_getsystime.c my_getwd.c my_compare.c my_init.c my_lib.c my_lock.c my_lockmem.c my_malloc.c my_messnc.c my_mkdir.c my_mmap.c my_net.c my_once.c my_open.c my_pread.c my_pthread.c my_quick.c my_read.c my_realloc.c my_redel.c my_rename.c my_seek.c my_sleep.c diff --git a/mysys/Makefile.am b/mysys/Makefile.am index e4c71f66079..00575375c11 100644 --- a/mysys/Makefile.am +++ b/mysys/Makefile.am @@ -46,10 +46,10 @@ libmysys_a_SOURCES = my_init.c my_getwd.c mf_getdate.c my_mmap.c \ my_sync.c my_getopt.c my_mkdir.c \ default_modify.c default.c \ my_compress.c checksum.c \ - my_net.c my_port.c my_sleep.c \ + my_net.c my_sleep.c \ charset.c charset-def.c my_bitmap.c my_bit.c md5.c \ - my_gethostbyname.c rijndael.c my_aes.c sha1.c \ - my_handler.c my_netware.c my_largepage.c \ + rijndael.c my_aes.c sha1.c \ + my_compare.c my_netware.c my_largepage.c \ my_memmem.c stacktrace.c \ my_windac.c my_access.c base64.c my_libwrap.c diff --git a/mysys/my_handler.c b/mysys/my_compare.c similarity index 78% rename from mysys/my_handler.c rename to mysys/my_compare.c index 7aa8177040d..8d33861d91c 100644 --- a/mysys/my_handler.c +++ b/mysys/my_compare.c @@ -1,27 +1,19 @@ -/* Copyright (C) 2002-2006 MySQL AB - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Library General Public - License as published by the Free Software Foundation; version 2 - of the License. - - This library is distributed in the hope that it will be useful, +/* Copyright (c) 2011 Oracle and/or its affiliates. All rights reserved. + + This program is free software; you can redistribute it and/or modify + it under the terms of the GNU General Public License as published by + the Free Software Foundation; version 2 of the License. + + This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Library General Public License for more details. + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the + GNU General Public License for more details. - You should have received a copy of the GNU Library General Public - License along with this library; if not, write to the Free - Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, - MA 02111-1307, USA */ + You should have received a copy of the GNU General Public License + along with this program; if not, write to the Free Software + Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA */ -#include -#include -#include -#include -#include - -#include "my_handler_errors.h" +#include "my_compare.h" int ha_compare_text(CHARSET_INFO *charset_info, uchar *a, uint a_length, uchar *b, uint b_length, my_bool part_key, @@ -269,6 +261,7 @@ int ha_key_cmp(register HA_KEYSEG *keyseg, register uchar *a, return ((keyseg->flag & HA_REVERSE_SORT) ? -flag : flag); a+=a_length; b+=b_length; + break; } break; case HA_KEYTYPE_INT8: @@ -474,125 +467,3 @@ end: } return 0; } /* ha_key_cmp */ - - -/* - Find the first NULL value in index-suffix values tuple - - SYNOPSIS - ha_find_null() - keyseg Array of keyparts for key suffix - a Key suffix value tuple - - DESCRIPTION - Find the first NULL value in index-suffix values tuple. - - TODO - Consider optimizing this function or its use so we don't search for - NULL values in completely NOT NULL index suffixes. - - RETURN - First key part that has NULL as value in values tuple, or the last key - part (with keyseg->type==HA_TYPE_END) if values tuple doesn't contain - NULLs. -*/ - -HA_KEYSEG *ha_find_null(HA_KEYSEG *keyseg, uchar *a) -{ - for (; (enum ha_base_keytype) keyseg->type != HA_KEYTYPE_END; keyseg++) - { - uchar *end; - if (keyseg->null_bit) - { - if (!*a++) - return keyseg; - } - end= a+ keyseg->length; - - switch ((enum ha_base_keytype) keyseg->type) { - case HA_KEYTYPE_TEXT: - case HA_KEYTYPE_BINARY: - case HA_KEYTYPE_BIT: - if (keyseg->flag & HA_SPACE_PACK) - { - int a_length; - get_key_length(a_length, a); - a += a_length; - break; - } - else - a= end; - break; - case HA_KEYTYPE_VARTEXT1: - case HA_KEYTYPE_VARTEXT2: - case HA_KEYTYPE_VARBINARY1: - case HA_KEYTYPE_VARBINARY2: - { - int a_length; - get_key_length(a_length, a); - a+= a_length; - break; - } - case HA_KEYTYPE_NUM: - if (keyseg->flag & HA_SPACE_PACK) - { - int alength= *a++; - end= a+alength; - } - a= end; - break; - case HA_KEYTYPE_INT8: - case HA_KEYTYPE_SHORT_INT: - case HA_KEYTYPE_USHORT_INT: - case HA_KEYTYPE_LONG_INT: - case HA_KEYTYPE_ULONG_INT: - case HA_KEYTYPE_INT24: - case HA_KEYTYPE_UINT24: -#ifdef HAVE_LONG_LONG - case HA_KEYTYPE_LONGLONG: - case HA_KEYTYPE_ULONGLONG: -#endif - case HA_KEYTYPE_FLOAT: - case HA_KEYTYPE_DOUBLE: - a= end; - break; - case HA_KEYTYPE_END: /* purecov: inspected */ - /* keep compiler happy */ - DBUG_ASSERT(0); - break; - } - } - return keyseg; -} - - - -/* - Register handler error messages for usage with my_error() - - NOTES - This is safe to call multiple times as my_error_register() - will ignore calls to register already registered error numbers. -*/ - - -void my_handler_error_register(void) -{ - /* - If you got compilation error here about compile_time_assert array, check - that every HA_ERR_xxx constant has a corresponding error message in - handler_error_messages[] list (check mysys/ma_handler_errors.h and - include/my_base.h). - */ - compile_time_assert(HA_ERR_FIRST + array_elements(handler_error_messages) == - HA_ERR_LAST + 1); - my_error_register(handler_error_messages, HA_ERR_FIRST, - HA_ERR_FIRST+ array_elements(handler_error_messages)-1); -} - - -void my_handler_error_unregister(void) -{ - my_error_unregister(HA_ERR_FIRST, - HA_ERR_FIRST+ array_elements(handler_error_messages)-1); -} diff --git a/mysys/my_gethostbyname.c b/mysys/my_gethostbyname.c deleted file mode 100644 index 12cf90271dd..00000000000 --- a/mysys/my_gethostbyname.c +++ /dev/null @@ -1,113 +0,0 @@ -/* Copyright (C) 2002, 2004 MySQL AB - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Library General Public - License as published by the Free Software Foundation; version 2 - of the License. - - This library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Library General Public License for more details. - - You should have received a copy of the GNU Library General Public - License along with this library; if not, write to the Free - Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, - MA 02111-1307, USA */ - -/* Thread safe version of gethostbyname_r() */ - -#include "mysys_priv.h" -#if !defined(__WIN__) -#include -#endif -#include - -/* This file is not needed if my_gethostbyname_r is a macro */ -#if !defined(my_gethostbyname_r) - -/* - Emulate SOLARIS style calls, not because it's better, but just to make the - usage of getbostbyname_r simpler. -*/ - -#if defined(HAVE_GETHOSTBYNAME_R) - -#if defined(HAVE_GETHOSTBYNAME_R_GLIBC2_STYLE) - -struct hostent *my_gethostbyname_r(const char *name, - struct hostent *result, char *buffer, - int buflen, int *h_errnop) -{ - struct hostent *hp; - DBUG_ASSERT((size_t) buflen >= sizeof(*result)); - if (gethostbyname_r(name,result, buffer, (size_t) buflen, &hp, h_errnop)) - return 0; - return hp; -} - -#elif defined(HAVE_GETHOSTBYNAME_R_RETURN_INT) - -struct hostent *my_gethostbyname_r(const char *name, - struct hostent *result, char *buffer, - int buflen, int *h_errnop) -{ - if (gethostbyname_r(name,result,(struct hostent_data *) buffer) == -1) - { - *h_errnop= errno; - return 0; - } - return result; -} - -#else - -/* gethostbyname_r with similar interface as gethostbyname() */ - -struct hostent *my_gethostbyname_r(const char *name, - struct hostent *result, char *buffer, - int buflen, int *h_errnop) -{ - struct hostent *hp; - DBUG_ASSERT(buflen >= sizeof(struct hostent_data)); - hp= gethostbyname_r(name,result,(struct hostent_data *) buffer); - *h_errnop= errno; - return hp; -} -#endif /* GLIBC2_STYLE_GETHOSTBYNAME_R */ - -#else /* !HAVE_GETHOSTBYNAME_R */ - -#ifdef THREAD -extern pthread_mutex_t LOCK_gethostbyname_r; -#endif - -/* - No gethostbyname_r() function exists. - In this case we have to keep a mutex over the call to ensure that no - other thread is going to reuse the internal memory. - - The user is responsible to call my_gethostbyname_r_free() when he - is finished with the structure. -*/ - -struct hostent *my_gethostbyname_r(const char *name, - struct hostent *res __attribute__((unused)), - char *buffer __attribute__((unused)), - int buflen __attribute__((unused)), - int *h_errnop) -{ - struct hostent *hp; - pthread_mutex_lock(&LOCK_gethostbyname_r); - hp= gethostbyname(name); - *h_errnop= h_errno; - return hp; -} - -void my_gethostbyname_r_free() -{ - pthread_mutex_unlock(&LOCK_gethostbyname_r); -} - -#endif /* !HAVE_GETHOSTBYNAME_R */ -#endif /* !my_gethostbyname_r */ diff --git a/mysys/my_net.c b/mysys/my_net.c index 81d977210f8..3d139bb46c3 100644 --- a/mysys/my_net.c +++ b/mysys/my_net.c @@ -31,6 +31,8 @@ #include #endif #endif /* !defined(__WIN__) */ +#include "my_net.h" + void my_inet_ntoa(struct in_addr in, char *buf) { @@ -40,3 +42,90 @@ void my_inet_ntoa(struct in_addr in, char *buf) strmov(buf,ptr); pthread_mutex_unlock(&THR_LOCK_net); } + +/* This code is not needed if my_gethostbyname_r is a macro */ +#if !defined(my_gethostbyname_r) + +/* + Emulate SOLARIS style calls, not because it's better, but just to make the + usage of getbostbyname_r simpler. +*/ + +#if defined(HAVE_GETHOSTBYNAME_R) + +#if defined(HAVE_GETHOSTBYNAME_R_GLIBC2_STYLE) + +struct hostent *my_gethostbyname_r(const char *name, + struct hostent *result, char *buffer, + int buflen, int *h_errnop) +{ + struct hostent *hp; + DBUG_ASSERT((size_t) buflen >= sizeof(*result)); + if (gethostbyname_r(name,result, buffer, (size_t) buflen, &hp, h_errnop)) + return 0; + return hp; +} + +#elif defined(HAVE_GETHOSTBYNAME_R_RETURN_INT) + +struct hostent *my_gethostbyname_r(const char *name, + struct hostent *result, char *buffer, + int buflen, int *h_errnop) +{ + if (gethostbyname_r(name,result,(struct hostent_data *) buffer) == -1) + { + *h_errnop= errno; + return 0; + } + return result; +} + +#else + +/* gethostbyname_r with similar interface as gethostbyname() */ + +struct hostent *my_gethostbyname_r(const char *name, + struct hostent *result, char *buffer, + int buflen, int *h_errnop) +{ + struct hostent *hp; + DBUG_ASSERT(buflen >= sizeof(struct hostent_data)); + hp= gethostbyname_r(name,result,(struct hostent_data *) buffer); + *h_errnop= errno; + return hp; +} +#endif /* GLIBC2_STYLE_GETHOSTBYNAME_R */ + +#else /* !HAVE_GETHOSTBYNAME_R */ + +#ifdef THREAD +extern pthread_mutex_t LOCK_gethostbyname_r; +#endif + +/* + No gethostbyname_r() function exists. + In this case we have to keep a mutex over the call to ensure that no + other thread is going to reuse the internal memory. + + The user is responsible to call my_gethostbyname_r_free() when he + is finished with the structure. +*/ + +struct hostent *my_gethostbyname_r(const char *name, + struct hostent *result, char *buffer, + int buflen, int *h_errnop) +{ + struct hostent *hp; + pthread_mutex_lock(&LOCK_gethostbyname_r); + hp= gethostbyname(name); + *h_errnop= h_errno; + return hp; +} + +void my_gethostbyname_r_free() +{ + pthread_mutex_unlock(&LOCK_gethostbyname_r); +} + +#endif /* !HAVE_GETHOSTBYNAME_R */ +#endif /* !my_gethostbyname_r */ diff --git a/mysys/my_port.c b/mysys/my_port.c deleted file mode 100644 index 9ad333421ca..00000000000 --- a/mysys/my_port.c +++ /dev/null @@ -1,40 +0,0 @@ -/* Copyright (C) 2002 MySQL AB - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Library General Public - License as published by the Free Software Foundation; version 2 - of the License. - - This library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Library General Public License for more details. - - You should have received a copy of the GNU Library General Public - License along with this library; if not, write to the Free - Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, - MA 02111-1307, USA */ - -/* - Small functions to make code portable -*/ - -#include "mysys_priv.h" - -#ifdef _AIX - -/* - On AIX, at least with gcc 3.1, the expression - '(double) (ulonglong) var' doesn't always work for big unsigned - integers like '18446744073709551615'. The end result is that the - high bit is simply dropped. (probably bug in gcc optimizations) - Handling the conversion in a sub function seems to work. -*/ - - - -double my_ulonglong2double(unsigned long long nr) -{ - return (double) nr; -} -#endif /* _AIX */ diff --git a/sql/field.h b/sql/field.h index cbdfa686ff8..285c8307634 100644 --- a/sql/field.h +++ b/sql/field.h @@ -13,6 +13,8 @@ along with this program; if not, write to the Free Software Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA */ +#include "my_compare.h" /* for clr_rec_bits */ + /* Because of the function new_field() all field classes that have static variables must declare the size_of() member function. diff --git a/sql/handler.h b/sql/handler.h index dabc179079a..5f68bb6a8f8 100644 --- a/sql/handler.h +++ b/sql/handler.h @@ -20,7 +20,6 @@ #pragma interface /* gcc class implementation */ #endif -#include #include #include diff --git a/storage/myisam/ft_stopwords.c b/storage/myisam/ft_stopwords.c index 9838b15af34..dbab71f4381 100644 --- a/storage/myisam/ft_stopwords.c +++ b/storage/myisam/ft_stopwords.c @@ -16,7 +16,7 @@ /* Written by Sergei A. Golubchik, who has a shared copyright to this code */ #include "ftdefs.h" -#include "my_handler.h" +#include "my_compare.h" typedef struct st_ft_stopwords { diff --git a/storage/myisam/mi_check.c b/storage/myisam/mi_check.c index 935465e7edf..7bc26729e03 100644 --- a/storage/myisam/mi_check.c +++ b/storage/myisam/mi_check.c @@ -85,6 +85,7 @@ static SORT_KEY_BLOCKS *alloc_key_blocks(MI_CHECK *param, uint blocks, uint buffer_length); static ha_checksum mi_byte_checksum(const uchar *buf, uint length); static void set_data_file_type(SORT_INFO *sort_info, MYISAM_SHARE *share); +static HA_KEYSEG *ha_find_null(HA_KEYSEG *keyseg, uchar *a); void myisamchk_init(MI_CHECK *param) { @@ -4739,3 +4740,89 @@ set_data_file_type(SORT_INFO *sort_info, MYISAM_SHARE *share) share->delete_record=tmp.delete_record; } } + +/* + Find the first NULL value in index-suffix values tuple + + SYNOPSIS + ha_find_null() + keyseg Array of keyparts for key suffix + a Key suffix value tuple + + DESCRIPTION + Find the first NULL value in index-suffix values tuple. + TODO Consider optimizing this fuction or its use so we don't search for + NULL values in completely NOT NULL index suffixes. + + RETURN + First key part that has NULL as value in values tuple, or the last key part + (with keyseg->type==HA_TYPE_END) if values tuple doesn't contain NULLs. +*/ + +static HA_KEYSEG *ha_find_null(HA_KEYSEG *keyseg, uchar *a) +{ + for (; (enum ha_base_keytype) keyseg->type != HA_KEYTYPE_END; keyseg++) + { + uchar *end; + if (keyseg->null_bit) + { + if (!*a++) + return keyseg; + } + end= a+ keyseg->length; + + switch ((enum ha_base_keytype) keyseg->type) { + case HA_KEYTYPE_TEXT: + case HA_KEYTYPE_BINARY: + case HA_KEYTYPE_BIT: + if (keyseg->flag & HA_SPACE_PACK) + { + int a_length; + get_key_length(a_length, a); + a += a_length; + break; + } + else + a= end; + break; + case HA_KEYTYPE_VARTEXT1: + case HA_KEYTYPE_VARTEXT2: + case HA_KEYTYPE_VARBINARY1: + case HA_KEYTYPE_VARBINARY2: + { + int a_length; + get_key_length(a_length, a); + a+= a_length; + break; + } + case HA_KEYTYPE_NUM: + if (keyseg->flag & HA_SPACE_PACK) + { + int alength= *a++; + end= a+alength; + } + a= end; + break; + case HA_KEYTYPE_INT8: + case HA_KEYTYPE_SHORT_INT: + case HA_KEYTYPE_USHORT_INT: + case HA_KEYTYPE_LONG_INT: + case HA_KEYTYPE_ULONG_INT: + case HA_KEYTYPE_INT24: + case HA_KEYTYPE_UINT24: +#ifdef HAVE_LONG_LONG + case HA_KEYTYPE_LONGLONG: + case HA_KEYTYPE_ULONGLONG: +#endif + case HA_KEYTYPE_FLOAT: + case HA_KEYTYPE_DOUBLE: + a= end; + break; + case HA_KEYTYPE_END: /* purecov: inspected */ + /* keep compiler happy */ + DBUG_ASSERT(0); + break; + } + } + return keyseg; +} diff --git a/storage/myisam/mi_test1.c b/storage/myisam/mi_test1.c index 363b024737a..142ee9b4909 100644 --- a/storage/myisam/mi_test1.c +++ b/storage/myisam/mi_test1.c @@ -16,6 +16,7 @@ /* Testing of the basic functions of a MyISAM table */ #include "myisam.h" +#include "myisamdef.h" #include #include diff --git a/storage/myisam/mi_write.c b/storage/myisam/mi_write.c index 72a4e006cc6..3c8ebe5dbd8 100644 --- a/storage/myisam/mi_write.c +++ b/storage/myisam/mi_write.c @@ -17,6 +17,7 @@ #include "fulltext.h" #include "rt_index.h" +#include "my_compare.h" #define MAX_POINTER_LENGTH 8 diff --git a/storage/myisam/myisamdef.h b/storage/myisam/myisamdef.h index 962155e884c..c91601f6503 100644 --- a/storage/myisam/myisamdef.h +++ b/storage/myisam/myisamdef.h @@ -424,6 +424,8 @@ typedef struct st_mi_sort_param #define get_pack_length(length) ((length) >= 255 ? 3 : 1) +#define portable_sizeof_char_ptr 8 + #define MI_MIN_BLOCK_LENGTH 20 /* Because of delete-link */ #define MI_EXTEND_BLOCK_LENGTH 20 /* Don't use to small record-blocks */ #define MI_SPLIT_LENGTH ((MI_EXTEND_BLOCK_LENGTH+4)*2) diff --git a/storage/myisam/sp_test.c b/storage/myisam/sp_test.c index f572c7ab19b..7a30a742fd6 100644 --- a/storage/myisam/sp_test.c +++ b/storage/myisam/sp_test.c @@ -17,6 +17,7 @@ /* Written by Alex Barkov, who has a shared copyright to this code */ #include "myisam.h" +#include "myisamdef.h" #ifdef HAVE_SPATIAL #include "sp_defs.h" From a3ab0d92defbafb462c7c5c50bab324521558971 Mon Sep 17 00:00:00 2001 From: Georgi Kodinov Date: Mon, 28 Mar 2011 13:25:03 +0300 Subject: [PATCH 160/202] Fixed a test failure in embedded because of the fix for BUG#11766769 --- mysql-test/r/variables-notembedded.result | 24 ++++++++++++++++++++ mysql-test/r/variables.result | 23 ------------------- mysql-test/t/variables-notembedded.test | 27 +++++++++++++++++++++++ mysql-test/t/variables.test | 25 --------------------- 4 files changed, 51 insertions(+), 48 deletions(-) diff --git a/mysql-test/r/variables-notembedded.result b/mysql-test/r/variables-notembedded.result index 8c6d54757ed..8056af49090 100644 --- a/mysql-test/r/variables-notembedded.result +++ b/mysql-test/r/variables-notembedded.result @@ -108,3 +108,27 @@ SET @@session.slave_skip_errors= 7; ERROR HY000: Variable 'slave_skip_errors' is a read only variable SET @@global.slave_skip_errors= 7; ERROR HY000: Variable 'slave_skip_errors' is a read only variable +# +# Bug #11766769 : 59959: SMALL VALUES OF --MAX-ALLOWED-PACKET +# ARE NOT BEING HONORED +# +CREATE TABLE t1 (a MEDIUMTEXT); +SET GLOBAL max_allowed_packet=2048; +Warnings: +Warning 1105 The value of 'max_allowed_packet' should be no less than the value of 'net_buffer_length' +SET GLOBAL net_buffer_length=4096; +Warnings: +Warning 1105 The value of 'max_allowed_packet' should be no less than the value of 'net_buffer_length' +SHOW SESSION VARIABLES LIKE 'max_allowed_packet'; +Variable_name Value +max_allowed_packet 2048 +SHOW SESSION VARIABLES LIKE 'net_buffer_length'; +Variable_name Value +net_buffer_length 4096 +ERROR 08S01: Got a packet bigger than 'max_allowed_packet' bytes +SELECT LENGTH(a) FROM t1; +LENGTH(a) +SET GLOBAL max_allowed_packet=default; +SET GLOBAL net_buffer_length=default; +DROP TABLE t1; +End of 5.1 tests diff --git a/mysql-test/r/variables.result b/mysql-test/r/variables.result index f92e1dec4c9..8cff6e99d4f 100644 --- a/mysql-test/r/variables.result +++ b/mysql-test/r/variables.result @@ -1567,27 +1567,4 @@ SET @@global.max_binlog_cache_size=DEFAULT; SET @@global.max_join_size=DEFAULT; SET @@global.key_buffer_size=@kbs; SET @@global.key_cache_block_size=@kcbs; -# -# Bug #11766769 : 59959: SMALL VALUES OF --MAX-ALLOWED-PACKET -# ARE NOT BEING HONORED -# -CREATE TABLE t1 (a MEDIUMTEXT); -SET GLOBAL max_allowed_packet=2048; -Warnings: -Warning 1105 The value of 'max_allowed_packet' should be no less than the value of 'net_buffer_length' -SET GLOBAL net_buffer_length=4096; -Warnings: -Warning 1105 The value of 'max_allowed_packet' should be no less than the value of 'net_buffer_length' -SHOW SESSION VARIABLES LIKE 'max_allowed_packet'; -Variable_name Value -max_allowed_packet 2048 -SHOW SESSION VARIABLES LIKE 'net_buffer_length'; -Variable_name Value -net_buffer_length 4096 -ERROR 08S01: Got a packet bigger than 'max_allowed_packet' bytes -SELECT LENGTH(a) FROM t1; -LENGTH(a) -SET GLOBAL max_allowed_packet=default; -SET GLOBAL net_buffer_length=default; -DROP TABLE t1; End of 5.1 tests diff --git a/mysql-test/t/variables-notembedded.test b/mysql-test/t/variables-notembedded.test index 7cc068c68c7..b440cfa47b0 100644 --- a/mysql-test/t/variables-notembedded.test +++ b/mysql-test/t/variables-notembedded.test @@ -109,3 +109,30 @@ SET @@session.slave_skip_errors= 7; --error ER_INCORRECT_GLOBAL_LOCAL_VAR SET @@global.slave_skip_errors= 7; # + +--echo # +--echo # Bug #11766769 : 59959: SMALL VALUES OF --MAX-ALLOWED-PACKET +--echo # ARE NOT BEING HONORED +--echo # + +CREATE TABLE t1 (a MEDIUMTEXT); + +SET GLOBAL max_allowed_packet=2048; +SET GLOBAL net_buffer_length=4096; +CONNECT (con1,localhost,root,,test); +SHOW SESSION VARIABLES LIKE 'max_allowed_packet'; +SHOW SESSION VARIABLES LIKE 'net_buffer_length'; +--disable_query_log +--error ER_NET_PACKET_TOO_LARGE +INSERT INTO t1 VALUES ('123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890'); +--enable_query_log + +CONNECTION default; +DISCONNECT con1; +SELECT LENGTH(a) FROM t1; + +SET GLOBAL max_allowed_packet=default; +SET GLOBAL net_buffer_length=default; +DROP TABLE t1; + +--echo End of 5.1 tests diff --git a/mysql-test/t/variables.test b/mysql-test/t/variables.test index 8f111e7cf3b..d00b77e64c0 100644 --- a/mysql-test/t/variables.test +++ b/mysql-test/t/variables.test @@ -1318,29 +1318,4 @@ SET @@global.key_buffer_size=@kbs; SET @@global.key_cache_block_size=@kcbs; ---echo # ---echo # Bug #11766769 : 59959: SMALL VALUES OF --MAX-ALLOWED-PACKET ---echo # ARE NOT BEING HONORED ---echo # - -CREATE TABLE t1 (a MEDIUMTEXT); - -SET GLOBAL max_allowed_packet=2048; -SET GLOBAL net_buffer_length=4096; -CONNECT (con1,localhost,root,,test); -SHOW SESSION VARIABLES LIKE 'max_allowed_packet'; -SHOW SESSION VARIABLES LIKE 'net_buffer_length'; ---disable_query_log ---error ER_NET_PACKET_TOO_LARGE -INSERT INTO t1 VALUES ('123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890'); ---enable_query_log -SELECT LENGTH(a) FROM t1; - -CONNECTION default; -DISCONNECT con1; -SET GLOBAL max_allowed_packet=default; -SET GLOBAL net_buffer_length=default; -DROP TABLE t1; - - --echo End of 5.1 tests From cd71e11cc825f55efceba44b055af47db88b5116 Mon Sep 17 00:00:00 2001 From: Georgi Kodinov Date: Mon, 28 Mar 2011 13:32:25 +0300 Subject: [PATCH 161/202] Fixed a test failure becase of a new warning caused by the fix for Bug #11766769 --- mysql-test/r/shm.result | 2 ++ 1 file changed, 2 insertions(+) diff --git a/mysql-test/r/shm.result b/mysql-test/r/shm.result index c504fe222ef..0e086e000c7 100644 --- a/mysql-test/r/shm.result +++ b/mysql-test/r/shm.result @@ -2155,6 +2155,8 @@ mysqld is alive SET @max_allowed_packet= @@global.max_allowed_packet; SET @net_buffer_length= @@global.net_buffer_length; SET GLOBAL max_allowed_packet= 1024; +Warnings: +Warning 1105 The value of 'max_allowed_packet' should be no less than the value of 'net_buffer_length' SET GLOBAL net_buffer_length= 1024; ERROR 1153 (08S01) at line 1: Got a packet bigger than 'max_allowed_packet' bytes SET GLOBAL max_allowed_packet= @max_allowed_packet; From 4ed8cb4a76275a28231a842c9112834d384b7b4c Mon Sep 17 00:00:00 2001 From: Georgi Kodinov Date: Mon, 28 Mar 2011 13:43:30 +0300 Subject: [PATCH 162/202] Added support for VS10. Fixed RelWithDebugInfo bzr ignores. --- .bzrignore | 6 +++++- win/build-vs10.bat | 18 ++++++++++++++++++ win/build-vs10_x64.bat | 18 ++++++++++++++++++ 3 files changed, 41 insertions(+), 1 deletion(-) create mode 100644 win/build-vs10.bat create mode 100644 win/build-vs10_x64.bat diff --git a/.bzrignore b/.bzrignore index 3d27c001e2b..0d668308193 100644 --- a/.bzrignore +++ b/.bzrignore @@ -9,6 +9,7 @@ *.core *.d *.da +*.dir *.dll *.exe *.exp @@ -30,6 +31,7 @@ *.pdb *.reject *.res +*.rule *.sbr *.so *.so.* @@ -37,6 +39,8 @@ *.user *.vcproj *.vcproj.cmake +*.vcxproj +*.vcxproj.filters */*.dir/* */*_pure_*warnings */.deps @@ -45,7 +49,7 @@ */debug/* */minsizerel/* */release/* -*/relwithdebinfo/* +RelWithDebInfo *~ .*.swp ./CMakeCache.txt diff --git a/win/build-vs10.bat b/win/build-vs10.bat new file mode 100644 index 00000000000..c2bc09b17df --- /dev/null +++ b/win/build-vs10.bat @@ -0,0 +1,18 @@ +@echo off + +REM Copyright (c) 2006,2010 Oracle and/or its affiliates. All rights reserved. +REM +REM This program is free software; you can redistribute it and/or modify +REM it under the terms of the GNU General Public License as published by +REM the Free Software Foundation; version 2 of the License. +REM +REM This program is distributed in the hope that it will be useful, +REM but WITHOUT ANY WARRANTY; without even the implied warranty of +REM MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the +REM GNU General Public License for more details. +REM +REM You should have received a copy of the GNU General Public License +REM along with this program; if not, write to the Free Software +REM Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA +cmake -G "Visual Studio 10" + diff --git a/win/build-vs10_x64.bat b/win/build-vs10_x64.bat new file mode 100644 index 00000000000..6fabe62a1ff --- /dev/null +++ b/win/build-vs10_x64.bat @@ -0,0 +1,18 @@ +@echo off + +REM Copyright (c) 2006,2010 Oracle and/or its affiliates. All rights reserved. +REM +REM This program is free software; you can redistribute it and/or modify +REM it under the terms of the GNU General Public License as published by +REM the Free Software Foundation; version 2 of the License. +REM +REM This program is distributed in the hope that it will be useful, +REM but WITHOUT ANY WARRANTY; without even the implied warranty of +REM MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the +REM GNU General Public License for more details. +REM +REM You should have received a copy of the GNU General Public License +REM along with this program; if not, write to the Free Software +REM Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA +cmake -G "Visual Studio 10 Win64" + From d6125b27b38432d1a465397c0c5a9e62bb1c65d3 Mon Sep 17 00:00:00 2001 From: Sergey Glukhov Date: Mon, 28 Mar 2011 17:24:25 +0400 Subject: [PATCH 163/202] Bug#11765216 58154: UNINITIALIZED VARIABLE FORMAT IN STR_TO_DATE FUNCTION Valgrind warning happens due to uninitialized cached_format_type field which is used later in Item_func_str_to_date::val_str method. The fix is to init cached_format_type field. mysql-test/r/func_time.result: test case mysql-test/t/func_time.test: test case sql/item_timefunc.cc: init cached_format_type field --- mysql-test/r/func_time.result | 6 ++++++ mysql-test/t/func_time.test | 8 ++++++++ sql/item_timefunc.cc | 1 + 3 files changed, 15 insertions(+) diff --git a/mysql-test/r/func_time.result b/mysql-test/r/func_time.result index f63860039d7..01743e4a1dc 100644 --- a/mysql-test/r/func_time.result +++ b/mysql-test/r/func_time.result @@ -1381,4 +1381,10 @@ DROP TABLE t1; SELECT STR_TO_DATE(SPACE(2),'1'); STR_TO_DATE(SPACE(2),'1') 0000-00-00 +# +# Bug#11765216 58154: UNINITIALIZED VARIABLE FORMAT IN STR_TO_DATE FUNCTION +# +SET GLOBAL SQL_MODE=''; +DO STR_TO_DATE((''), FROM_DAYS(@@GLOBAL.SQL_MODE)); +SET GLOBAL SQL_MODE=DEFAULT; End of 5.1 tests diff --git a/mysql-test/t/func_time.test b/mysql-test/t/func_time.test index c48351d33f2..3f441c42d48 100644 --- a/mysql-test/t/func_time.test +++ b/mysql-test/t/func_time.test @@ -887,4 +887,12 @@ DROP TABLE t1; SELECT STR_TO_DATE(SPACE(2),'1'); +--echo # +--echo # Bug#11765216 58154: UNINITIALIZED VARIABLE FORMAT IN STR_TO_DATE FUNCTION +--echo # + +SET GLOBAL SQL_MODE=''; +DO STR_TO_DATE((''), FROM_DAYS(@@GLOBAL.SQL_MODE)); +SET GLOBAL SQL_MODE=DEFAULT; + --echo End of 5.1 tests diff --git a/sql/item_timefunc.cc b/sql/item_timefunc.cc index 71b2baf4fee..ecf790cc061 100644 --- a/sql/item_timefunc.cc +++ b/sql/item_timefunc.cc @@ -3293,6 +3293,7 @@ void Item_func_str_to_date::fix_length_and_dec() { maybe_null= 1; decimals=0; + cached_format_type= DATE_TIME; cached_field_type= MYSQL_TYPE_DATETIME; max_length= MAX_DATETIME_FULL_WIDTH*MY_CHARSET_BIN_MB_MAXLEN; cached_timestamp_type= MYSQL_TIMESTAMP_NONE; From 47885f552b1822291584b71c791fd5175ba6567f Mon Sep 17 00:00:00 2001 From: Sergey Glukhov Date: Mon, 28 Mar 2011 17:27:44 +0400 Subject: [PATCH 164/202] Bug#11766087 59125: VALGRIND UNINITIALISED VALUE WARNING IN ULL2DEC, LONGLONG2DECIMAL Valgrind warning happens due to missing NULL value check in Item_func::val_decimal. The fix is to add this check. mysql-test/r/func_time.result: test case mysql-test/t/func_time.test: test case sql/item_func.cc: added check for NULL value --- mysql-test/r/func_time.result | 6 ++++++ mysql-test/t/func_time.test | 6 ++++++ sql/item_func.cc | 5 ++++- 3 files changed, 16 insertions(+), 1 deletion(-) diff --git a/mysql-test/r/func_time.result b/mysql-test/r/func_time.result index 01743e4a1dc..bbb506035dc 100644 --- a/mysql-test/r/func_time.result +++ b/mysql-test/r/func_time.result @@ -1387,4 +1387,10 @@ STR_TO_DATE(SPACE(2),'1') SET GLOBAL SQL_MODE=''; DO STR_TO_DATE((''), FROM_DAYS(@@GLOBAL.SQL_MODE)); SET GLOBAL SQL_MODE=DEFAULT; +# +# Bug#11766087 59125: VALGRIND UNINITIALISED VALUE WARNING IN ULL2DEC, LONGLONG2DECIMAL +# +SELECT FORMAT(YEAR(STR_TO_DATE('',GET_FORMAT(TIME,''))),1); +FORMAT(YEAR(STR_TO_DATE('',GET_FORMAT(TIME,''))),1) +NULL End of 5.1 tests diff --git a/mysql-test/t/func_time.test b/mysql-test/t/func_time.test index 3f441c42d48..2c3d3849793 100644 --- a/mysql-test/t/func_time.test +++ b/mysql-test/t/func_time.test @@ -895,4 +895,10 @@ SET GLOBAL SQL_MODE=''; DO STR_TO_DATE((''), FROM_DAYS(@@GLOBAL.SQL_MODE)); SET GLOBAL SQL_MODE=DEFAULT; +--echo # +--echo # Bug#11766087 59125: VALGRIND UNINITIALISED VALUE WARNING IN ULL2DEC, LONGLONG2DECIMAL +--echo # + +SELECT FORMAT(YEAR(STR_TO_DATE('',GET_FORMAT(TIME,''))),1); + --echo End of 5.1 tests diff --git a/sql/item_func.cc b/sql/item_func.cc index 79fa37bd372..595629b51be 100644 --- a/sql/item_func.cc +++ b/sql/item_func.cc @@ -482,7 +482,10 @@ bool Item_func::is_expensive_processor(uchar *arg) my_decimal *Item_func::val_decimal(my_decimal *decimal_value) { DBUG_ASSERT(fixed); - int2my_decimal(E_DEC_FATAL_ERROR, val_int(), unsigned_flag, decimal_value); + longlong nr= val_int(); + if (null_value) + return 0; /* purecov: inspected */ + int2my_decimal(E_DEC_FATAL_ERROR, nr, unsigned_flag, decimal_value); return decimal_value; } From 08e472ff349bb5d21b4881828ed62748ecf7aa40 Mon Sep 17 00:00:00 2001 From: Mayank Prasad Date: Mon, 28 Mar 2011 21:01:37 +0530 Subject: [PATCH 165/202] Bug#11751148 : show events shows events in other schema Issue: ====== Test case Correction for bug#11751148. mysql-test/r/events_bugs.result: Result file Correction for bug#11751148. mysql-test/t/events_bugs.test: Test case Correction for bug#11751148. --- mysql-test/r/events_bugs.result | 8 ++++---- mysql-test/t/events_bugs.test | 8 ++++---- 2 files changed, 8 insertions(+), 8 deletions(-) diff --git a/mysql-test/r/events_bugs.result b/mysql-test/r/events_bugs.result index ab1e9884efd..dfb8f008c5a 100644 --- a/mysql-test/r/events_bugs.result +++ b/mysql-test/r/events_bugs.result @@ -747,15 +747,15 @@ event_name originator ev1 4294967295 DROP EVENT ev1; SET GLOBAL server_id = @old_server_id; +CREATE DATABASE event_test12; +USE event_test12; +CREATE EVENT ev1 ON SCHEDULE EVERY 1 DAY DO SELECT 1; CREATE DATABASE event_test1; USE event_test1; -CREATE EVENT ev1 ON SCHEDULE EVERY 1 DAY DO SELECT 1; -CREATE DATABASE event_test2; -USE event_test2; SHOW EVENTS; Db Name Definer Time zone Type Execute at Interval value Interval field Starts Ends Status Originator character_set_client collation_connection Database Collation DROP DATABASE event_test1; -DROP DATABASE event_test2; +DROP DATABASE event_test12; DROP DATABASE events_test; SET GLOBAL event_scheduler= 'ON'; SET @@global.concurrent_insert= @concurrent_insert; diff --git a/mysql-test/t/events_bugs.test b/mysql-test/t/events_bugs.test index 83e37cdccdb..420e7183621 100644 --- a/mysql-test/t/events_bugs.test +++ b/mysql-test/t/events_bugs.test @@ -1225,15 +1225,15 @@ SET GLOBAL server_id = @old_server_id; # Bug#11751148: show events shows events in other schema # +CREATE DATABASE event_test12; +USE event_test12; +CREATE EVENT ev1 ON SCHEDULE EVERY 1 DAY DO SELECT 1; CREATE DATABASE event_test1; USE event_test1; -CREATE EVENT ev1 ON SCHEDULE EVERY 1 DAY DO SELECT 1; -CREATE DATABASE event_test2; -USE event_test2; # Following show events should not show ev1 SHOW EVENTS; DROP DATABASE event_test1; -DROP DATABASE event_test2; +DROP DATABASE event_test12; ########################################################################### From 4e26a41f3e2cac5ec5016b862944c0116a18b0f6 Mon Sep 17 00:00:00 2001 From: Jon Olav Hauglid Date: Tue, 29 Mar 2011 10:09:05 +0200 Subject: [PATCH 166/202] Bug# 11763784 (former 56541) ASSERTION TABLE->DB_STAT FAILED IN SQL_BASE.CC::OPEN_TABLE() DURING I_S Q This assert could be triggered if a statement requiring a name lock on a table (e.g. DROP TRIGGER) executed concurrently with an I_S query which also used the table. One connection first started an I_S query that opened a given table. Then another connection started a statement requiring a name lock on the same table. This statement was blocked since the table was in use by the I_S query. When the I_S query resumed and tried to open the table again as part of get_all_tables(), it would encounter a table instance with an old version number representing the pending name lock. Since I_S queries ignore version checks and thus pending name locks, it would try to continue. This caused it to encounter the assert. The assert checked that the TABLE instance found with a different version, was a real, open table. However, since this TABLE instance instead represented a pending name lock, the check would fail and trigger the assert. This patch fixes the problem by removing the assert. It is ok for TABLE::db_stat to be 0 in this case since the TABLE instance can represent a pending name lock. Test case added to lock_sync.test. --- mysql-test/r/lock_sync.result | 27 ++++++++++++++++++ mysql-test/t/lock_sync.test | 54 +++++++++++++++++++++++++++++++++++ sql/sql_base.cc | 3 +- 3 files changed, 82 insertions(+), 2 deletions(-) diff --git a/mysql-test/r/lock_sync.result b/mysql-test/r/lock_sync.result index 752f278a2b4..8b662cc8a82 100644 --- a/mysql-test/r/lock_sync.result +++ b/mysql-test/r/lock_sync.result @@ -629,3 +629,30 @@ drop procedure p1; drop procedure p2; drop table t1, t2, t3, t4, t5, te; set @@global.concurrent_insert= @old_concurrent_insert; +# +# Bug#11763784 56541: ASSERTION TABLE->DB_STAT FAILED IN +# SQL_BASE.CC::OPEN_TABLE() DURING I_S Q +# +DROP TABLE IF EXISTS t1; +CREATE TABLE t1(a int); +INSERT INTO t1 VALUES (1), (2); +CREATE TRIGGER t1_bi BEFORE INSERT ON t1 FOR EACH ROW BEGIN END; +# Connection con2 +SET DEBUG_SYNC= 'before_open_in_get_all_tables SIGNAL is_waits WAIT_FOR is_cont'; +# Sending: +SELECT * FROM information_schema.table_constraints JOIN t1 ON table_name = a; +# Connection con1 +SET DEBUG_SYNC= 'now WAIT_FOR is_waits'; +# Sending: +DROP TRIGGER t1_bi; +# Connection default +# Wait until DROP TRIGGER is blocked, waiting for t1 +SET DEBUG_SYNC= 'now SIGNAL is_cont'; +# Connection con2 +# Reaping SELECT * FROM information_schema.table_constraints JOIN t1... +CONSTRAINT_CATALOG CONSTRAINT_SCHEMA CONSTRAINT_NAME TABLE_SCHEMA TABLE_NAME CONSTRAINT_TYPE a +# Connection con1 +# Reaping DROP TRIGGER t1_bi +# Connection default +DROP TABLE t1; +SET DEBUG_SYNC= 'RESET'; diff --git a/mysql-test/t/lock_sync.test b/mysql-test/t/lock_sync.test index 17f8abb75f3..1df09524140 100644 --- a/mysql-test/t/lock_sync.test +++ b/mysql-test/t/lock_sync.test @@ -862,6 +862,60 @@ disconnect con2; set @@global.concurrent_insert= @old_concurrent_insert; +--echo # +--echo # Bug#11763784 56541: ASSERTION TABLE->DB_STAT FAILED IN +--echo # SQL_BASE.CC::OPEN_TABLE() DURING I_S Q +--echo # + +--disable_warnings +DROP TABLE IF EXISTS t1; +--enable_warnings + +CREATE TABLE t1(a int); +INSERT INTO t1 VALUES (1), (2); +CREATE TRIGGER t1_bi BEFORE INSERT ON t1 FOR EACH ROW BEGIN END; + +connect (con1, localhost, root); +--echo # Connection con2 +connect (con2, localhost, root); +SET DEBUG_SYNC= 'before_open_in_get_all_tables SIGNAL is_waits WAIT_FOR is_cont'; +--echo # Sending: +--send SELECT * FROM information_schema.table_constraints JOIN t1 ON table_name = a + +--echo # Connection con1 +connection con1; +SET DEBUG_SYNC= 'now WAIT_FOR is_waits'; +--echo # Sending: +--send DROP TRIGGER t1_bi + +--echo # Connection default +connection default; +--echo # Wait until DROP TRIGGER is blocked, waiting for t1 +let $wait_condition= + SELECT COUNT(*) = 1 FROM information_schema.processlist + WHERE state = "Waiting for table" AND + info = "DROP TRIGGER t1_bi"; +--source include/wait_condition.inc +SET DEBUG_SYNC= 'now SIGNAL is_cont'; + +--echo # Connection con2 +connection con2; +--echo # Reaping SELECT * FROM information_schema.table_constraints JOIN t1... +--reap + +--echo # Connection con1 +connection con1; +--echo # Reaping DROP TRIGGER t1_bi +--reap + +--echo # Connection default +connection default; +DROP TABLE t1; +SET DEBUG_SYNC= 'RESET'; +disconnect con1; +disconnect con2; + + # Check that all connections opened by test cases in this file are really # gone so execution of other tests won't be affected by their presence. --source include/wait_until_count_sessions.inc diff --git a/sql/sql_base.cc b/sql/sql_base.cc index 9765148cda1..dc78f3b84c6 100644 --- a/sql/sql_base.cc +++ b/sql/sql_base.cc @@ -2798,10 +2798,9 @@ TABLE *open_table(THD *thd, TABLE_LIST *table_list, MEM_ROOT *mem_root, ("Found table '%s.%s' with different refresh version", table_list->db, table_list->table_name)); - /* Ignore FLUSH, but not name locks! */ + /* Ignore FLUSH and pending name locks, but not acquired name locks! */ if (flags & MYSQL_LOCK_IGNORE_FLUSH && !table->open_placeholder) { - DBUG_ASSERT(table->db_stat); /* Force close at once after usage */ thd->version= table->s->version; continue; From 3b7f044534ae24ce0a098d598bc7fc7a2b40fe4f Mon Sep 17 00:00:00 2001 From: Sergey Glukhov Date: Wed, 30 Mar 2011 11:00:41 +0400 Subject: [PATCH 167/202] Bug#11766126 59166: ANOTHER DATETIME VALGRIND UNINITIALIZED WARNING Valgrind warning happens because null values check happens too late in Item_func_month::val_str(after result string calculation).The fix is to check null value before result string calculation. mysql-test/r/func_time.result: test case mysql-test/t/func_time.test: test case sql/item_timefunc.h: check null value before result string calculation. --- mysql-test/r/func_time.result | 6 ++++++ mysql-test/t/func_time.test | 6 ++++++ sql/item_timefunc.h | 7 +++++-- 3 files changed, 17 insertions(+), 2 deletions(-) diff --git a/mysql-test/r/func_time.result b/mysql-test/r/func_time.result index bbb506035dc..fd543ba4308 100644 --- a/mysql-test/r/func_time.result +++ b/mysql-test/r/func_time.result @@ -1393,4 +1393,10 @@ SET GLOBAL SQL_MODE=DEFAULT; SELECT FORMAT(YEAR(STR_TO_DATE('',GET_FORMAT(TIME,''))),1); FORMAT(YEAR(STR_TO_DATE('',GET_FORMAT(TIME,''))),1) NULL +# +# Bug#11766126 59166: ANOTHER DATETIME VALGRIND UNINITIALIZED WARNING +# +SELECT CAST((MONTH(FROM_UNIXTIME(@@GLOBAL.SQL_MODE))) AS BINARY(1025)); +CAST((MONTH(FROM_UNIXTIME(@@GLOBAL.SQL_MODE))) AS BINARY(1025)) +NULL End of 5.1 tests diff --git a/mysql-test/t/func_time.test b/mysql-test/t/func_time.test index 2c3d3849793..1bc56c0f403 100644 --- a/mysql-test/t/func_time.test +++ b/mysql-test/t/func_time.test @@ -901,4 +901,10 @@ SET GLOBAL SQL_MODE=DEFAULT; SELECT FORMAT(YEAR(STR_TO_DATE('',GET_FORMAT(TIME,''))),1); +--echo # +--echo # Bug#11766126 59166: ANOTHER DATETIME VALGRIND UNINITIALIZED WARNING +--echo # + +SELECT CAST((MONTH(FROM_UNIXTIME(@@GLOBAL.SQL_MODE))) AS BINARY(1025)); + --echo End of 5.1 tests diff --git a/sql/item_timefunc.h b/sql/item_timefunc.h index 9c1ac512bcb..396b5bbb200 100644 --- a/sql/item_timefunc.h +++ b/sql/item_timefunc.h @@ -106,8 +106,11 @@ public: { DBUG_ASSERT(fixed == 1); return (double) Item_func_month::val_int(); } String *val_str(String *str) { - str->set(val_int(), &my_charset_bin); - return null_value ? 0 : str; + longlong nr= val_int(); + if (null_value) + return 0; + str->set(nr, &my_charset_bin); + return str; } const char *func_name() const { return "month"; } enum Item_result result_type () const { return INT_RESULT; } From a7d383cbb8db5478c1c53a025afda967ad09299b Mon Sep 17 00:00:00 2001 From: Sergey Glukhov Date: Wed, 30 Mar 2011 11:08:35 +0400 Subject: [PATCH 168/202] Bug#11766124 59164: VALGRIND: UNINITIALIZED VALUE IN NUMBER_TO_DATETIME Valgrind warning happens due to missing NULL value check in Item::get_date. The fix is to add this check. mysql-test/r/func_time.result: test case mysql-test/t/func_time.test: test case sql/item.cc: added check for NULL value --- mysql-test/r/func_time.result | 6 ++++++ mysql-test/t/func_time.test | 6 ++++++ sql/item.cc | 6 +++++- 3 files changed, 17 insertions(+), 1 deletion(-) diff --git a/mysql-test/r/func_time.result b/mysql-test/r/func_time.result index fd543ba4308..f67171af99f 100644 --- a/mysql-test/r/func_time.result +++ b/mysql-test/r/func_time.result @@ -1399,4 +1399,10 @@ NULL SELECT CAST((MONTH(FROM_UNIXTIME(@@GLOBAL.SQL_MODE))) AS BINARY(1025)); CAST((MONTH(FROM_UNIXTIME(@@GLOBAL.SQL_MODE))) AS BINARY(1025)) NULL +# +# Bug#11766124 59164: VALGRIND: UNINITIALIZED VALUE IN NUMBER_TO_DATETIME +# +SELECT ADDDATE(MONTH(FROM_UNIXTIME(NULL)),INTERVAL 1 HOUR); +ADDDATE(MONTH(FROM_UNIXTIME(NULL)),INTERVAL 1 HOUR) +NULL End of 5.1 tests diff --git a/mysql-test/t/func_time.test b/mysql-test/t/func_time.test index 1bc56c0f403..938359f8c11 100644 --- a/mysql-test/t/func_time.test +++ b/mysql-test/t/func_time.test @@ -907,4 +907,10 @@ SELECT FORMAT(YEAR(STR_TO_DATE('',GET_FORMAT(TIME,''))),1); SELECT CAST((MONTH(FROM_UNIXTIME(@@GLOBAL.SQL_MODE))) AS BINARY(1025)); +--echo # +--echo # Bug#11766124 59164: VALGRIND: UNINITIALIZED VALUE IN NUMBER_TO_DATETIME +--echo # + +SELECT ADDDATE(MONTH(FROM_UNIXTIME(NULL)),INTERVAL 1 HOUR); + --echo End of 5.1 tests diff --git a/sql/item.cc b/sql/item.cc index 357cc6d7fe4..f90cf562c0b 100644 --- a/sql/item.cc +++ b/sql/item.cc @@ -926,8 +926,12 @@ bool Item::get_date(MYSQL_TIME *ltime,uint fuzzydate) } else { - longlong value= val_int(); int was_cut; + longlong value= val_int(); + + if (null_value) + goto err; + if (number_to_datetime(value, ltime, fuzzydate, &was_cut) == LL(-1)) { char buff[22], *end; From ddec6ecdd8521d6fd6e4c26498e7bd752fd3eddf Mon Sep 17 00:00:00 2001 From: =?UTF-8?q?Marko=20M=C3=A4kel=C3=A4?= Date: Wed, 30 Mar 2011 14:25:58 +0300 Subject: [PATCH 169/202] Bug#11877216 InnoDB too eager to commit suicide on a busy server sync_array_print_long_waits(): Return the longest waiting thread ID and the longest waited-for lock. Only if those remain unchanged between calls in srv_error_monitor_thread(), increment fatal_cnt. Otherwise, reset fatal_cnt. Background: There is a built-in watchdog in InnoDB whose purpose is to kill the server when some thread is stuck waiting for a mutex or rw-lock. Before this fix, the logic was flawed. The function sync_array_print_long_waits() returns TRUE if it finds a lock wait that exceeds 10 minutes (srv_fatal_semaphore_wait_threshold). The function srv_error_monitor_thread() will kill the server if this happens 10 times in a row (fatal_cnt reaches 10), checked every 30 seconds. This is wrong, because this situation does not mean that the server is hung. If the server is very busy for a little over 15 minutes, it will be killed. Consider this example. Thread T1 is waiting for mutex M. Some time later, threads T2..Tn start waiting for the same mutex M. If T1 keeps waiting for 600 seconds, fatal_cnt will be incremented to 1. So far, so good. Now, if M is granted to T1, the server was obviously not stuck. But, T2..Tn keeps waiting, and their wait time will be longer than 600 seconds. If 5 minutes later, some Tn has still been waiting for more than 10 minutes for the mutex M, the server can be killed, even though it is not stuck. rb:622 approved by Jimmy Yang --- storage/innobase/include/sync0arr.h | 11 +++++--- storage/innobase/srv/srv0srv.c | 19 +++++++++---- storage/innobase/sync/sync0arr.c | 36 ++++++++++++++++++------ storage/innodb_plugin/ChangeLog | 5 ++++ storage/innodb_plugin/include/sync0arr.h | 7 +++-- storage/innodb_plugin/srv/srv0srv.c | 11 +++++++- storage/innodb_plugin/sync/sync0arr.c | 32 ++++++++++++++++----- 7 files changed, 93 insertions(+), 28 deletions(-) diff --git a/storage/innobase/include/sync0arr.h b/storage/innobase/include/sync0arr.h index fae26b7a63e..ec48059dbcb 100644 --- a/storage/innobase/include/sync0arr.h +++ b/storage/innobase/include/sync0arr.h @@ -93,10 +93,13 @@ sync_arr_wake_threads_if_sema_free(void); Prints warnings of long semaphore waits to stderr. */ ibool -sync_array_print_long_waits(void); -/*=============================*/ - /* out: TRUE if fatal semaphore wait threshold - was exceeded */ +sync_array_print_long_waits( +/*========================*/ + /* out: TRUE if fatal semaphore wait threshold + was exceeded */ + os_thread_id_t* waiter, /* out: longest waiting thread */ + const void** sema) /* out: longest-waited-for semaphore */ + __attribute__((nonnull)); /************************************************************************ Validates the integrity of the wait array. Checks that the number of reserved cells equals the count variable. */ diff --git a/storage/innobase/srv/srv0srv.c b/storage/innobase/srv/srv0srv.c index 9c34e73109c..3f6f1982992 100644 --- a/storage/innobase/srv/srv0srv.c +++ b/storage/innobase/srv/srv0srv.c @@ -2180,9 +2180,15 @@ srv_error_monitor_thread( os_thread_create */ { /* number of successive fatal timeouts observed */ - ulint fatal_cnt = 0; - dulint old_lsn; - dulint new_lsn; + ulint fatal_cnt = 0; + dulint old_lsn; + dulint new_lsn; + /* longest waiting thread for a semaphore */ + os_thread_id_t waiter = os_thread_get_curr_id(); + os_thread_id_t old_waiter = waiter; + /* the semaphore that is being waited for */ + const void* sema = NULL; + const void* old_sema = NULL; old_lsn = srv_start_lsn; @@ -2224,10 +2230,11 @@ loop: /* In case mutex_exit is not a memory barrier, it is theoretically possible some threads are left waiting though the semaphore is already released. Wake up those threads: */ - + sync_arr_wake_threads_if_sema_free(); - if (sync_array_print_long_waits()) { + if (sync_array_print_long_waits(&waiter, &sema) + && sema == old_sema && os_thread_eq(waiter, old_waiter)) { fatal_cnt++; if (fatal_cnt > 10) { @@ -2242,6 +2249,8 @@ loop: } } else { fatal_cnt = 0; + old_waiter = waiter; + old_sema = sema; } /* Flush stderr so that a database user gets the output diff --git a/storage/innobase/sync/sync0arr.c b/storage/innobase/sync/sync0arr.c index 41d3492c8c9..93a7398f252 100644 --- a/storage/innobase/sync/sync0arr.c +++ b/storage/innobase/sync/sync0arr.c @@ -916,10 +916,12 @@ sync_arr_wake_threads_if_sema_free(void) Prints warnings of long semaphore waits to stderr. */ ibool -sync_array_print_long_waits(void) -/*=============================*/ - /* out: TRUE if fatal semaphore wait threshold - was exceeded */ +sync_array_print_long_waits( +/*========================*/ + /* out: TRUE if fatal semaphore wait threshold + was exceeded */ + os_thread_id_t* waiter, /* out: longest waiting thread */ + const void** sema) /* out: longest-waited-for semaphore */ { sync_cell_t* cell; ibool old_val; @@ -927,24 +929,40 @@ sync_array_print_long_waits(void) ulint i; ulint fatal_timeout = srv_fatal_semaphore_wait_threshold; ibool fatal = FALSE; + double longest_diff = 0; for (i = 0; i < sync_primary_wait_array->n_cells; i++) { + double diff; + void* wait_object; + cell = sync_array_get_nth_cell(sync_primary_wait_array, i); - if (cell->wait_object != NULL && cell->waiting - && difftime(time(NULL), cell->reservation_time) > 240) { + wait_object = cell->wait_object; + + if (wait_object == NULL || !cell->waiting) { + + continue; + } + + diff = difftime(time(NULL), cell->reservation_time); + + if (diff > 240) { fputs("InnoDB: Warning: a long semaphore wait:\n", stderr); sync_array_cell_print(stderr, cell); noticed = TRUE; } - if (cell->wait_object != NULL && cell->waiting - && difftime(time(NULL), cell->reservation_time) - > fatal_timeout) { + if (diff > fatal_timeout) { fatal = TRUE; } + + if (diff > longest_diff) { + longest_diff = diff; + *sema = wait_object; + *waiter = cell->thread; + } } if (noticed) { diff --git a/storage/innodb_plugin/ChangeLog b/storage/innodb_plugin/ChangeLog index 7c82cd9c27f..100cf3690ce 100644 --- a/storage/innodb_plugin/ChangeLog +++ b/storage/innodb_plugin/ChangeLog @@ -1,3 +1,8 @@ +2011-03-30 The InnoDB Team + + * srv/srv0srv.c, sync/sync0arr.h, sync/sync0arr.c: + Fix Bug#11877216 InnoDB too eager to commit suicide on a busy server + 2011-03-15 The InnoDB Team * btr/btr0cur.c, page/page0zip.c: diff --git a/storage/innodb_plugin/include/sync0arr.h b/storage/innodb_plugin/include/sync0arr.h index 5f1280f5e28..6e931346238 100644 --- a/storage/innodb_plugin/include/sync0arr.h +++ b/storage/innodb_plugin/include/sync0arr.h @@ -115,8 +115,11 @@ Prints warnings of long semaphore waits to stderr. @return TRUE if fatal semaphore wait threshold was exceeded */ UNIV_INTERN ibool -sync_array_print_long_waits(void); -/*=============================*/ +sync_array_print_long_waits( +/*========================*/ + os_thread_id_t* waiter, /*!< out: longest waiting thread */ + const void** sema) /*!< out: longest-waited-for semaphore */ + __attribute__((nonnull)); /********************************************************************//** Validates the integrity of the wait array. Checks that the number of reserved cells equals the count variable. */ diff --git a/storage/innodb_plugin/srv/srv0srv.c b/storage/innodb_plugin/srv/srv0srv.c index 3cf17f33c40..b1fc1ac67fd 100644 --- a/storage/innodb_plugin/srv/srv0srv.c +++ b/storage/innodb_plugin/srv/srv0srv.c @@ -2236,6 +2236,12 @@ srv_error_monitor_thread( ulint fatal_cnt = 0; ib_uint64_t old_lsn; ib_uint64_t new_lsn; + /* longest waiting thread for a semaphore */ + os_thread_id_t waiter = os_thread_get_curr_id(); + os_thread_id_t old_waiter = waiter; + /* the semaphore that is being waited for */ + const void* sema = NULL; + const void* old_sema = NULL; old_lsn = srv_start_lsn; @@ -2284,7 +2290,8 @@ loop: sync_arr_wake_threads_if_sema_free(); - if (sync_array_print_long_waits()) { + if (sync_array_print_long_waits(&waiter, &sema) + && sema == old_sema && os_thread_eq(waiter, old_waiter)) { fatal_cnt++; if (fatal_cnt > 10) { @@ -2299,6 +2306,8 @@ loop: } } else { fatal_cnt = 0; + old_waiter = waiter; + old_sema = sema; } /* Flush stderr so that a database user gets the output diff --git a/storage/innodb_plugin/sync/sync0arr.c b/storage/innodb_plugin/sync/sync0arr.c index ad29b90d344..13970023573 100644 --- a/storage/innodb_plugin/sync/sync0arr.c +++ b/storage/innodb_plugin/sync/sync0arr.c @@ -914,8 +914,10 @@ Prints warnings of long semaphore waits to stderr. @return TRUE if fatal semaphore wait threshold was exceeded */ UNIV_INTERN ibool -sync_array_print_long_waits(void) -/*=============================*/ +sync_array_print_long_waits( +/*========================*/ + os_thread_id_t* waiter, /*!< out: longest waiting thread */ + const void** sema) /*!< out: longest-waited-for semaphore */ { sync_cell_t* cell; ibool old_val; @@ -923,24 +925,40 @@ sync_array_print_long_waits(void) ulint i; ulint fatal_timeout = srv_fatal_semaphore_wait_threshold; ibool fatal = FALSE; + double longest_diff = 0; for (i = 0; i < sync_primary_wait_array->n_cells; i++) { + double diff; + void* wait_object; + cell = sync_array_get_nth_cell(sync_primary_wait_array, i); - if (cell->wait_object != NULL && cell->waiting - && difftime(time(NULL), cell->reservation_time) > 240) { + wait_object = cell->wait_object; + + if (wait_object == NULL || !cell->waiting) { + + continue; + } + + diff = difftime(time(NULL), cell->reservation_time); + + if (diff > 240) { fputs("InnoDB: Warning: a long semaphore wait:\n", stderr); sync_array_cell_print(stderr, cell); noticed = TRUE; } - if (cell->wait_object != NULL && cell->waiting - && difftime(time(NULL), cell->reservation_time) - > fatal_timeout) { + if (diff > fatal_timeout) { fatal = TRUE; } + + if (diff > longest_diff) { + longest_diff = diff; + *sema = wait_object; + *waiter = cell->thread; + } } if (noticed) { From 4c1eb0c1719004b66187a166ddf0765cb481a927 Mon Sep 17 00:00:00 2001 From: Bjorn Munch Date: Wed, 30 Mar 2011 14:33:53 +0200 Subject: [PATCH 170/202] mtr: cleaned up some superfluos global warning suppressions --- .../extra/rpl_tests/rpl_extra_col_master.test | 6 +-- mysql-test/include/mix1.inc | 4 ++ mysql-test/include/mtr_warnings.sql | 46 +------------------ mysql-test/r/ctype_cp932_binlog_stm.result | 1 + mysql-test/r/order_by.result | 1 + mysql-test/r/show_check.result | 1 + mysql-test/r/sp-destruct.result | 1 + .../rpl/r/rpl_extra_col_master_innodb.result | 18 ++++---- .../rpl/r/rpl_extra_col_master_myisam.result | 18 ++++---- mysql-test/t/ctype_cp932_binlog_stm.test | 2 + mysql-test/t/order_by.test | 3 +- mysql-test/t/show_check.test | 1 + mysql-test/t/sp-destruct.test | 1 + 13 files changed, 35 insertions(+), 68 deletions(-) diff --git a/mysql-test/extra/rpl_tests/rpl_extra_col_master.test b/mysql-test/extra/rpl_tests/rpl_extra_col_master.test index 6dba4202260..9bab1192d97 100644 --- a/mysql-test/extra/rpl_tests/rpl_extra_col_master.test +++ b/mysql-test/extra/rpl_tests/rpl_extra_col_master.test @@ -123,9 +123,9 @@ SELECT f1,f2,f3,f4,f5,f6,f7,f8,f9, #connection slave; call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column 2 type mismatch.* 1535"); -call mtr.add_suppression("Slave SQL.*Error .Can.t DROP .c7.; check that column.key exists. on query.* 1091"); -call mtr.add_suppression("Slave SQL.*Error .Unknown column .c7. in .t15.. on query.* 1054"); -call mtr.add_suppression("Slave SQL.*Error .Key column .c6. doesn.t exist in table. on query.* 1072"); +call mtr.add_suppression("Slave.*Can.t DROP .c7.; check that column.key exists.* Error_code: 1091"); +call mtr.add_suppression("Slave.*Unknown column .c7. in .t15.* Error_code: 1054"); +call mtr.add_suppression("Slave.*Key column .c6. doesn.t exist in table.* Error_code: 1072"); sync_slave_with_master; --echo diff --git a/mysql-test/include/mix1.inc b/mysql-test/include/mix1.inc index 194d9e41108..10f0d4546ed 100644 --- a/mysql-test/include/mix1.inc +++ b/mysql-test/include/mix1.inc @@ -634,6 +634,10 @@ drop table t1; drop table bug29807; create table bug29807 (a int); drop table bug29807; +--disable_query_log +call mtr.add_suppression("InnoDB: Error: table .test...bug29807. does not exist in the InnoDB internal"); +call mtr.add_suppression("Cannot find or open table test\/bug29807 from"); +--enable_query_log # diff --git a/mysql-test/include/mtr_warnings.sql b/mysql-test/include/mtr_warnings.sql index 30919dd10dc..03148f09fac 100644 --- a/mysql-test/include/mtr_warnings.sql +++ b/mysql-test/include/mtr_warnings.sql @@ -53,7 +53,7 @@ END -- Insert patterns that should always be suppressed -- INSERT INTO global_suppressions VALUES - ("'SELECT UNIX_TIMESTAMP\\(\\)' failed on master"), + (".SELECT UNIX_TIMESTAMP... failed on master"), ("Aborted connection"), ("Client requested master to start replication from impossible position"), ("Could not find first log file name in binary log"), @@ -110,7 +110,6 @@ INSERT INTO global_suppressions VALUES ("Sort aborted"), ("Time-out in NDB"), ("Warning:\s+One can only use the --user.*root"), - ("Warning:\s+Setting lower_case_table_names=2"), ("Warning:\s+Table:.* on (delete|rename)"), ("You have an error in your SQL syntax"), ("deprecated"), @@ -123,55 +122,21 @@ INSERT INTO global_suppressions VALUES ("slave SQL thread aborted"), ("Slave: .*Duplicate entry"), - /* - Special case, made as specific as possible, for: - Bug #28436: Incorrect position in SHOW BINLOG EVENTS causes - server coredump - */ - - ("Error in Log_event::read_log_event\\\(\\\): 'Sanity check failed', data_len: 258, event_type: 49"), - ("Statement may not be safe to log in statement format"), - /* test case for Bug#bug29807 copies a stray frm into database */ - ("InnoDB: Error: table `test`.`bug29807` does not exist in the InnoDB internal"), - ("Cannot find or open table test\/bug29807 from"), - /* innodb foreign key tests that fail in ALTER or RENAME produce this */ ("InnoDB: Error: in ALTER TABLE `test`.`t[123]`"), ("InnoDB: Error: in RENAME TABLE table `test`.`t1`"), ("InnoDB: Error: table `test`.`t[123]` does not exist in the InnoDB internal"), - /* Test case for Bug#14233 produces the following warnings: */ - ("Stored routine 'test'.'bug14233_1': invalid value in column mysql.proc"), - ("Stored routine 'test'.'bug14233_2': invalid value in column mysql.proc"), - ("Stored routine 'test'.'bug14233_3': invalid value in column mysql.proc"), - /* BUG#32080 - Excessive warnings on Solaris: setrlimit could not change the size of core files */ ("setrlimit could not change the size of core files to 'infinity'"), - /* - rpl_extrColmaster_*.test, the slave thread produces warnings - when it get updates to a table that has more columns on the - master - */ - ("Slave: Unknown column 'c7' in 't15' Error_code: 1054"), - ("Slave: Can't DROP 'c7'.* 1091"), - ("Slave: Key column 'c6'.* 1072"), ("The slave I.O thread stops because a fatal error is encountered when it try to get the value of SERVER_ID variable from master."), - (".SELECT UNIX_TIMESTAMP... failed on master, do not trust column Seconds_Behind_Master of SHOW SLAVE STATUS"), - /* Test case for Bug#31590 in order_by.test produces the following error */ - ("Out of sort memory; increase server sort buffer size"), - - /* Special case for Bug #26402 in show_check.test - - Question marks are not valid file name parts on Windows. Ignore - this error message. - */ - ("Can't find file: '.\\\\test\\\\\\?{8}.frm'"), ("Slave: Unknown table 't1' Error_code: 1051"), /* Messages from valgrind */ @@ -189,15 +154,6 @@ INSERT INTO global_suppressions VALUES ("==[0-9]*== Warning: invalid file descriptor -1 in syscall write()"), ("==[0-9]*== Warning: invalid file descriptor -1 in syscall read()"), - /* - Transient network failures that cause warnings on reconnect. - BUG#47743 and BUG#47983. - */ - ("Slave I/O: Get master SERVER_ID failed with error:.*"), - ("Slave I/O: Get master clock failed with error:.*"), - ("Slave I/O: Get master COLLATION_SERVER failed with error:.*"), - ("Slave I/O: Get master TIME_ZONE failed with error:.*"), - ("THE_LAST_SUPPRESSION")|| diff --git a/mysql-test/r/ctype_cp932_binlog_stm.result b/mysql-test/r/ctype_cp932_binlog_stm.result index 8854a835e25..1841cc3ef69 100644 --- a/mysql-test/r/ctype_cp932_binlog_stm.result +++ b/mysql-test/r/ctype_cp932_binlog_stm.result @@ -44,6 +44,7 @@ master-bin.000001 # Query # # use `test`; INSERT INTO t4 VALUES ( NAME_CONST('in master-bin.000001 # Query # # use `test`; DROP PROCEDURE bug18293 master-bin.000001 # Query # # use `test`; DROP TABLE t4 End of 5.0 tests +call mtr.add_suppression("Error in Log_event::read_log_event\\\(\\\): 'Sanity check failed', data_len: 258, event_type: 49"); SHOW BINLOG EVENTS FROM 365; ERROR HY000: Error when executing command SHOW BINLOG EVENTS: Wrong offset or I/O error Bug#44352 UPPER/LOWER function doesn't work correctly on cp932 and sjis environment. diff --git a/mysql-test/r/order_by.result b/mysql-test/r/order_by.result index 30879af418a..90b03711191 100644 --- a/mysql-test/r/order_by.result +++ b/mysql-test/r/order_by.result @@ -1428,6 +1428,7 @@ set session max_sort_length= 2180; select * from t1 order by b; ERROR HY001: Out of sort memory; increase server sort buffer size drop table t1; +call mtr.add_suppression("Out of sort memory; increase server sort buffer size"); # # Bug #39844: Query Crash Mysql Server 5.0.67 # diff --git a/mysql-test/r/show_check.result b/mysql-test/r/show_check.result index 1aa3d62fc70..7cb3f696449 100644 --- a/mysql-test/r/show_check.result +++ b/mysql-test/r/show_check.result @@ -1339,6 +1339,7 @@ drop table `été`; set names latin1; show columns from `#mysql50#????????`; Got one of the listed errors +call mtr.add_suppression("Can.t find file: '.\\\\test\\\\\\?{8}.frm'"); DROP TABLE IF EXISTS t1; DROP PROCEDURE IF EXISTS p1; CREATE TABLE t1(c1 INT); diff --git a/mysql-test/r/sp-destruct.result b/mysql-test/r/sp-destruct.result index b6891df2420..a9db461e84e 100644 --- a/mysql-test/r/sp-destruct.result +++ b/mysql-test/r/sp-destruct.result @@ -1,4 +1,5 @@ call mtr.add_suppression("Column count of mysql.proc is wrong. Expected 20, found 19. The table is probably corrupted"); +call mtr.add_suppression("Stored routine .test...bug14233_[123].: invalid value in column mysql.proc"); use test; drop procedure if exists bug14233; drop function if exists bug14233; diff --git a/mysql-test/suite/rpl/r/rpl_extra_col_master_innodb.result b/mysql-test/suite/rpl/r/rpl_extra_col_master_innodb.result index f235c68cc95..160f970fd5e 100644 --- a/mysql-test/suite/rpl/r/rpl_extra_col_master_innodb.result +++ b/mysql-test/suite/rpl/r/rpl_extra_col_master_innodb.result @@ -59,9 +59,9 @@ f1 f2 f3 f4 f5 f6 f7 f8 f9 hex(f10) hex(f11) 29 29 29 second 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 30 30 30 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column 2 type mismatch.* 1535"); -call mtr.add_suppression("Slave SQL.*Error .Can.t DROP .c7.; check that column.key exists. on query.* 1091"); -call mtr.add_suppression("Slave SQL.*Error .Unknown column .c7. in .t15.. on query.* 1054"); -call mtr.add_suppression("Slave SQL.*Error .Key column .c6. doesn.t exist in table. on query.* 1072"); +call mtr.add_suppression("Slave.*Can.t DROP .c7.; check that column.key exists.* Error_code: 1091"); +call mtr.add_suppression("Slave.*Unknown column .c7. in .t15.* Error_code: 1054"); +call mtr.add_suppression("Slave.*Key column .c6. doesn.t exist in table.* Error_code: 1072"); * Select count and 20 rows from Slave * @@ -934,9 +934,9 @@ f1 f2 f3 f4 f5 f6 f7 f8 f9 hex(f10) hex(f11) 29 29 29 second 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 30 30 30 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column 2 type mismatch.* 1535"); -call mtr.add_suppression("Slave SQL.*Error .Can.t DROP .c7.; check that column.key exists. on query.* 1091"); -call mtr.add_suppression("Slave SQL.*Error .Unknown column .c7. in .t15.. on query.* 1054"); -call mtr.add_suppression("Slave SQL.*Error .Key column .c6. doesn.t exist in table. on query.* 1072"); +call mtr.add_suppression("Slave.*Can.t DROP .c7.; check that column.key exists.* Error_code: 1091"); +call mtr.add_suppression("Slave.*Unknown column .c7. in .t15.* Error_code: 1054"); +call mtr.add_suppression("Slave.*Key column .c6. doesn.t exist in table.* Error_code: 1072"); * Select count and 20 rows from Slave * @@ -1809,9 +1809,9 @@ f1 f2 f3 f4 f5 f6 f7 f8 f9 hex(f10) hex(f11) 29 29 29 second 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 30 30 30 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column 2 type mismatch.* 1535"); -call mtr.add_suppression("Slave SQL.*Error .Can.t DROP .c7.; check that column.key exists. on query.* 1091"); -call mtr.add_suppression("Slave SQL.*Error .Unknown column .c7. in .t15.. on query.* 1054"); -call mtr.add_suppression("Slave SQL.*Error .Key column .c6. doesn.t exist in table. on query.* 1072"); +call mtr.add_suppression("Slave.*Can.t DROP .c7.; check that column.key exists.* Error_code: 1091"); +call mtr.add_suppression("Slave.*Unknown column .c7. in .t15.* Error_code: 1054"); +call mtr.add_suppression("Slave.*Key column .c6. doesn.t exist in table.* Error_code: 1072"); * Select count and 20 rows from Slave * diff --git a/mysql-test/suite/rpl/r/rpl_extra_col_master_myisam.result b/mysql-test/suite/rpl/r/rpl_extra_col_master_myisam.result index 52f4a7a8453..11356dd8620 100644 --- a/mysql-test/suite/rpl/r/rpl_extra_col_master_myisam.result +++ b/mysql-test/suite/rpl/r/rpl_extra_col_master_myisam.result @@ -59,9 +59,9 @@ f1 f2 f3 f4 f5 f6 f7 f8 f9 hex(f10) hex(f11) 29 29 29 second 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 30 30 30 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column 2 type mismatch.* 1535"); -call mtr.add_suppression("Slave SQL.*Error .Can.t DROP .c7.; check that column.key exists. on query.* 1091"); -call mtr.add_suppression("Slave SQL.*Error .Unknown column .c7. in .t15.. on query.* 1054"); -call mtr.add_suppression("Slave SQL.*Error .Key column .c6. doesn.t exist in table. on query.* 1072"); +call mtr.add_suppression("Slave.*Can.t DROP .c7.; check that column.key exists.* Error_code: 1091"); +call mtr.add_suppression("Slave.*Unknown column .c7. in .t15.* Error_code: 1054"); +call mtr.add_suppression("Slave.*Key column .c6. doesn.t exist in table.* Error_code: 1072"); * Select count and 20 rows from Slave * @@ -934,9 +934,9 @@ f1 f2 f3 f4 f5 f6 f7 f8 f9 hex(f10) hex(f11) 29 29 29 second 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 30 30 30 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column 2 type mismatch.* 1535"); -call mtr.add_suppression("Slave SQL.*Error .Can.t DROP .c7.; check that column.key exists. on query.* 1091"); -call mtr.add_suppression("Slave SQL.*Error .Unknown column .c7. in .t15.. on query.* 1054"); -call mtr.add_suppression("Slave SQL.*Error .Key column .c6. doesn.t exist in table. on query.* 1072"); +call mtr.add_suppression("Slave.*Can.t DROP .c7.; check that column.key exists.* Error_code: 1091"); +call mtr.add_suppression("Slave.*Unknown column .c7. in .t15.* Error_code: 1054"); +call mtr.add_suppression("Slave.*Key column .c6. doesn.t exist in table.* Error_code: 1072"); * Select count and 20 rows from Slave * @@ -1809,9 +1809,9 @@ f1 f2 f3 f4 f5 f6 f7 f8 f9 hex(f10) hex(f11) 29 29 29 second 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 30 30 30 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column 2 type mismatch.* 1535"); -call mtr.add_suppression("Slave SQL.*Error .Can.t DROP .c7.; check that column.key exists. on query.* 1091"); -call mtr.add_suppression("Slave SQL.*Error .Unknown column .c7. in .t15.. on query.* 1054"); -call mtr.add_suppression("Slave SQL.*Error .Key column .c6. doesn.t exist in table. on query.* 1072"); +call mtr.add_suppression("Slave.*Can.t DROP .c7.; check that column.key exists.* Error_code: 1091"); +call mtr.add_suppression("Slave.*Unknown column .c7. in .t15.* Error_code: 1054"); +call mtr.add_suppression("Slave.*Key column .c6. doesn.t exist in table.* Error_code: 1072"); * Select count and 20 rows from Slave * diff --git a/mysql-test/t/ctype_cp932_binlog_stm.test b/mysql-test/t/ctype_cp932_binlog_stm.test index f3038ccfa61..95252a95368 100644 --- a/mysql-test/t/ctype_cp932_binlog_stm.test +++ b/mysql-test/t/ctype_cp932_binlog_stm.test @@ -33,6 +33,8 @@ delimiter ;| # Note: 364 is a magic position (found experimentally, depends on # the log's contents) that caused the server crash. +call mtr.add_suppression("Error in Log_event::read_log_event\\\(\\\): 'Sanity check failed', data_len: 258, event_type: 49"); + --error 1220 SHOW BINLOG EVENTS FROM 365; diff --git a/mysql-test/t/order_by.test b/mysql-test/t/order_by.test index 1064320b65c..e310d960c97 100644 --- a/mysql-test/t/order_by.test +++ b/mysql-test/t/order_by.test @@ -846,8 +846,7 @@ set session max_sort_length= 2180; --error 1038 select * from t1 order by b; drop table t1; - - +call mtr.add_suppression("Out of sort memory; increase server sort buffer size"); --echo # --echo # Bug #39844: Query Crash Mysql Server 5.0.67 --echo # diff --git a/mysql-test/t/show_check.test b/mysql-test/t/show_check.test index d46261f38d2..e5ca35bda32 100644 --- a/mysql-test/t/show_check.test +++ b/mysql-test/t/show_check.test @@ -1064,6 +1064,7 @@ set names latin1; # --error ER_NO_SUCH_TABLE,ER_FILE_NOT_FOUND show columns from `#mysql50#????????`; +call mtr.add_suppression("Can.t find file: '.\\\\test\\\\\\?{8}.frm'"); # # SHOW CREATE TRIGGER test. diff --git a/mysql-test/t/sp-destruct.test b/mysql-test/t/sp-destruct.test index 720c24b2c24..b006a36b8fd 100644 --- a/mysql-test/t/sp-destruct.test +++ b/mysql-test/t/sp-destruct.test @@ -14,6 +14,7 @@ # Supress warnings written to the log file call mtr.add_suppression("Column count of mysql.proc is wrong. Expected 20, found 19. The table is probably corrupted"); +call mtr.add_suppression("Stored routine .test...bug14233_[123].: invalid value in column mysql.proc"); # Backup proc table let $MYSQLD_DATADIR= `select @@datadir`; From b8faa8f2c69a13c83d763f8d8605dcf3612c1257 Mon Sep 17 00:00:00 2001 From: Magne Mahre Date: Wed, 30 Mar 2011 16:14:13 +0200 Subject: [PATCH 171/202] Fix-up after commit of Bug#11900714 The patch fixes a build problem on MacOSX, where the compiler complains about unused parameters. --- mysys/my_net.c | 6 ++++-- 1 file changed, 4 insertions(+), 2 deletions(-) diff --git a/mysys/my_net.c b/mysys/my_net.c index 3d139bb46c3..e2cc0679134 100644 --- a/mysys/my_net.c +++ b/mysys/my_net.c @@ -112,8 +112,10 @@ extern pthread_mutex_t LOCK_gethostbyname_r; */ struct hostent *my_gethostbyname_r(const char *name, - struct hostent *result, char *buffer, - int buflen, int *h_errnop) + struct hostent *result __attribute__((unused)), + char *buffer __attribute__((unused)), + int buflen __attribute__((unused)), + int *h_errnop) { struct hostent *hp; pthread_mutex_lock(&LOCK_gethostbyname_r); From 997eb49e49077fe3f65cfdf488f1f8807ba4b311 Mon Sep 17 00:00:00 2001 From: Bjorn Munch Date: Thu, 31 Mar 2011 10:33:07 +0200 Subject: [PATCH 172/202] Small followup fix after MTR warning cleanup --- mysql-test/extra/rpl_tests/rpl_extra_col_master.test | 3 +++ .../suite/rpl/r/rpl_extra_col_master_innodb.result | 12 ------------ .../suite/rpl/r/rpl_extra_col_master_myisam.result | 12 ------------ 3 files changed, 3 insertions(+), 24 deletions(-) diff --git a/mysql-test/extra/rpl_tests/rpl_extra_col_master.test b/mysql-test/extra/rpl_tests/rpl_extra_col_master.test index 9bab1192d97..981adcf6d54 100644 --- a/mysql-test/extra/rpl_tests/rpl_extra_col_master.test +++ b/mysql-test/extra/rpl_tests/rpl_extra_col_master.test @@ -122,10 +122,13 @@ SELECT f1,f2,f3,f4,f5,f6,f7,f8,f9, #connection slave; +--disable_query_log call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column 2 type mismatch.* 1535"); call mtr.add_suppression("Slave.*Can.t DROP .c7.; check that column.key exists.* Error_code: 1091"); call mtr.add_suppression("Slave.*Unknown column .c7. in .t15.* Error_code: 1054"); call mtr.add_suppression("Slave.*Key column .c6. doesn.t exist in table.* Error_code: 1072"); +call mtr.add_suppression("Slave I/O: Get master clock failed with error:.* Error_code: 2013"); +--enable_query_log sync_slave_with_master; --echo diff --git a/mysql-test/suite/rpl/r/rpl_extra_col_master_innodb.result b/mysql-test/suite/rpl/r/rpl_extra_col_master_innodb.result index 160f970fd5e..affb179d50e 100644 --- a/mysql-test/suite/rpl/r/rpl_extra_col_master_innodb.result +++ b/mysql-test/suite/rpl/r/rpl_extra_col_master_innodb.result @@ -58,10 +58,6 @@ f1 f2 f3 f4 f5 f6 f7 f8 f9 hex(f10) hex(f11) 27 27 27 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 29 29 29 second 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 30 30 30 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 -call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column 2 type mismatch.* 1535"); -call mtr.add_suppression("Slave.*Can.t DROP .c7.; check that column.key exists.* Error_code: 1091"); -call mtr.add_suppression("Slave.*Unknown column .c7. in .t15.* Error_code: 1054"); -call mtr.add_suppression("Slave.*Key column .c6. doesn.t exist in table.* Error_code: 1072"); * Select count and 20 rows from Slave * @@ -933,10 +929,6 @@ f1 f2 f3 f4 f5 f6 f7 f8 f9 hex(f10) hex(f11) 27 27 27 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 29 29 29 second 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 30 30 30 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 -call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column 2 type mismatch.* 1535"); -call mtr.add_suppression("Slave.*Can.t DROP .c7.; check that column.key exists.* Error_code: 1091"); -call mtr.add_suppression("Slave.*Unknown column .c7. in .t15.* Error_code: 1054"); -call mtr.add_suppression("Slave.*Key column .c6. doesn.t exist in table.* Error_code: 1072"); * Select count and 20 rows from Slave * @@ -1808,10 +1800,6 @@ f1 f2 f3 f4 f5 f6 f7 f8 f9 hex(f10) hex(f11) 27 27 27 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 29 29 29 second 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 30 30 30 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 -call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column 2 type mismatch.* 1535"); -call mtr.add_suppression("Slave.*Can.t DROP .c7.; check that column.key exists.* Error_code: 1091"); -call mtr.add_suppression("Slave.*Unknown column .c7. in .t15.* Error_code: 1054"); -call mtr.add_suppression("Slave.*Key column .c6. doesn.t exist in table.* Error_code: 1072"); * Select count and 20 rows from Slave * diff --git a/mysql-test/suite/rpl/r/rpl_extra_col_master_myisam.result b/mysql-test/suite/rpl/r/rpl_extra_col_master_myisam.result index 11356dd8620..8aeb5bdc1c9 100644 --- a/mysql-test/suite/rpl/r/rpl_extra_col_master_myisam.result +++ b/mysql-test/suite/rpl/r/rpl_extra_col_master_myisam.result @@ -58,10 +58,6 @@ f1 f2 f3 f4 f5 f6 f7 f8 f9 hex(f10) hex(f11) 27 27 27 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 29 29 29 second 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 30 30 30 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 -call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column 2 type mismatch.* 1535"); -call mtr.add_suppression("Slave.*Can.t DROP .c7.; check that column.key exists.* Error_code: 1091"); -call mtr.add_suppression("Slave.*Unknown column .c7. in .t15.* Error_code: 1054"); -call mtr.add_suppression("Slave.*Key column .c6. doesn.t exist in table.* Error_code: 1072"); * Select count and 20 rows from Slave * @@ -933,10 +929,6 @@ f1 f2 f3 f4 f5 f6 f7 f8 f9 hex(f10) hex(f11) 27 27 27 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 29 29 29 second 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 30 30 30 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 -call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column 2 type mismatch.* 1535"); -call mtr.add_suppression("Slave.*Can.t DROP .c7.; check that column.key exists.* Error_code: 1091"); -call mtr.add_suppression("Slave.*Unknown column .c7. in .t15.* Error_code: 1054"); -call mtr.add_suppression("Slave.*Key column .c6. doesn.t exist in table.* Error_code: 1072"); * Select count and 20 rows from Slave * @@ -1808,10 +1800,6 @@ f1 f2 f3 f4 f5 f6 f7 f8 f9 hex(f10) hex(f11) 27 27 27 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 29 29 29 second 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 30 30 30 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 -call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column 2 type mismatch.* 1535"); -call mtr.add_suppression("Slave.*Can.t DROP .c7.; check that column.key exists.* Error_code: 1091"); -call mtr.add_suppression("Slave.*Unknown column .c7. in .t15.* Error_code: 1054"); -call mtr.add_suppression("Slave.*Key column .c6. doesn.t exist in table.* Error_code: 1072"); * Select count and 20 rows from Slave * From fc7a12c05d179bf749a650b79c86574d095458b1 Mon Sep 17 00:00:00 2001 From: Bjorn Munch Date: Thu, 31 Mar 2011 15:48:05 +0200 Subject: [PATCH 173/202] One more test suppression for rpl_extra_col_master tests --- mysql-test/extra/rpl_tests/rpl_extra_col_master.test | 1 + 1 file changed, 1 insertion(+) diff --git a/mysql-test/extra/rpl_tests/rpl_extra_col_master.test b/mysql-test/extra/rpl_tests/rpl_extra_col_master.test index 981adcf6d54..1c103512318 100644 --- a/mysql-test/extra/rpl_tests/rpl_extra_col_master.test +++ b/mysql-test/extra/rpl_tests/rpl_extra_col_master.test @@ -128,6 +128,7 @@ call mtr.add_suppression("Slave.*Can.t DROP .c7.; check that column.key exists.* call mtr.add_suppression("Slave.*Unknown column .c7. in .t15.* Error_code: 1054"); call mtr.add_suppression("Slave.*Key column .c6. doesn.t exist in table.* Error_code: 1072"); call mtr.add_suppression("Slave I/O: Get master clock failed with error:.* Error_code: 2013"); +call mtr.add_suppression("Slave I/O: Get master SERVER_ID failed with error:.* Error_code: 2013"); --enable_query_log sync_slave_with_master; From 7aa81e2a02e78200eec105b968bda675af6f4987 Mon Sep 17 00:00:00 2001 From: Gleb Shchepa Date: Thu, 31 Mar 2011 22:59:11 +0400 Subject: [PATCH 174/202] Bug #11766094 - 59132: MIN() AND MAX() REMOVE UNSIGNEDNESS In the string context the MIN() and MAX() functions don't take into account the unsignedness of the UNSIGNED BIGINT argument column. I.e.: CREATE TABLE t1 (a BIGINT UNSIGNED); INSERT INTO t1 VALUES (18446668621106209655); SELECT CONCAT(MAX(a)) FROM t1; returns -75452603341961. mysql-test/r/func_group.result: Test case for bug #11766094. mysql-test/t/func_group.test: Test case for bug #11766094. sql/item.cc: Bug #11766094 - 59132: MIN() AND MAX() REMOVE UNSIGNEDNESS The Item_cache_int::val_str() method has been modified to take into account the unsigned_flag value when converting data to string. --- mysql-test/r/func_group.result | 9 +++++++++ mysql-test/t/func_group.test | 10 ++++++++++ sql/item.cc | 2 +- 3 files changed, 20 insertions(+), 1 deletion(-) diff --git a/mysql-test/r/func_group.result b/mysql-test/r/func_group.result index 1a21fb5872f..69bce1c8bd8 100644 --- a/mysql-test/r/func_group.result +++ b/mysql-test/r/func_group.result @@ -1737,4 +1737,13 @@ SELECT MIN(GET_LOCK('aaaaaaaaaaaaaaaaa',0) / '0b11111111111111111111111111111111 SELECT MIN(GET_LOCK('aaaaaaaaaaaaaaaaa',0) / '0b1111111111111111111111111111111111111111111111111111111111111111111111111' ^ (RAND())); SELECT RELEASE_LOCK('aaaaaaaaaaaaaaaaa'); # +# Bug #11766094 - 59132: MIN() AND MAX() REMOVE UNSIGNEDNESS +# +CREATE TABLE t1 (a BIGINT UNSIGNED); +INSERT INTO t1 VALUES (18446668621106209655); +SELECT MAX(LENGTH(a)), LENGTH(MAX(a)), MIN(a), MAX(a), CONCAT(MIN(a)), CONCAT(MAX(a)) FROM t1; +MAX(LENGTH(a)) LENGTH(MAX(a)) MIN(a) MAX(a) CONCAT(MIN(a)) CONCAT(MAX(a)) +20 20 18446668621106209655 18446668621106209655 18446668621106209655 18446668621106209655 +DROP TABLE t1; +# End of 5.1 tests diff --git a/mysql-test/t/func_group.test b/mysql-test/t/func_group.test index 8839a28b9dd..600b46fcde6 100644 --- a/mysql-test/t/func_group.test +++ b/mysql-test/t/func_group.test @@ -1117,6 +1117,16 @@ SELECT RELEASE_LOCK('aaaaaaaaaaaaaaaaa'); --enable_result_log + +--echo # +--echo # Bug #11766094 - 59132: MIN() AND MAX() REMOVE UNSIGNEDNESS +--echo # + +CREATE TABLE t1 (a BIGINT UNSIGNED); +INSERT INTO t1 VALUES (18446668621106209655); +SELECT MAX(LENGTH(a)), LENGTH(MAX(a)), MIN(a), MAX(a), CONCAT(MIN(a)), CONCAT(MAX(a)) FROM t1; +DROP TABLE t1; + --echo # --echo End of 5.1 tests diff --git a/sql/item.cc b/sql/item.cc index f90cf562c0b..24c3107ece9 100644 --- a/sql/item.cc +++ b/sql/item.cc @@ -7109,7 +7109,7 @@ String *Item_cache_int::val_str(String *str) DBUG_ASSERT(fixed == 1); if (!value_cached && !cache_value()) return NULL; - str->set(value, default_charset()); + str->set_int(value, unsigned_flag, default_charset()); return str; } From 5321b3a57a5191471cba0db85a11e21fb702200a Mon Sep 17 00:00:00 2001 From: Georgi Kodinov Date: Mon, 4 Apr 2011 16:04:15 +0300 Subject: [PATCH 175/202] Bug #11758687: 50924: object names not resolved correctly on lctn2 systems There was a local variable in get_all_tables() to store the "original" value of the database name as it can get lowercased depending on the lower_case_table_name value. get_all_tables() iterates over database names and for each database iterates over the tables in it. The "original" db name was assigned in the table names loop. Thus the first table is ok, but the second and subsequent tables get the lowercased name from processing the first table. Fixed by moving the assignment of the original database name from the inner (table name) to the outer (database name) loop. Test suite added. --- mysql-test/r/lowercase_table2.result | 30 ++++++++++++++++++++++ mysql-test/t/lowercase_table2.test | 37 ++++++++++++++++++++++++++++ mysys/my_net.c | 11 +++++---- sql/sql_show.cc | 12 +++++---- 4 files changed, 80 insertions(+), 10 deletions(-) diff --git a/mysql-test/r/lowercase_table2.result b/mysql-test/r/lowercase_table2.result index c9a46b70fab..ee555a9006c 100644 --- a/mysql-test/r/lowercase_table2.result +++ b/mysql-test/r/lowercase_table2.result @@ -175,3 +175,33 @@ TABLE_SCHEMA TABLE_NAME mysqltest_lc2 myUC use test; drop database mysqltest_LC2; +# +# Bug #11758687: 50924: object names not resolved correctly +# on lctn2 systems +# +CREATE DATABASE BUP_XPFM_COMPAT_DB2; +CREATE TABLE BUP_XPFM_COMPAT_DB2.TABLE2 (c13 INT) DEFAULT CHARSET latin1; +CREATE TABLE BUP_XPFM_COMPAT_DB2.table1 (c13 INT) DEFAULT CHARSET latin1; +CREATE TABLE bup_xpfm_compat_db2.table3 (c13 INT) DEFAULT CHARSET latin1; +CREATE TRIGGER BUP_XPFM_COMPAT_DB2.trigger1 AFTER INSERT +ON BUP_XPFM_COMPAT_DB2.table1 FOR EACH ROW +update BUP_XPFM_COMPAT_DB2.table1 set c13=12; +| +CREATE TRIGGER BUP_XPFM_COMPAT_DB2.TRIGGER2 AFTER INSERT +ON BUP_XPFM_COMPAT_DB2.TABLE2 FOR EACH ROW +update BUP_XPFM_COMPAT_DB2.table1 set c13=12; +| +CREATE TRIGGER BUP_XPFM_COMPAT_DB2.TrigGer3 AFTER INSERT +ON BUP_XPFM_COMPAT_DB2.TaBle3 FOR EACH ROW +update BUP_XPFM_COMPAT_DB2.table1 set c13=12; +| +SELECT trigger_schema, trigger_name, event_object_table FROM +INFORMATION_SCHEMA.TRIGGERS +WHERE trigger_schema COLLATE utf8_bin = 'BUP_XPFM_COMPAT_DB2' + ORDER BY trigger_schema, trigger_name; +trigger_schema trigger_name event_object_table +BUP_XPFM_COMPAT_DB2 trigger1 table1 +BUP_XPFM_COMPAT_DB2 TRIGGER2 TABLE2 +BUP_XPFM_COMPAT_DB2 TrigGer3 table3 +DROP DATABASE BUP_XPFM_COMPAT_DB2; +End of 5.1 tests diff --git a/mysql-test/t/lowercase_table2.test b/mysql-test/t/lowercase_table2.test index 521df01cc9b..b595d4b1775 100644 --- a/mysql-test/t/lowercase_table2.test +++ b/mysql-test/t/lowercase_table2.test @@ -150,3 +150,40 @@ select TABLE_SCHEMA,TABLE_NAME FROM information_schema.TABLES where TABLE_SCHEMA ='mysqltest_LC2'; use test; drop database mysqltest_LC2; + + +--echo # +--echo # Bug #11758687: 50924: object names not resolved correctly +--echo # on lctn2 systems +--echo # + +CREATE DATABASE BUP_XPFM_COMPAT_DB2; + +CREATE TABLE BUP_XPFM_COMPAT_DB2.TABLE2 (c13 INT) DEFAULT CHARSET latin1; +CREATE TABLE BUP_XPFM_COMPAT_DB2.table1 (c13 INT) DEFAULT CHARSET latin1; +CREATE TABLE bup_xpfm_compat_db2.table3 (c13 INT) DEFAULT CHARSET latin1; + +delimiter |; +# +CREATE TRIGGER BUP_XPFM_COMPAT_DB2.trigger1 AFTER INSERT + ON BUP_XPFM_COMPAT_DB2.table1 FOR EACH ROW + update BUP_XPFM_COMPAT_DB2.table1 set c13=12; +| +CREATE TRIGGER BUP_XPFM_COMPAT_DB2.TRIGGER2 AFTER INSERT + ON BUP_XPFM_COMPAT_DB2.TABLE2 FOR EACH ROW + update BUP_XPFM_COMPAT_DB2.table1 set c13=12; +| +CREATE TRIGGER BUP_XPFM_COMPAT_DB2.TrigGer3 AFTER INSERT + ON BUP_XPFM_COMPAT_DB2.TaBle3 FOR EACH ROW + update BUP_XPFM_COMPAT_DB2.table1 set c13=12; +| +delimiter ;| + +SELECT trigger_schema, trigger_name, event_object_table FROM +INFORMATION_SCHEMA.TRIGGERS + WHERE trigger_schema COLLATE utf8_bin = 'BUP_XPFM_COMPAT_DB2' + ORDER BY trigger_schema, trigger_name; + +DROP DATABASE BUP_XPFM_COMPAT_DB2; + +--echo End of 5.1 tests diff --git a/mysys/my_net.c b/mysys/my_net.c index e2cc0679134..820abf32386 100644 --- a/mysys/my_net.c +++ b/mysys/my_net.c @@ -111,11 +111,12 @@ extern pthread_mutex_t LOCK_gethostbyname_r; is finished with the structure. */ -struct hostent *my_gethostbyname_r(const char *name, - struct hostent *result __attribute__((unused)), - char *buffer __attribute__((unused)), - int buflen __attribute__((unused)), - int *h_errnop) +struct hostent * +my_gethostbyname_r(const char *name, + struct hostent *result __attribute__((unused)), + char *buffer __attribute__((unused)), + int buflen __attribute__((unused)), + int *h_errnop) { struct hostent *hp; pthread_mutex_lock(&LOCK_gethostbyname_r); diff --git a/sql/sql_show.cc b/sql/sql_show.cc index 1524a8fb87f..5b835096042 100644 --- a/sql/sql_show.cc +++ b/sql/sql_show.cc @@ -3399,6 +3399,12 @@ int get_all_tables(THD *thd, TABLE_LIST *tables, COND *cond) it.rewind(); /* To get access to new elements in basis list */ while ((db_name= it++)) { + LEX_STRING orig_db_name; + + /* db_name can be changed in make_table_list() func */ + if (!thd->make_lex_string(&orig_db_name, db_name->str, + db_name->length, FALSE)) + goto err; #ifndef NO_EMBEDDED_ACCESS_CHECKS if (!(check_access(thd,SELECT_ACL, db_name->str, &thd->col_access, 0, 1, with_i_schema) || @@ -3461,17 +3467,13 @@ int get_all_tables(THD *thd, TABLE_LIST *tables, COND *cond) } int res; - LEX_STRING tmp_lex_string, orig_db_name; + LEX_STRING tmp_lex_string; /* Set the parent lex of 'sel' because it is needed by sel.init_query() which is called inside make_table_list. */ thd->no_warnings_for_error= 1; sel.parent_lex= lex; - /* db_name can be changed in make_table_list() func */ - if (!thd->make_lex_string(&orig_db_name, db_name->str, - db_name->length, FALSE)) - goto err; if (make_table_list(thd, &sel, db_name, table_name)) goto err; TABLE_LIST *show_table_list= sel.table_list.first; From dc65d9217c36a0edc8fab0a4a09fbeda7a5c278d Mon Sep 17 00:00:00 2001 From: Guilhem Bichot Date: Thu, 7 Apr 2011 15:09:19 +0200 Subject: [PATCH 176/202] Fix for Bug#11765141 - "58072: LOAD DATA INFILE: LEAKS IO CACHE MEMORY WHEN ERROR OCCURS" mysql-test/t/loaddata.test: test for bug; without fix, running the test with --valgrind would show the leak and make the test fail. sql/sql_load.cc: * In READ_INFO class, 'need_end_io_cache' is true as long as init_io_cache() was called, so if it's true, we need to call end_io_cache(), to free memory allocated by init_io_cache(). No matter the value of 'error'. In the bug's scenario, 'error' was set to true in read_sep_field() because '1' (read from file) isn't suitable to load into a geometric column. Because of 'error', end_io_cache() was not called. Note: end_io_cache() calls my_b_flush_io_cache(), which will do nothing wrong given that the file is opened for reads only; see the init_io_cache() call which uses only those read-only types: (get_it_from_net) ? READ_NET : (is_fifo ? READ_FIFO : READ_CACHE). IF the cache were rather used to write to the file, my_b_flush_io_cache() may write to it, and it may be questionable to write to the file if 'error' is true. But here there's no problem. * Now that 'need_end_io_cache' is checked even if 'error' is true, it needs to be initialized in all cases. * Bonus: move some variables to the initialization list. --- mysql-test/r/loaddata.result | 9 +++++++++ mysql-test/t/loaddata.test | 15 +++++++++++++++ sql/sql_load.cc | 9 ++++----- 3 files changed, 28 insertions(+), 5 deletions(-) diff --git a/mysql-test/r/loaddata.result b/mysql-test/r/loaddata.result index 3a421b3ea3f..59a1b904744 100644 --- a/mysql-test/r/loaddata.result +++ b/mysql-test/r/loaddata.result @@ -539,4 +539,13 @@ CREATE TABLE t1(f1 INT); SELECT 0xE1BB30 INTO OUTFILE 't1.dat'; LOAD DATA INFILE 't1.dat' IGNORE INTO TABLE t1 CHARACTER SET utf8; DROP TABLE t1; +# +# Bug#11765141 - 58072: LOAD DATA INFILE: LEAKS IO CACHE MEMORY +# WHEN ERROR OCCURS +# +SELECT '1\n' INTO DUMPFILE 'MYSQLTEST_VARDIR/tmp/bug11735141.txt'; +create table t1(a point); +LOAD DATA INFILE 'MYSQLTEST_VARDIR/tmp/bug11735141.txt' INTO TABLE t1; +ERROR 22003: Cannot get geometry object from data you send to the GEOMETRY field +drop table t1; End of 5.1 tests diff --git a/mysql-test/t/loaddata.test b/mysql-test/t/loaddata.test index e0764b67ec0..3d0fdea05ed 100644 --- a/mysql-test/t/loaddata.test +++ b/mysql-test/t/loaddata.test @@ -625,4 +625,19 @@ DROP TABLE t1; let $MYSQLD_DATADIR= `select @@datadir`; remove_file $MYSQLD_DATADIR/test/t1.dat; +--echo # +--echo # Bug#11765141 - 58072: LOAD DATA INFILE: LEAKS IO CACHE MEMORY +--echo # WHEN ERROR OCCURS +--echo # + +--let $file=$MYSQLTEST_VARDIR/tmp/bug11735141.txt +--replace_result $MYSQLTEST_VARDIR MYSQLTEST_VARDIR +--eval SELECT '1\n' INTO DUMPFILE '$file' + +create table t1(a point); +--replace_result $MYSQLTEST_VARDIR MYSQLTEST_VARDIR +--error ER_CANT_CREATE_GEOMETRY_OBJECT +--eval LOAD DATA INFILE '$file' INTO TABLE t1 +drop table t1; + --echo End of 5.1 tests diff --git a/sql/sql_load.cc b/sql/sql_load.cc index 513cd62b510..b9b7bd74f6c 100644 --- a/sql/sql_load.cc +++ b/sql/sql_load.cc @@ -1075,9 +1075,10 @@ READ_INFO::READ_INFO(File file_par, uint tot_length, CHARSET_INFO *cs, String &field_term, String &line_start, String &line_term, String &enclosed_par, int escape, bool get_it_from_net, bool is_fifo) - :file(file_par),escape_char(escape) + :file(file_par), buff_length(tot_length), escape_char(escape), + found_end_of_line(false), eof(false), need_end_io_cache(false), + error(false), line_cuted(false), found_null(false), read_charset(cs) { - read_charset= cs; field_term_ptr=(char*) field_term.ptr(); field_term_length= field_term.length(); line_term_ptr=(char*) line_term.ptr(); @@ -1104,8 +1105,6 @@ READ_INFO::READ_INFO(File file_par, uint tot_length, CHARSET_INFO *cs, (uchar) enclosed_par[0] : INT_MAX; field_term_char= field_term_length ? (uchar) field_term_ptr[0] : INT_MAX; line_term_char= line_term_length ? (uchar) line_term_ptr[0] : INT_MAX; - error=eof=found_end_of_line=found_null=line_cuted=0; - buff_length=tot_length; /* Set of a stack for unget if long terminators */ @@ -1151,7 +1150,7 @@ READ_INFO::READ_INFO(File file_par, uint tot_length, CHARSET_INFO *cs, READ_INFO::~READ_INFO() { - if (!error && need_end_io_cache) + if (need_end_io_cache) ::end_io_cache(&cache); my_free(buffer, MYF(MY_ALLOW_ZERO_PTR)); From cb0e49c000b65db94cb40c6331572440b4bc4c3e Mon Sep 17 00:00:00 2001 From: Nirbhay Choubey Date: Fri, 8 Apr 2011 12:22:44 +0530 Subject: [PATCH 177/202] Bug#11765157 - 58090: mysqlslap drops schema specified in create_schema if auto-generate-sql also set. mysqlslap uses a schema to run its tests on and later drops it if auto-generate-sql is used. This can be a problem, if the schema is an already existing one. If create-schema is used with auto-generate-sql option, mysqlslap while performing the cleanup, drops the specified database. Fixed by introducing an option --no-drop, which, if used, will prevent the dropping of schema at the end of the test. client/client_priv.h: Bug#11765157 - 58090: mysqlslap drops schema specified in create_schema if auto-generate-sql also set. Added an option. client/mysqlslap.c: Bug#11765157 - 58090: mysqlslap drops schema specified in create_schema if auto-generate-sql also set. Introduced an option 'no-drop' to forbid the removal of schema even if 'create' or 'auto-generate-sql' options are used. mysql-test/r/mysqlslap.result: Added a testcase for Bug#11765157. mysql-test/t/mysqlslap.test: Added a testcase for Bug#11765157. --- client/client_priv.h | 1 + client/mysqlslap.c | 11 ++++++++--- mysql-test/r/mysqlslap.result | 20 ++++++++++++++++++++ mysql-test/t/mysqlslap.test | 15 +++++++++++++++ 4 files changed, 44 insertions(+), 3 deletions(-) diff --git a/client/client_priv.h b/client/client_priv.h index 689f7277c2e..92f495864bb 100644 --- a/client/client_priv.h +++ b/client/client_priv.h @@ -85,6 +85,7 @@ enum options_client OPT_SLAP_POST_SYSTEM, OPT_SLAP_COMMIT, OPT_SLAP_DETACH, + OPT_SLAP_NO_DROP, OPT_MYSQL_REPLACE_INTO, OPT_BASE64_OUTPUT_MODE, OPT_SERVER_ID, OPT_FIX_TABLE_NAMES, OPT_FIX_DB_NAMES, OPT_SSL_VERIFY_SERVER_CERT, OPT_DEBUG_INFO, OPT_DEBUG_CHECK, OPT_COLUMN_TYPES, OPT_ERROR_LOG_FILE, diff --git a/client/mysqlslap.c b/client/mysqlslap.c index 3b5c14dd74b..851407a108f 100644 --- a/client/mysqlslap.c +++ b/client/mysqlslap.c @@ -131,7 +131,7 @@ const char *delimiter= "\n"; const char *create_schema_string= "mysqlslap"; -static my_bool opt_preserve= TRUE; +static my_bool opt_preserve= TRUE, opt_no_drop= FALSE; static my_bool debug_info_flag= 0, debug_check_flag= 0; static my_bool opt_only_print= FALSE; static my_bool opt_compress= FALSE, tty_password= FALSE, @@ -599,6 +599,8 @@ static struct my_option my_long_options[] = REQUIRED_ARG, 0, 0, 0, 0, 0, 0}, {"iterations", 'i', "Number of times to run the tests.", &iterations, &iterations, 0, GET_UINT, REQUIRED_ARG, 1, 0, 0, 0, 0, 0}, + {"no-drop", OPT_SLAP_NO_DROP, "Do not drop the schema after the test.", + &opt_no_drop, &opt_no_drop, 0, GET_BOOL, NO_ARG, 0, 0, 0, 0, 0, 0}, {"number-char-cols", 'x', "Number of VARCHAR columns to create in table if specifying --auto-generate-sql.", &num_char_cols_opt, &num_char_cols_opt, 0, GET_STR, REQUIRED_ARG, @@ -1147,8 +1149,11 @@ get_options(int *argc,char ***argv) if (!user) user= (char *)"root"; - /* If something is created we clean it up, otherwise we leave schemas alone */ - if (create_string || auto_generate_sql) + /* + If something is created and --no-drop is not specified, we drop the + schema. + */ + if (!opt_no_drop && (create_string || auto_generate_sql)) opt_preserve= FALSE; if (auto_generate_sql && (create_string || user_supplied_query)) diff --git a/mysql-test/r/mysqlslap.result b/mysql-test/r/mysqlslap.result index 4cb01490407..a94d9156462 100644 --- a/mysql-test/r/mysqlslap.result +++ b/mysql-test/r/mysqlslap.result @@ -225,3 +225,23 @@ DROP SCHEMA IF EXISTS `mysqlslap`; DROP PROCEDURE IF EXISTS p1; CREATE PROCEDURE p1() SELECT 1; DROP PROCEDURE p1; +# +# Bug #11765157 - 58090: mysqlslap drops schema specified in +# create_schema if auto-generate-sql also set. +# +# 'bug58090' database should not be present. +SHOW DATABASES; +Database +information_schema +mtr +mysql +test +# 'bug58090' database should be present. +SHOW DATABASES; +Database +information_schema +bug58090 +mtr +mysql +test +DROP DATABASE bug58090; diff --git a/mysql-test/t/mysqlslap.test b/mysql-test/t/mysqlslap.test index 28042f62fe6..757d2813483 100644 --- a/mysql-test/t/mysqlslap.test +++ b/mysql-test/t/mysqlslap.test @@ -53,3 +53,18 @@ CREATE PROCEDURE p1() SELECT 1; --exec $MYSQL_SLAP --create-schema=test --delimiter=";" --query="CALL p1; SELECT 1;" --silent 2>&1 DROP PROCEDURE p1; + + +--echo # +--echo # Bug #11765157 - 58090: mysqlslap drops schema specified in +--echo # create_schema if auto-generate-sql also set. +--echo # + +--exec $MYSQL_SLAP --silent --create-schema=bug58090 --concurrency=5 --iterations=20 --auto-generate-sql +--echo # 'bug58090' database should not be present. +SHOW DATABASES; +--exec $MYSQL_SLAP --silent --create-schema=bug58090 --no-drop --auto-generate-sql +--echo # 'bug58090' database should be present. +SHOW DATABASES; +DROP DATABASE bug58090; + From a77bc59896ee3cd89a8f1d391a65722b443f1841 Mon Sep 17 00:00:00 2001 From: Gleb Shchepa Date: Fri, 8 Apr 2011 12:05:20 +0400 Subject: [PATCH 178/202] Bug #11829681 - 60295: ERROR 1356 ON VIEW THAT EXECUTES FINE AS A QUERY Select from a view with the underlying HAVING clause failed with a message: "1356: View '...' references invalid table(s) or column(s) or function(s) or definer/invoker of view lack rights to use them" The bug is a regression of the fix for bug 11750328 - 40825 (similar case, but the HAVING cause references an aliased field). In the old fix for bug 40825 the Item_field::name_length value has been used in place of the real length of Item_field::name. However, in some cases Item_field::name_length is not in sync with the actual name length (TODO: combine name and name_length into a solid String field). The Item_ref::print() method has been modified to calculate actual name length every time. mysql-test/r/view.result: Test case for bug #11829681 mysql-test/t/view.test: Test case for bug #11829681 sql/item.cc: Bug #11829681 - 60295: ERROR 1356 ON VIEW THAT EXECUTES FINE AS A QUERY The Item_ref::print() method has been modified to calculate actual name length every time. sql/item.h: Minor commentary. --- mysql-test/r/view.result | 9 +++++++++ mysql-test/t/view.test | 12 ++++++++++++ sql/item.cc | 2 +- sql/item.h | 4 ++++ 4 files changed, 26 insertions(+), 1 deletion(-) diff --git a/mysql-test/r/view.result b/mysql-test/r/view.result index 6b0a2103afa..2ca81f20cbb 100644 --- a/mysql-test/r/view.result +++ b/mysql-test/r/view.result @@ -3897,6 +3897,15 @@ DROP TABLE t1; # CREATE VIEW v1 AS SELECT 1 IN (1 LIKE 2,0) AS f; DROP VIEW v1; +# +# Bug 11829681 - 60295: ERROR 1356 ON VIEW THAT EXECUTES FINE AS A QUERY +# +CREATE TABLE t1 (a INT); +CREATE VIEW v1 AS SELECT s.* FROM t1 s, t1 b HAVING a; +SELECT * FROM v1; +a +DROP VIEW v1; +DROP TABLE t1; # ----------------------------------------------------------------- # -- End of 5.1 tests. # ----------------------------------------------------------------- diff --git a/mysql-test/t/view.test b/mysql-test/t/view.test index b1b3b5f2a83..1543924a7ad 100644 --- a/mysql-test/t/view.test +++ b/mysql-test/t/view.test @@ -3941,6 +3941,18 @@ DROP TABLE t1; CREATE VIEW v1 AS SELECT 1 IN (1 LIKE 2,0) AS f; DROP VIEW v1; +--echo # +--echo # Bug 11829681 - 60295: ERROR 1356 ON VIEW THAT EXECUTES FINE AS A QUERY +--echo # + +CREATE TABLE t1 (a INT); +CREATE VIEW v1 AS SELECT s.* FROM t1 s, t1 b HAVING a; + +SELECT * FROM v1; + +DROP VIEW v1; +DROP TABLE t1; + --echo # ----------------------------------------------------------------- --echo # -- End of 5.1 tests. --echo # ----------------------------------------------------------------- diff --git a/sql/item.cc b/sql/item.cc index 24c3107ece9..40be8b205bd 100644 --- a/sql/item.cc +++ b/sql/item.cc @@ -6121,7 +6121,7 @@ void Item_ref::print(String *str, enum_query_type query_type) { THD *thd= current_thd; append_identifier(thd, str, (*ref)->real_item()->name, - (*ref)->real_item()->name_length); + strlen((*ref)->real_item()->name)); } else (*ref)->print(str, query_type); diff --git a/sql/item.h b/sql/item.h index 8568e89542e..8d7ad3c41d3 100644 --- a/sql/item.h +++ b/sql/item.h @@ -515,6 +515,10 @@ public: */ Item *next; uint32 max_length; + /* + TODO: convert name and name_length fields into String to keep them in sync + (see bug #11829681/60295 etc). + */ uint name_length; /* Length of name */ int8 marker; uint8 decimals; From 97e435dd18ae49847abb7775428bd308a400c3c5 Mon Sep 17 00:00:00 2001 From: Alexander Nozdrin Date: Mon, 11 Apr 2011 13:45:41 +0400 Subject: [PATCH 179/202] Bump version. --- configure.in | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) diff --git a/configure.in b/configure.in index 523d36afaea..e07ae7e3191 100644 --- a/configure.in +++ b/configure.in @@ -7,7 +7,7 @@ AC_INIT(sql/mysqld.cc) AC_CANONICAL_SYSTEM # The Docs Makefile.am parses this line! # remember to also change ndb version below and update version.c in ndb -AM_INIT_AUTOMAKE(mysql, 5.0.93) +AM_INIT_AUTOMAKE(mysql, 5.0.94) AM_CONFIG_HEADER([include/config.h:config.h.in]) PROTOCOL_VERSION=10 From ab86b40c05bcde5d27bcf016c4d8626a4ca5cd2a Mon Sep 17 00:00:00 2001 From: Alexander Nozdrin Date: Mon, 11 Apr 2011 13:57:45 +0400 Subject: [PATCH 180/202] Bump NDB-version. --- configure.in | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) diff --git a/configure.in b/configure.in index e07ae7e3191..fdfb7eae871 100644 --- a/configure.in +++ b/configure.in @@ -23,7 +23,7 @@ NDB_SHARED_LIB_VERSION=$NDB_SHARED_LIB_MAJOR_VERSION:0:0 # ndb version NDB_VERSION_MAJOR=5 NDB_VERSION_MINOR=0 -NDB_VERSION_BUILD=93 +NDB_VERSION_BUILD=94 NDB_VERSION_STATUS="" # Set all version vars based on $VERSION. How do we do this more elegant ? From e108b3f69eb74490cd1ddf8b53b9b6afd0ad054b Mon Sep 17 00:00:00 2001 From: Sven Sandberg Date: Mon, 11 Apr 2011 16:01:46 +0200 Subject: [PATCH 181/202] corrected bug reference for experimental test --- mysql-test/collections/default.experimental | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) diff --git a/mysql-test/collections/default.experimental b/mysql-test/collections/default.experimental index 1e6ff625d39..703a8a18ef0 100644 --- a/mysql-test/collections/default.experimental +++ b/mysql-test/collections/default.experimental @@ -22,7 +22,7 @@ main.outfile_loaddata @solaris # joro : Bug #46895 ndb.* # joro : NDB tests marked as experimental as agreed with bochklin rpl.rpl_innodb_bug28430 @solaris # Bug#46029 -rpl.rpl_row_sp011 @solaris # Joro : Bug #54138 +rpl.rpl_row_sp011 @solaris # Joro : Bug #45445 rpl_ndb.* # joro : NDB tests marked as experimental as agreed with bochklin rpl_ndb.rpl_ndb_log # Bug#38998 From 33c2a5e7e3f5ed2dee0f50f6d02052d8bf2234b9 Mon Sep 17 00:00:00 2001 From: Sergey Glukhov Date: Tue, 12 Apr 2011 13:51:36 +0400 Subject: [PATCH 182/202] Bug#11766212 59270: NOT IN (YEAR( ... ), ... ) PRODUCES MANY VALGRIND WARNINGS Valgrind warning happens due to early null values check in Item_func_in::fix_length_and_dec(before item evaluation). As result null value items with uninitialized values are placed into array and it leads to valgrind warnings during value array sorting. The fix is to check null value after item evaluation, item is evaluated in in_array::set() method. mysql-test/r/func_in.result: test case mysql-test/t/func_in.test: test case sql/item_cmpfunc.cc: The fix is to check null value after item evaluation. --- mysql-test/r/func_in.result | 6 ++++++ mysql-test/t/func_in.test | 6 ++++++ sql/item_cmpfunc.cc | 12 +++++------- 3 files changed, 17 insertions(+), 7 deletions(-) diff --git a/mysql-test/r/func_in.result b/mysql-test/r/func_in.result index fdeec2755ca..0b6117581f3 100644 --- a/mysql-test/r/func_in.result +++ b/mysql-test/r/func_in.result @@ -770,4 +770,10 @@ CASE a WHEN a THEN a END NULL DROP TABLE t1; # +# Bug #11766212 59270: NOT IN (YEAR( ... ), ... ) PRODUCES MANY VALGRIND WARNINGS +# +SELECT 1 IN (YEAR(FROM_UNIXTIME(NULL)) ,1); +1 IN (YEAR(FROM_UNIXTIME(NULL)) ,1) +1 +# End of 5.1 tests diff --git a/mysql-test/t/func_in.test b/mysql-test/t/func_in.test index 6efeb2866e6..08469b37967 100644 --- a/mysql-test/t/func_in.test +++ b/mysql-test/t/func_in.test @@ -554,6 +554,12 @@ SELECT CASE a WHEN a THEN a END FROM t1 GROUP BY a WITH ROLLUP; DROP TABLE t1; +--echo # +--echo # Bug #11766212 59270: NOT IN (YEAR( ... ), ... ) PRODUCES MANY VALGRIND WARNINGS +--echo # + +SELECT 1 IN (YEAR(FROM_UNIXTIME(NULL)) ,1); + --echo # --echo End of 5.1 tests diff --git a/sql/item_cmpfunc.cc b/sql/item_cmpfunc.cc index 36ca5537eb5..23f081e1cc0 100644 --- a/sql/item_cmpfunc.cc +++ b/sql/item_cmpfunc.cc @@ -4000,13 +4000,11 @@ void Item_func_in::fix_length_and_dec() uint j=0; for (uint i=1 ; i < arg_count ; i++) { - if (!args[i]->null_value) // Skip NULL values - { - array->set(j,args[i]); - j++; - } - else - have_null= 1; + array->set(j,args[i]); + if (!args[i]->null_value) // Skip NULL values + j++; + else + have_null= 1; } if ((array->used_count= j)) array->sort(); From 7fa7a0cad95b0c8cc4f7f450f7f3411fa632b148 Mon Sep 17 00:00:00 2001 From: Sergey Glukhov Date: Tue, 12 Apr 2011 14:01:33 +0400 Subject: [PATCH 183/202] Bug#11766270 59343: YEAR(4): INCORRECT RESULT AND VALGRIND WARNINGS WITH MIN/MAX, UNION When we create temporary result table for UNION incorrect max_length for YEAR field is used and it leads to incorrect field value and incorrect result string length as YEAR field value calculation depends on field length. The fix is to use underlying item max_length for Item_sum_hybrid::max_length intialization. mysql-test/r/func_group.result: test case mysql-test/t/func_group.test: test case sql/field.cc: added assert sql/item_sum.cc: init Item_sum_hybrid::max_length with use underlying item max_length for INT result type. --- mysql-test/r/func_group.result | 11 +++++++++++ mysql-test/t/func_group.test | 12 ++++++++++++ sql/field.cc | 2 ++ sql/item_sum.cc | 6 +----- 4 files changed, 26 insertions(+), 5 deletions(-) diff --git a/mysql-test/r/func_group.result b/mysql-test/r/func_group.result index 69bce1c8bd8..b90eb2a4c0f 100644 --- a/mysql-test/r/func_group.result +++ b/mysql-test/r/func_group.result @@ -1746,4 +1746,15 @@ MAX(LENGTH(a)) LENGTH(MAX(a)) MIN(a) MAX(a) CONCAT(MIN(a)) CONCAT(MAX(a)) 20 20 18446668621106209655 18446668621106209655 18446668621106209655 18446668621106209655 DROP TABLE t1; # +# Bug #11766270 59343: YEAR(4): INCORRECT RESULT AND VALGRIND WARNINGS WITH MIN/MAX, UNION +# +CREATE TABLE t1(f1 YEAR(4)); +INSERT INTO t1 VALUES (0000),(2001); +(SELECT MAX(f1) FROM t1) UNION (SELECT MAX(f1) FROM t1); +Catalog Database Table Table_alias Column Column_alias Type Length Max length Is_null Flags Decimals Charsetnr +def MAX(f1) MAX(f1) 13 4 4 Y 32864 0 63 +MAX(f1) +2001 +DROP TABLE t1; +# End of 5.1 tests diff --git a/mysql-test/t/func_group.test b/mysql-test/t/func_group.test index 600b46fcde6..177a1ca2471 100644 --- a/mysql-test/t/func_group.test +++ b/mysql-test/t/func_group.test @@ -1127,6 +1127,18 @@ INSERT INTO t1 VALUES (18446668621106209655); SELECT MAX(LENGTH(a)), LENGTH(MAX(a)), MIN(a), MAX(a), CONCAT(MIN(a)), CONCAT(MAX(a)) FROM t1; DROP TABLE t1; +--echo # +--echo # Bug #11766270 59343: YEAR(4): INCORRECT RESULT AND VALGRIND WARNINGS WITH MIN/MAX, UNION +--echo # + +CREATE TABLE t1(f1 YEAR(4)); +INSERT INTO t1 VALUES (0000),(2001); +--enable_metadata +(SELECT MAX(f1) FROM t1) UNION (SELECT MAX(f1) FROM t1); +--disable_metadata +DROP TABLE t1; + + --echo # --echo End of 5.1 tests diff --git a/sql/field.cc b/sql/field.cc index 1ad5e408e07..3707c5b056f 100644 --- a/sql/field.cc +++ b/sql/field.cc @@ -5467,6 +5467,7 @@ double Field_year::val_real(void) longlong Field_year::val_int(void) { ASSERT_COLUMN_MARKED_FOR_READ; + DBUG_ASSERT(field_length == 2 || field_length == 4); int tmp= (int) ptr[0]; if (field_length != 4) tmp%=100; // Return last 2 char @@ -5479,6 +5480,7 @@ longlong Field_year::val_int(void) String *Field_year::val_str(String *val_buffer, String *val_ptr __attribute__((unused))) { + DBUG_ASSERT(field_length < 5); val_buffer->alloc(5); val_buffer->length(field_length); char *to=(char*) val_buffer->ptr(); diff --git a/sql/item_sum.cc b/sql/item_sum.cc index 2a8aea68f7a..c62738abac0 100644 --- a/sql/item_sum.cc +++ b/sql/item_sum.cc @@ -612,17 +612,13 @@ Item_sum_hybrid::fix_fields(THD *thd, Item **ref) switch (hybrid_type= item->result_type()) { case INT_RESULT: - max_length= 20; - break; case DECIMAL_RESULT: + case STRING_RESULT: max_length= item->max_length; break; case REAL_RESULT: max_length= float_length(decimals); break; - case STRING_RESULT: - max_length= item->max_length; - break; case ROW_RESULT: default: DBUG_ASSERT(0); From da267719197397fbf0ba70fe0749788a82581267 Mon Sep 17 00:00:00 2001 From: Sven Sandberg Date: Tue, 12 Apr 2011 13:14:49 +0200 Subject: [PATCH 184/202] marked rpl_stop_slave experimental due to BUG#12345981 --- mysql-test/collections/default.experimental | 1 + 1 file changed, 1 insertion(+) diff --git a/mysql-test/collections/default.experimental b/mysql-test/collections/default.experimental index 703a8a18ef0..4e566436ac8 100644 --- a/mysql-test/collections/default.experimental +++ b/mysql-test/collections/default.experimental @@ -23,6 +23,7 @@ ndb.* # joro : NDB tests marked as experiment rpl.rpl_innodb_bug28430 @solaris # Bug#46029 rpl.rpl_row_sp011 @solaris # Joro : Bug #45445 +rpl.rpl_stop_slave @freebsd # Sven : BUG#12345981 rpl_ndb.* # joro : NDB tests marked as experimental as agreed with bochklin rpl_ndb.rpl_ndb_log # Bug#38998 From 729e9a65943823b2636ea8dc3c50486a3844c02c Mon Sep 17 00:00:00 2001 From: Serge Kozlov Date: Thu, 14 Apr 2011 00:18:08 +0400 Subject: [PATCH 185/202] WL#5867, reorganize test cases of bugs suite --- mysql-test/collections/default.experimental | 5 + .../r/binlog_bug23533.result} | 20 +-- .../suite/binlog/r/binlog_bug36391.result | 10 ++ .../t/binlog_bug23533.test} | 18 +- .../t/binlog_bug36391-master.opt} | 0 .../t/binlog_bug36391.test} | 23 +-- mysql-test/suite/bugs/combinations | 8 - mysql-test/suite/bugs/data/rpl_bug12691.dat | 3 - mysql-test/suite/bugs/r/rpl_bug12691.result | 33 ---- mysql-test/suite/bugs/r/rpl_bug31582.result | 16 -- mysql-test/suite/bugs/r/rpl_bug31583.result | 16 -- mysql-test/suite/bugs/r/rpl_bug33029.result | 15 -- mysql-test/suite/bugs/r/rpl_bug36391.result | 18 -- mysql-test/suite/bugs/r/rpl_bug37426.result | 17 -- mysql-test/suite/bugs/r/rpl_bug38205.result | 56 ------ mysql-test/suite/bugs/t/rpl_bug12691.test | 49 ------ mysql-test/suite/bugs/t/rpl_bug31582.test | 25 --- mysql-test/suite/bugs/t/rpl_bug31583.test | 25 --- mysql-test/suite/bugs/t/rpl_bug33029.test | 26 --- mysql-test/suite/bugs/t/rpl_bug38205.test | 166 ------------------ mysql-test/suite/rpl/r/rpl_bug37426.result | 12 ++ .../suite/{bugs => rpl}/t/rpl_bug37426.test | 11 +- 22 files changed, 63 insertions(+), 509 deletions(-) rename mysql-test/suite/{bugs/r/rpl_bug23533.result => binlog/r/binlog_bug23533.result} (52%) create mode 100644 mysql-test/suite/binlog/r/binlog_bug36391.result rename mysql-test/suite/{bugs/t/rpl_bug23533.test => binlog/t/binlog_bug23533.test} (76%) rename mysql-test/suite/{bugs/t/rpl_bug36391-master.opt => binlog/t/binlog_bug36391-master.opt} (100%) rename mysql-test/suite/{bugs/t/rpl_bug36391.test => binlog/t/binlog_bug36391.test} (65%) delete mode 100644 mysql-test/suite/bugs/combinations delete mode 100644 mysql-test/suite/bugs/data/rpl_bug12691.dat delete mode 100644 mysql-test/suite/bugs/r/rpl_bug12691.result delete mode 100644 mysql-test/suite/bugs/r/rpl_bug31582.result delete mode 100644 mysql-test/suite/bugs/r/rpl_bug31583.result delete mode 100644 mysql-test/suite/bugs/r/rpl_bug33029.result delete mode 100644 mysql-test/suite/bugs/r/rpl_bug36391.result delete mode 100644 mysql-test/suite/bugs/r/rpl_bug37426.result delete mode 100644 mysql-test/suite/bugs/r/rpl_bug38205.result delete mode 100644 mysql-test/suite/bugs/t/rpl_bug12691.test delete mode 100644 mysql-test/suite/bugs/t/rpl_bug31582.test delete mode 100644 mysql-test/suite/bugs/t/rpl_bug31583.test delete mode 100644 mysql-test/suite/bugs/t/rpl_bug33029.test delete mode 100644 mysql-test/suite/bugs/t/rpl_bug38205.test create mode 100644 mysql-test/suite/rpl/r/rpl_bug37426.result rename mysql-test/suite/{bugs => rpl}/t/rpl_bug37426.test (71%) diff --git a/mysql-test/collections/default.experimental b/mysql-test/collections/default.experimental index 4e566436ac8..72e14135ef0 100644 --- a/mysql-test/collections/default.experimental +++ b/mysql-test/collections/default.experimental @@ -2,6 +2,9 @@ # in alphabetical order. This also helps with merge conflict resolution. binlog.binlog_multi_engine # joro : NDB tests marked as experimental as agreed with bochklin +binlog.binlog_bug23533 # WL#5867: skozlov: test case moved from unused bugs suite +binlog.binlog_bug36391 # WL#5867: skozlov: test case moved from unused bugs suite + funcs_1.charset_collation_1 # depends on compile-time decisions funcs_1.is_cml_ndb # joro : NDB tests marked as experimental as agreed with bochklin @@ -24,6 +27,8 @@ ndb.* # joro : NDB tests marked as experiment rpl.rpl_innodb_bug28430 @solaris # Bug#46029 rpl.rpl_row_sp011 @solaris # Joro : Bug #45445 rpl.rpl_stop_slave @freebsd # Sven : BUG#12345981 +rpl.rpl_bug37426 # WL#5867: skozlov: test case moved from unused bugs suite + rpl_ndb.* # joro : NDB tests marked as experimental as agreed with bochklin rpl_ndb.rpl_ndb_log # Bug#38998 diff --git a/mysql-test/suite/bugs/r/rpl_bug23533.result b/mysql-test/suite/binlog/r/binlog_bug23533.result similarity index 52% rename from mysql-test/suite/bugs/r/rpl_bug23533.result rename to mysql-test/suite/binlog/r/binlog_bug23533.result index 1dda75a69b0..8a28867afb4 100644 --- a/mysql-test/suite/bugs/r/rpl_bug23533.result +++ b/mysql-test/suite/binlog/r/binlog_bug23533.result @@ -1,23 +1,19 @@ -stop slave; -drop table if exists t1,t2,t3,t4,t5,t6,t7,t8,t9; -reset master; -reset slave; -drop table if exists t1,t2,t3,t4,t5,t6,t7,t8,t9; -start slave; -DROP TABLE IF EXISTS t1,t2; SET AUTOCOMMIT=0; -SET GLOBAL max_binlog_cache_size=4096; -SHOW VARIABLES LIKE 'max_binlog_cache_size'; -Variable_name Value -max_binlog_cache_size 4096 CREATE TABLE t1 (a INT NOT NULL AUTO_INCREMENT, b TEXT, PRIMARY KEY(a)) ENGINE=InnoDB; SELECT COUNT(*) FROM t1; COUNT(*) 1000 +SHOW VARIABLES LIKE 'max_binlog_cache_size'; +Variable_name Value +max_binlog_cache_size 4294963200 +SET @saved_max_binlog_cache_size=@@max_binlog_cache_size; +SET GLOBAL max_binlog_cache_size=4096; START TRANSACTION; CREATE TABLE t2 SELECT * FROM t1; -ERROR HY000: Writing one row to the row-based binary log failed +ERROR HY000: Multi-statement transaction required more than 'max_binlog_cache_size' bytes of storage; increase this mysqld variable and try again COMMIT; SHOW TABLES LIKE 't%'; Tables_in_test (t%) t1 +SET GLOBAL max_binlog_cache_size=@saved_max_binlog_cache_size; +DROP TABLE t1; diff --git a/mysql-test/suite/binlog/r/binlog_bug36391.result b/mysql-test/suite/binlog/r/binlog_bug36391.result new file mode 100644 index 00000000000..551bfb9924d --- /dev/null +++ b/mysql-test/suite/binlog/r/binlog_bug36391.result @@ -0,0 +1,10 @@ +CREATE TABLE t1(id INT); +SHOW TABLES; +Tables_in_test +t1 +FLUSH LOGS; +DROP TABLE t1; +SHOW TABLES; +Tables_in_test +t1 +DROP TABLE t1; diff --git a/mysql-test/suite/bugs/t/rpl_bug23533.test b/mysql-test/suite/binlog/t/binlog_bug23533.test similarity index 76% rename from mysql-test/suite/bugs/t/rpl_bug23533.test rename to mysql-test/suite/binlog/t/binlog_bug23533.test index 337dddcef3d..3c9a7ab5896 100644 --- a/mysql-test/suite/bugs/t/rpl_bug23533.test +++ b/mysql-test/suite/binlog/t/binlog_bug23533.test @@ -4,15 +4,13 @@ ############################################################# --source include/have_innodb.inc +--source include/have_log_bin.inc --source include/have_binlog_format_row.inc ---source include/master-slave.inc SET AUTOCOMMIT=0; -SET GLOBAL max_binlog_cache_size=4096; -SHOW VARIABLES LIKE 'max_binlog_cache_size'; +# Create 1st table CREATE TABLE t1 (a INT NOT NULL AUTO_INCREMENT, b TEXT, PRIMARY KEY(a)) ENGINE=InnoDB; - --disable_query_log let $i= 1000; while ($i) @@ -21,16 +19,20 @@ while ($i) dec $i; } --enable_query_log - SELECT COUNT(*) FROM t1; +# Set small value for max_binlog_cache_size +SHOW VARIABLES LIKE 'max_binlog_cache_size'; +SET @saved_max_binlog_cache_size=@@max_binlog_cache_size; +SET GLOBAL max_binlog_cache_size=4096; + # Copied data from t1 into t2 large than max_binlog_cache_size START TRANSACTION; ---error 1534 +--error 1197 CREATE TABLE t2 SELECT * FROM t1; COMMIT; SHOW TABLES LIKE 't%'; - # 5.1 End of Test ---source include/rpl_end.inc +SET GLOBAL max_binlog_cache_size=@saved_max_binlog_cache_size; +DROP TABLE t1; diff --git a/mysql-test/suite/bugs/t/rpl_bug36391-master.opt b/mysql-test/suite/binlog/t/binlog_bug36391-master.opt similarity index 100% rename from mysql-test/suite/bugs/t/rpl_bug36391-master.opt rename to mysql-test/suite/binlog/t/binlog_bug36391-master.opt diff --git a/mysql-test/suite/bugs/t/rpl_bug36391.test b/mysql-test/suite/binlog/t/binlog_bug36391.test similarity index 65% rename from mysql-test/suite/bugs/t/rpl_bug36391.test rename to mysql-test/suite/binlog/t/binlog_bug36391.test index 3961082273d..64d91dfafd9 100644 --- a/mysql-test/suite/bugs/t/rpl_bug36391.test +++ b/mysql-test/suite/binlog/t/binlog_bug36391.test @@ -13,17 +13,18 @@ # # ---source include/master-slave.inc +--source include/have_log_bin.inc +--source include/have_binlog_format_mixed.inc -create table t1(id int); +CREATE TABLE t1(id INT); +let $binlog= query_get_value(SHOW MASTER STATUS, File, 1); +let $binlog_path= `SELECT CONCAT(@@DATADIR, '$binlog')`; +SHOW TABLES; +FLUSH LOGS; +DROP TABLE t1; -show tables; +--exec $MYSQL_BINLOG $binlog_path | $MYSQL test +SHOW TABLES; ---source include/show_master_status.inc - -flush logs; - ---exec $MYSQL_BINLOG $MYSQL_TEST_DIR/var/log/master-bin.000001 | $MYSQL test - -drop table t1; ---source include/rpl_end.inc +# Clean up +DROP TABLE t1; diff --git a/mysql-test/suite/bugs/combinations b/mysql-test/suite/bugs/combinations deleted file mode 100644 index 07042c2cbec..00000000000 --- a/mysql-test/suite/bugs/combinations +++ /dev/null @@ -1,8 +0,0 @@ -[row] -binlog-format=row - -[stmt] -binlog-format=statement - -[mix] -binlog-format=mixed diff --git a/mysql-test/suite/bugs/data/rpl_bug12691.dat b/mysql-test/suite/bugs/data/rpl_bug12691.dat deleted file mode 100644 index de980441c3a..00000000000 --- a/mysql-test/suite/bugs/data/rpl_bug12691.dat +++ /dev/null @@ -1,3 +0,0 @@ -a -b -c diff --git a/mysql-test/suite/bugs/r/rpl_bug12691.result b/mysql-test/suite/bugs/r/rpl_bug12691.result deleted file mode 100644 index 8feeb0effc3..00000000000 --- a/mysql-test/suite/bugs/r/rpl_bug12691.result +++ /dev/null @@ -1,33 +0,0 @@ -stop slave; -drop table if exists t1,t2,t3,t4,t5,t6,t7,t8,t9; -reset master; -reset slave; -drop table if exists t1,t2,t3,t4,t5,t6,t7,t8,t9; -start slave; - -**** On Master **** -CREATE TABLE t1 (b CHAR(10)); - -**** On Slave **** -STOP SLAVE; - -**** On Master **** -LOAD DATA INFILE FILENAME -SELECT COUNT(*) FROM t1; -COUNT(*) -3 -show binlog events from ; -Log_name Pos Event_type Server_id End_log_pos Info -master-bin.000001 # Query # # use `test`; CREATE TABLE t1 (b CHAR(10)) -master-bin.000001 # Begin_load_query # # ;file_id=#;block_len=# -master-bin.000001 # Execute_load_query # # use `test`; LOAD DATA INFILE 'MYSQLTEST_VARDIR/tmp/rpl_bug12691.dat' INTO TABLE `t1` FIELDS TERMINATED BY '|' ENCLOSED BY '' ESCAPED BY '\\' LINES TERMINATED BY '\n' (`b`) ;file_id=# - -**** On Slave **** -SET GLOBAL SQL_SLAVE_SKIP_COUNTER=1; -START SLAVE; -SELECT COUNT(*) FROM t1; -COUNT(*) -0 - -**** On Master **** -DROP TABLE t1; diff --git a/mysql-test/suite/bugs/r/rpl_bug31582.result b/mysql-test/suite/bugs/r/rpl_bug31582.result deleted file mode 100644 index 1f71fbf8fe7..00000000000 --- a/mysql-test/suite/bugs/r/rpl_bug31582.result +++ /dev/null @@ -1,16 +0,0 @@ -stop slave; -drop table if exists t1,t2,t3,t4,t5,t6,t7,t8,t9; -reset master; -reset slave; -drop table if exists t1,t2,t3,t4,t5,t6,t7,t8,t9; -start slave; -CREATE TABLE t1 (a VARCHAR(10) PRIMARY KEY) ENGINE=MyISAM; -INSERT INTO t1 VALUES ('a'); -UPDATE t1 SET a = 'MyISAM'; -SELECT * FROM t1 ORDER BY a; -a -MyISAM -SELECT * FROM t1 ORDER BY a; -a -MyISAM -DROP TABLE t1; diff --git a/mysql-test/suite/bugs/r/rpl_bug31583.result b/mysql-test/suite/bugs/r/rpl_bug31583.result deleted file mode 100644 index 74846607313..00000000000 --- a/mysql-test/suite/bugs/r/rpl_bug31583.result +++ /dev/null @@ -1,16 +0,0 @@ -stop slave; -drop table if exists t1,t2,t3,t4,t5,t6,t7,t8,t9; -reset master; -reset slave; -drop table if exists t1,t2,t3,t4,t5,t6,t7,t8,t9; -start slave; -CREATE TABLE t1 ( a INT, b INT DEFAULT -3 ); -INSERT INTO t1 VALUES (1, DEFAULT); -UPDATE t1 SET a = 3; -SELECT * FROM t1 ORDER BY a; -a b -3 -3 -SELECT * FROM t1 ORDER BY a; -a b -3 -3 -DROP TABLE t1; diff --git a/mysql-test/suite/bugs/r/rpl_bug33029.result b/mysql-test/suite/bugs/r/rpl_bug33029.result deleted file mode 100644 index d11ae1cc0be..00000000000 --- a/mysql-test/suite/bugs/r/rpl_bug33029.result +++ /dev/null @@ -1,15 +0,0 @@ -stop slave; -drop table if exists t1,t2,t3,t4,t5,t6,t7,t8,t9; -reset master; -reset slave; -drop table if exists t1,t2,t3,t4,t5,t6,t7,t8,t9; -start slave; -create table `t1` (`id` int not null auto_increment primary key); -create trigger `trg` before insert on `t1` for each row begin end; -set @@global.debug="+d,simulate_bug33029"; -stop slave; -start slave; -insert into `t1` values (); -select * from t1; -id -1 diff --git a/mysql-test/suite/bugs/r/rpl_bug36391.result b/mysql-test/suite/bugs/r/rpl_bug36391.result deleted file mode 100644 index 33175d89d30..00000000000 --- a/mysql-test/suite/bugs/r/rpl_bug36391.result +++ /dev/null @@ -1,18 +0,0 @@ -stop slave; -drop table if exists t1,t2,t3,t4,t5,t6,t7,t8,t9; -reset master; -reset slave; -drop table if exists t1,t2,t3,t4,t5,t6,t7,t8,t9; -start slave; -drop table if exists t1; -Warnings: -Note 1051 Unknown table 't1' -create table t1(id int); -show tables; -Tables_in_test -t1 -show master status; -File Position Binlog_Do_DB Binlog_Ignore_DB -master-bin.000001 # -flush logs; -drop table t1; diff --git a/mysql-test/suite/bugs/r/rpl_bug37426.result b/mysql-test/suite/bugs/r/rpl_bug37426.result deleted file mode 100644 index 24dfd27ca01..00000000000 --- a/mysql-test/suite/bugs/r/rpl_bug37426.result +++ /dev/null @@ -1,17 +0,0 @@ -stop slave; -drop table if exists t1,t2,t3,t4,t5,t6,t7,t8,t9; -reset master; -reset slave; -drop table if exists t1,t2,t3,t4,t5,t6,t7,t8,t9; -start slave; -CREATE TABLE char128_utf8 ( -i1 INT NOT NULL, -c CHAR(128) CHARACTER SET utf8 NOT NULL, -i2 INT NOT NULL); -INSERT INTO char128_utf8 VALUES ( 1, "123", 1 ); -SELECT * FROM char128_utf8; -i1 c i2 -1 123 1 -SELECT * FROM char128_utf8; -i1 c i2 -1 123 1 diff --git a/mysql-test/suite/bugs/r/rpl_bug38205.result b/mysql-test/suite/bugs/r/rpl_bug38205.result deleted file mode 100644 index 8f1dee344fa..00000000000 --- a/mysql-test/suite/bugs/r/rpl_bug38205.result +++ /dev/null @@ -1,56 +0,0 @@ -stop slave; -drop table if exists t1,t2,t3,t4,t5,t6,t7,t8,t9; -reset master; -reset slave; -drop table if exists t1,t2,t3,t4,t5,t6,t7,t8,t9; -start slave; -create table t1i(n int primary key) engine=innodb; -create table t2m(n int primary key) engine=myisam; -begin; -insert into t1i values (1); -insert into t1i values (2); -insert into t1i values (3); -commit; -begin; -insert into t1i values (5); -begin; -insert into t1i values (4); -insert into t2m values (1); -update t1i set n = 5 where n = 4; -commit; -zero -0 -*** kill sql thread *** -rollback; -*** sql thread is *not* running: No *** -*** the prove: the killed slave has not finished the current transaction *** -three -3 -one -1 -zero -0 -delete from t2m; -start slave sql_thread; -delete from t1i; -delete from t2m; -begin; -insert into t1i values (5); -begin; -insert into t1i values (4); -update t1i set n = 5 where n = 4; -commit; -zero -0 -stop slave sql_thread; -rollback; -*** sql thread is *not* running: No *** -*** the prove: the stopped slave has rolled back the current transaction *** -zero -0 -zero -0 -one -1 -start slave sql_thread; -drop table t1i, t2m; diff --git a/mysql-test/suite/bugs/t/rpl_bug12691.test b/mysql-test/suite/bugs/t/rpl_bug12691.test deleted file mode 100644 index 038f3e57b75..00000000000 --- a/mysql-test/suite/bugs/t/rpl_bug12691.test +++ /dev/null @@ -1,49 +0,0 @@ -# Bug#12691: Exec_master_log_pos corrupted with SQL_SLAVE_SKIP_COUNTER - ---source include/master-slave.inc ---connection master ---source include/have_binlog_format_mixed_or_statement.inc - ---echo ---echo **** On Master **** -CREATE TABLE t1 (b CHAR(10)); ---echo ---echo **** On Slave **** ---sync_slave_with_master -STOP SLAVE; ---source include/wait_for_slave_to_stop.inc - ---connection master - ---echo ---echo **** On Master **** ---exec cp $MYSQL_TEST_DIR/suite/bugs/data/rpl_bug12691.dat $MYSQLTEST_VARDIR/tmp/ ---echo LOAD DATA INFILE FILENAME ---disable_query_log ---eval LOAD DATA INFILE '$MYSQLTEST_VARDIR/tmp/rpl_bug12691.dat' INTO TABLE t1 FIELDS TERMINATED BY '|' ---enable_query_log ---remove_file $MYSQLTEST_VARDIR/tmp/rpl_bug12691.dat - -SELECT COUNT(*) FROM t1; - -source include/show_binlog_events.inc; - ---save_master_pos - ---connection slave ---echo ---echo **** On Slave **** -SET GLOBAL SQL_SLAVE_SKIP_COUNTER=1; -START SLAVE; ---source include/wait_for_slave_to_start.inc ---sync_with_master - -SELECT COUNT(*) FROM t1; - -# Clean up ---connection master ---echo ---echo **** On Master **** -DROP TABLE t1; - ---source include/rpl_end.inc diff --git a/mysql-test/suite/bugs/t/rpl_bug31582.test b/mysql-test/suite/bugs/t/rpl_bug31582.test deleted file mode 100644 index 6bff8ef4172..00000000000 --- a/mysql-test/suite/bugs/t/rpl_bug31582.test +++ /dev/null @@ -1,25 +0,0 @@ - -# BUG#31582: 5.1-telco-6.1 -> 5.1.22. Slave crashes when reading -# UPDATE for VARCHAR - -# This is a problem for any update statement replicating from an old -# server to a new server. The bug consisted of a new slave trying to -# read two column bitmaps, but there is only one available in the old -# format. - -# This test case should be executed replicating from an old server to -# a new server, so make sure you have one handy. - -source include/master-slave.inc; - -CREATE TABLE t1 (a VARCHAR(10) PRIMARY KEY) ENGINE=MyISAM; -INSERT INTO t1 VALUES ('a'); -UPDATE t1 SET a = 'MyISAM'; -SELECT * FROM t1 ORDER BY a; -sync_slave_with_master; -SELECT * FROM t1 ORDER BY a; - -connection master; -DROP TABLE t1; - ---source include/rpl_end.inc diff --git a/mysql-test/suite/bugs/t/rpl_bug31583.test b/mysql-test/suite/bugs/t/rpl_bug31583.test deleted file mode 100644 index ee5b7698016..00000000000 --- a/mysql-test/suite/bugs/t/rpl_bug31583.test +++ /dev/null @@ -1,25 +0,0 @@ -# -# BUG#31583: 5.1-telco-6.1 -> 5.1.22. Slave returns Error in unknown event - -# This is a problem for any update statement replicating from an old -# server to a new server. The bug consisted of a new slave trying to -# read two column bitmaps, but there is only one available in the old -# format. - -# This test case should be executed replicating from an old server to -# a new server, so make sure you have one handy. - -source include/master-slave.inc; - -CREATE TABLE t1 ( a INT, b INT DEFAULT -3 ); - -INSERT INTO t1 VALUES (1, DEFAULT); -UPDATE t1 SET a = 3; -SELECT * FROM t1 ORDER BY a; -sync_slave_with_master; -SELECT * FROM t1 ORDER BY a; - -connection master; -DROP TABLE t1; - ---source include/rpl_end.inc diff --git a/mysql-test/suite/bugs/t/rpl_bug33029.test b/mysql-test/suite/bugs/t/rpl_bug33029.test deleted file mode 100644 index f5aad4de8df..00000000000 --- a/mysql-test/suite/bugs/t/rpl_bug33029.test +++ /dev/null @@ -1,26 +0,0 @@ -# -# Bug #36443 Server crashes when executing insert when insert trigger on table -# -# Emulating the former bug#33029 situation to see that there is no crash anymore. -# - - -source include/master-slave.inc; - -create table `t1` (`id` int not null auto_increment primary key); -create trigger `trg` before insert on `t1` for each row begin end; - -sync_slave_with_master; -set @@global.debug="+d,simulate_bug33029"; - -stop slave; -start slave; - -connection master; - -insert into `t1` values (); - -sync_slave_with_master; -select * from t1; - ---source include/rpl_end.inc diff --git a/mysql-test/suite/bugs/t/rpl_bug38205.test b/mysql-test/suite/bugs/t/rpl_bug38205.test deleted file mode 100644 index 550746719f4..00000000000 --- a/mysql-test/suite/bugs/t/rpl_bug38205.test +++ /dev/null @@ -1,166 +0,0 @@ -# -# Bug #38205 Row-based Replication (RBR) causes inconsistencies: HA_ERR_FOUND_DUPP_KEY -# Bug#319 if while a non-transactional slave is replicating a transaction possible problem -# -# Verifying the fact that STOP SLAVE in the middle of a group execution waits -# for the end of the group before the slave sql thread will stop. -# The patch refines STOP SLAVE to not interrupt a transaction or other type of -# the replication events group (the part I). -# Killing the sql thread continues to provide a "hard" stop (the part II). -# -# Non-deterministic tests -# - -source include/master-slave.inc; -source include/have_innodb.inc; - - -# -# Part II, killed sql slave leaves instantly -# - -# A. multi-statement transaction as the replication group - -connection master; - -create table t1i(n int primary key) engine=innodb; -create table t2m(n int primary key) engine=myisam; - -sync_slave_with_master; - -connection master; - -begin; -insert into t1i values (1); -insert into t1i values (2); -insert into t1i values (3); -commit; - -sync_slave_with_master; - -# -# todo: first challenge is to find out the SQL thread id -# the following is not fully reliable -# - -let $id=`SELECT id from information_schema.processlist where user like 'system user' and state like '%Has read all relay log%' or user like 'system user' and state like '%Reading event from the relay log%'`; -connection slave; -begin; -insert into t1i values (5); - -connection master; -let $pos0_master= query_get_value(SHOW MASTER STATUS, Position, 1); -begin; -insert into t1i values (4); -insert into t2m values (1); # non-ta update -update t1i set n = 5 where n = 4; # to block at. can't be played with killed -commit; -let $pos1_master= query_get_value(SHOW MASTER STATUS, Position, 1); - -connection slave; -# slave sql thread must be locked out by the conn `slave' explicit lock -let $pos0_slave= query_get_value(SHOW SLAVE STATUS, Exec_Master_Log_Pos, 1); ---disable_query_log -eval select $pos0_master - $pos0_slave as zero; ---enable_query_log - -connection slave1; - -let $count= 1; -let $table= t2m; -source include/wait_until_rows_count.inc; -# -# todo: may fail as said above -# ---echo *** kill sql thread *** ---disable_query_log -eval kill connection $id; ---enable_query_log - -connection slave; -rollback; # release the sql thread - -connection slave1; - -source include/wait_for_slave_sql_to_stop.inc; -let $sql_status= query_get_value(SHOW SLAVE STATUS, Slave_SQL_Running, 1); ---echo *** sql thread is *not* running: $sql_status *** -let $pos1_slave= query_get_value(SHOW SLAVE STATUS, Exec_Master_Log_Pos, 1); - -connection slave; ---echo *** the prove: the killed slave has not finished the current transaction *** - ---disable_query_log -select count(*) as three from t1i; -eval select $pos1_master > $pos1_slave as one; -eval select $pos1_slave - $pos0_slave as zero; ---enable_query_log - -delete from t2m; # remove the row to be able to replay -start slave sql_thread; - -# -# Part I: B The homogenous transaction remains interuptable in between -# - -connection master; -delete from t1i; -delete from t2m; - -sync_slave_with_master; -begin; -insert into t1i values (5); - -connection master; -let $pos0_master= query_get_value(SHOW MASTER STATUS, Position, 1); -begin; -insert into t1i values (4); -update t1i set n = 5 where n = 4; # to block at. not to be played -commit; -let $pos1_master= query_get_value(SHOW MASTER STATUS, Position, 1); - - -connection slave1; -# slave sql can't advance as must be locked by the conn `slave' trans -let $pos0_slave= query_get_value(SHOW SLAVE STATUS, Exec_Master_Log_Pos, 1); ---disable_query_log -eval select $pos0_master - $pos0_slave as zero; ---enable_query_log - -# -# the replicated trans is blocked by the slave's local. -# However, it's not easy to catch the exact moment when it happens. -# The test issues sleep which makes the test either non-deterministic or -# wasting too much time. -# ---sleep 3 - -send stop slave sql_thread; - -connection slave; -rollback; # release the sql thread - -connection slave1; -reap; -source include/wait_for_slave_sql_to_stop.inc; -let $sql_status= query_get_value(SHOW SLAVE STATUS, Slave_SQL_Running, 1); ---echo *** sql thread is *not* running: $sql_status *** - -let $pos1_slave= query_get_value(SHOW SLAVE STATUS, Exec_Master_Log_Pos, 1); - ---echo *** the prove: the stopped slave has rolled back the current transaction *** - ---disable_query_log -select count(*) as zero from t1i; -eval select $pos0_master - $pos0_slave as zero; -eval select $pos1_master > $pos0_slave as one; ---enable_query_log - -start slave sql_thread; - -# clean-up - -connection master; -drop table t1i, t2m; - ---source include/rpl_end.inc diff --git a/mysql-test/suite/rpl/r/rpl_bug37426.result b/mysql-test/suite/rpl/r/rpl_bug37426.result new file mode 100644 index 00000000000..bf96255c7b4 --- /dev/null +++ b/mysql-test/suite/rpl/r/rpl_bug37426.result @@ -0,0 +1,12 @@ +include/master-slave.inc +[connection master] +CREATE TABLE char128_utf8 (i1 INT NOT NULL, c CHAR(128) CHARACTER SET utf8 NOT NULL, i2 INT NOT NULL); +INSERT INTO char128_utf8 VALUES ( 1, "123", 1 ); +SELECT * FROM char128_utf8; +i1 c i2 +1 123 1 +SELECT * FROM char128_utf8; +i1 c i2 +1 123 1 +DROP TABLE char128_utf8; +include/rpl_end.inc diff --git a/mysql-test/suite/bugs/t/rpl_bug37426.test b/mysql-test/suite/rpl/t/rpl_bug37426.test similarity index 71% rename from mysql-test/suite/bugs/t/rpl_bug37426.test rename to mysql-test/suite/rpl/t/rpl_bug37426.test index 4c7729ab837..d0a60524fef 100644 --- a/mysql-test/suite/bugs/t/rpl_bug37426.test +++ b/mysql-test/suite/rpl/t/rpl_bug37426.test @@ -7,15 +7,16 @@ source include/master-slave.inc; source include/have_binlog_format_row.inc; connection master; -CREATE TABLE char128_utf8 ( - i1 INT NOT NULL, - c CHAR(128) CHARACTER SET utf8 NOT NULL, - i2 INT NOT NULL); - +CREATE TABLE char128_utf8 (i1 INT NOT NULL, c CHAR(128) CHARACTER SET utf8 NOT NULL, i2 INT NOT NULL); INSERT INTO char128_utf8 VALUES ( 1, "123", 1 ); SELECT * FROM char128_utf8; sync_slave_with_master; SELECT * FROM char128_utf8; + +# Clean up +connection master; +DROP TABLE char128_utf8; +sync_slave_with_master; --source include/rpl_end.inc From 3abe56f31d90f2cc84399e042b5f105b87b2b01a Mon Sep 17 00:00:00 2001 From: Sergey Glukhov Date: Thu, 14 Apr 2011 12:11:57 +0400 Subject: [PATCH 186/202] Bug#11756242 48137: PROCEDURE ANALYSE() LEAKS MEMORY WHEN RETURNING NULL There are two problems with ANALYSE(): 1. Memory leak it happens because do_select() can overwrite JOIN::procedure field(with zero value in our case) and JOIN destructor don't free the memory allocated for JOIN::procedure. The fix is to save original JOIN::procedure before do_select() call and restore it after do_select execution. 2. Wrong result If ANALYSE() procedure is used for the statement with LIMIT clause it could retrun empty result set. It happens because of missing analyse::end_of_records() call. First end_send() function call returns NESTED_LOOP_QUERY_LIMIT and second call of end_send() with end_of_records flag enabled does not happen. The fix is to return NESTED_LOOP_OK from end_send() if procedure is active. mysql-test/r/analyse.result: test case mysql-test/t/analyse.test: test case sql/sql_select.cc: --save original JOIN::procedure before do_select() call and restore it after do_select execution. --return NESTED_LOOP_OK from end_send() if procedure is active --- mysql-test/r/analyse.result | 13 +++++++++++++ mysql-test/t/analyse.test | 12 ++++++++++++ sql/sql_select.cc | 16 ++++++++++++---- 3 files changed, 37 insertions(+), 4 deletions(-) diff --git a/mysql-test/r/analyse.result b/mysql-test/r/analyse.result index 92fc26e7ba3..f82439090f6 100644 --- a/mysql-test/r/analyse.result +++ b/mysql-test/r/analyse.result @@ -135,4 +135,17 @@ SELECT * FROM t1 PROCEDURE ANALYSE(); Field_name Min_value Max_value Min_length Max_length Empties_or_zeros Nulls Avg_value_or_avg_length Std Optimal_fieldtype test.t1.a e e- 1 2 0 0 1.3333 NULL ENUM('e','e-') NOT NULL DROP TABLE t1; +# +# Bug#11756242 48137: PROCEDURE ANALYSE() LEAKS MEMORY WHEN RETURNING NULL +# +CREATE TABLE t1(f1 INT) ENGINE=MYISAM; +CREATE TABLE t2(f2 INT) ENGINE=INNODB; +INSERT INTO t2 VALUES (1); +SELECT DISTINCTROW f1 FROM t1 NATURAL RIGHT OUTER JOIN t2 PROCEDURE ANALYSE(); +Field_name Min_value Max_value Min_length Max_length Empties_or_zeros Nulls Avg_value_or_avg_length Std Optimal_fieldtype +test.t1.f1 NULL NULL 0 0 0 1 0.0 0.0 CHAR(0) +SELECT * FROM t2 LIMIT 1 PROCEDURE ANALYSE(); +Field_name Min_value Max_value Min_length Max_length Empties_or_zeros Nulls Avg_value_or_avg_length Std Optimal_fieldtype +test.t2.f2 1 1 1 1 0 0 1.0000 0.0000 ENUM('1') NOT NULL +DROP TABLE t1, t2; End of 5.1 tests diff --git a/mysql-test/t/analyse.test b/mysql-test/t/analyse.test index 63929d8766b..c77967a0cc9 100644 --- a/mysql-test/t/analyse.test +++ b/mysql-test/t/analyse.test @@ -1,6 +1,7 @@ # # Test of procedure analyse # +-- source include/have_innodb.inc --disable_warnings drop table if exists t1,t2; @@ -144,4 +145,15 @@ INSERT INTO t1 VALUES ('e'),('e'),('e-'); SELECT * FROM t1 PROCEDURE ANALYSE(); DROP TABLE t1; +--echo # +--echo # Bug#11756242 48137: PROCEDURE ANALYSE() LEAKS MEMORY WHEN RETURNING NULL +--echo # + +CREATE TABLE t1(f1 INT) ENGINE=MYISAM; +CREATE TABLE t2(f2 INT) ENGINE=INNODB; +INSERT INTO t2 VALUES (1); +SELECT DISTINCTROW f1 FROM t1 NATURAL RIGHT OUTER JOIN t2 PROCEDURE ANALYSE(); +SELECT * FROM t2 LIMIT 1 PROCEDURE ANALYSE(); +DROP TABLE t1, t2; + --echo End of 5.1 tests diff --git a/sql/sql_select.cc b/sql/sql_select.cc index eb2559fc600..84a09fbc7e6 100644 --- a/sql/sql_select.cc +++ b/sql/sql_select.cc @@ -1929,7 +1929,11 @@ JOIN::exec() if (!curr_join->sort_and_group && curr_join->const_tables != curr_join->tables) curr_join->join_tab[curr_join->const_tables].sorted= 0; - if ((tmp_error= do_select(curr_join, (List *) 0, curr_tmp_table, 0))) + + Procedure *save_proc= curr_join->procedure; + tmp_error= do_select(curr_join, (List *) 0, curr_tmp_table, 0); + curr_join->procedure= save_proc; + if (tmp_error) { error= tmp_error; DBUG_VOID_RETURN; @@ -12354,10 +12358,14 @@ end_send(JOIN *join, JOIN_TAB *join_tab __attribute__((unused)), int error; if (join->having && join->having->val_int() == 0) DBUG_RETURN(NESTED_LOOP_OK); // Didn't match having - error=0; if (join->procedure) - error=join->procedure->send_row(join->procedure_fields_list); - else if (join->do_send_rows) + { + if (join->procedure->send_row(join->procedure_fields_list)) + DBUG_RETURN(NESTED_LOOP_ERROR); + DBUG_RETURN(NESTED_LOOP_OK); + } + error=0; + if (join->do_send_rows) error=join->result->send_data(*join->fields); if (error) DBUG_RETURN(NESTED_LOOP_ERROR); /* purecov: inspected */ From 7634e724e786a91aeb9b450818230629beb66228 Mon Sep 17 00:00:00 2001 From: Serge Kozlov Date: Thu, 14 Apr 2011 15:24:11 +0400 Subject: [PATCH 187/202] WL#5867, postfix for binlog_bug23533 --- mysql-test/suite/binlog/r/binlog_bug23533.result | 3 --- mysql-test/suite/binlog/t/binlog_bug23533.test | 1 - 2 files changed, 4 deletions(-) diff --git a/mysql-test/suite/binlog/r/binlog_bug23533.result b/mysql-test/suite/binlog/r/binlog_bug23533.result index 8a28867afb4..07b124793d1 100644 --- a/mysql-test/suite/binlog/r/binlog_bug23533.result +++ b/mysql-test/suite/binlog/r/binlog_bug23533.result @@ -3,9 +3,6 @@ CREATE TABLE t1 (a INT NOT NULL AUTO_INCREMENT, b TEXT, PRIMARY KEY(a)) ENGINE=I SELECT COUNT(*) FROM t1; COUNT(*) 1000 -SHOW VARIABLES LIKE 'max_binlog_cache_size'; -Variable_name Value -max_binlog_cache_size 4294963200 SET @saved_max_binlog_cache_size=@@max_binlog_cache_size; SET GLOBAL max_binlog_cache_size=4096; START TRANSACTION; diff --git a/mysql-test/suite/binlog/t/binlog_bug23533.test b/mysql-test/suite/binlog/t/binlog_bug23533.test index 3c9a7ab5896..fb2fc808b7b 100644 --- a/mysql-test/suite/binlog/t/binlog_bug23533.test +++ b/mysql-test/suite/binlog/t/binlog_bug23533.test @@ -22,7 +22,6 @@ while ($i) SELECT COUNT(*) FROM t1; # Set small value for max_binlog_cache_size -SHOW VARIABLES LIKE 'max_binlog_cache_size'; SET @saved_max_binlog_cache_size=@@max_binlog_cache_size; SET GLOBAL max_binlog_cache_size=4096; From e675ed063e890c4f442d61eaa6837119505449eb Mon Sep 17 00:00:00 2001 From: Bjorn Munch Date: Thu, 14 Apr 2011 16:17:58 +0200 Subject: [PATCH 188/202] Bug #12351213 MTR --VS-CONFIG DOES NOT WORK LIKE MTR_VS_CONFIG Fix for --vs-config applied Find.pm incorrectly tested an unitialized local variable instead of the global, corrected. Find.pm is also wrong in 5.5: uses a non-existent global variable. Fix when merging up. --- mysql-test/lib/My/Find.pm | 6 ++---- mysql-test/mysql-test-run.pl | 4 ++-- 2 files changed, 4 insertions(+), 6 deletions(-) diff --git a/mysql-test/lib/My/Find.pm b/mysql-test/lib/My/Find.pm index 9c89a7e4e2a..8cbd6db3201 100644 --- a/mysql-test/lib/My/Find.pm +++ b/mysql-test/lib/My/Find.pm @@ -1,5 +1,5 @@ # -*- cperl -*- -# Copyright (C) 2008 MySQL AB +# Copyright (c) 2004, 2011, Oracle and/or its affiliates. All rights reserved. # # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by @@ -28,8 +28,6 @@ use My::Platform; use base qw(Exporter); our @EXPORT= qw(my_find_bin my_find_dir my_find_file NOT_REQUIRED); -our $vs_config_dir; - my $bin_extension= ".exe" if IS_WINDOWS; # Helper function to be used for fourth parameter to find functions @@ -158,7 +156,7 @@ sub my_find_paths { # User can select to look in a special build dir # which is a subdirectory of any of the paths my @extra_dirs; - my $build_dir= $vs_config_dir || $ENV{MTR_VS_CONFIG} || $ENV{MTR_BUILD_DIR}; + my $build_dir= $::opt_vs_config || $ENV{MTR_VS_CONFIG} || $ENV{MTR_BUILD_DIR}; push(@extra_dirs, $build_dir) if defined $build_dir; if (defined $extension){ diff --git a/mysql-test/mysql-test-run.pl b/mysql-test/mysql-test-run.pl index 2301b2444d3..9b8b1dc67cf 100755 --- a/mysql-test/mysql-test-run.pl +++ b/mysql-test/mysql-test-run.pl @@ -1,7 +1,7 @@ #!/usr/bin/perl # -*- cperl -*- -# Copyright (c) 2004, 2010, Oracle and/or its affiliates. All rights reserved. +# Copyright (c) 2004, 2011, Oracle and/or its affiliates. All rights reserved. # # This program is free software; you can redistribute it and/or # modify it under the terms of the GNU Library General Public @@ -893,7 +893,7 @@ sub command_line_setup { 'ssl|with-openssl' => \$opt_ssl, 'skip-ssl' => \$opt_skip_ssl, 'compress' => \$opt_compress, - 'vs-config' => \$opt_vs_config, + 'vs-config=s' => \$opt_vs_config, # Max number of parallel threads to use 'parallel=s' => \$opt_parallel, From dd3d9477b25b546407e18b4b474e766db1709aa7 Mon Sep 17 00:00:00 2001 From: Tor Didriksen Date: Thu, 14 Apr 2011 16:35:24 +0200 Subject: [PATCH 189/202] Bug#11765713 58705: OPTIMIZER LET ENGINE DEPEND ON UNINITIALIZED VALUES CREATED BY OPT_SUM_QU Valgrind warnings were caused by comparing index values to an un-initialized field. mysql-test/r/subselect.result: New test cases. mysql-test/t/subselect.test: New test cases. sql/opt_sum.cc: Add thd to opt_sum_query enabling it to test for errors. If we have a non-nullable index, we cannot use it to match null values, since set_null() will be ignored, and we might compare uninitialized data. sql/sql_select.cc: Add thd to opt_sum_query, enabling it to test for errors. sql/sql_select.h: Add thd to opt_sum_query, enabling it to test for errors. --- mysql-test/r/subselect.result | 18 +++++++++++++++ mysql-test/t/subselect.test | 22 ++++++++++++++++++ sql/opt_sum.cc | 43 +++++++++++++++++++++++++---------- sql/sql_select.cc | 2 +- sql/sql_select.h | 3 ++- 5 files changed, 74 insertions(+), 14 deletions(-) diff --git a/mysql-test/r/subselect.result b/mysql-test/r/subselect.result index dc40e42275b..5f86b0db132 100644 --- a/mysql-test/r/subselect.result +++ b/mysql-test/r/subselect.result @@ -4734,3 +4734,21 @@ SELECT * FROM t2 UNION SELECT * FROM t2 ORDER BY (SELECT * FROM t1 WHERE MATCH(a) AGAINST ('+abc' IN BOOLEAN MODE)); DROP TABLE t1,t2; End of 5.1 tests +# +# Bug #11765713 58705: +# OPTIMIZER LET ENGINE DEPEND ON UNINITIALIZED VALUES +# CREATED BY OPT_SUM_QUERY +# +CREATE TABLE t1(a INT NOT NULL, KEY (a)); +INSERT INTO t1 VALUES (0), (1); +SELECT 1 as foo FROM t1 WHERE a < SOME +(SELECT a FROM t1 WHERE a <=> +(SELECT a FROM t1) +); +ERROR 21000: Subquery returns more than 1 row +SELECT 1 as foo FROM t1 WHERE a < SOME +(SELECT a FROM t1 WHERE a <=> +(SELECT a FROM t1 where a is null) +); +foo +DROP TABLE t1; diff --git a/mysql-test/t/subselect.test b/mysql-test/t/subselect.test index 1f471b46c4e..94a3df21998 100644 --- a/mysql-test/t/subselect.test +++ b/mysql-test/t/subselect.test @@ -3726,3 +3726,25 @@ DROP TABLE t1,t2; --enable_result_log --echo End of 5.1 tests + +--echo # +--echo # Bug #11765713 58705: +--echo # OPTIMIZER LET ENGINE DEPEND ON UNINITIALIZED VALUES +--echo # CREATED BY OPT_SUM_QUERY +--echo # + +CREATE TABLE t1(a INT NOT NULL, KEY (a)); +INSERT INTO t1 VALUES (0), (1); + +--error ER_SUBQUERY_NO_1_ROW +SELECT 1 as foo FROM t1 WHERE a < SOME + (SELECT a FROM t1 WHERE a <=> + (SELECT a FROM t1) + ); + +SELECT 1 as foo FROM t1 WHERE a < SOME + (SELECT a FROM t1 WHERE a <=> + (SELECT a FROM t1 where a is null) + ); + +DROP TABLE t1; diff --git a/sql/opt_sum.cc b/sql/opt_sum.cc index b20a0c4fcbe..1eef3798908 100644 --- a/sql/opt_sum.cc +++ b/sql/opt_sum.cc @@ -211,6 +211,7 @@ static int get_index_max_value(TABLE *table, TABLE_REF *ref, uint range_fl) /** Substitutes constants for some COUNT(), MIN() and MAX() functions. + @param thd thread handler @param tables list of leaves of join table tree @param all_fields All fields to be returned @param conds WHERE clause @@ -228,9 +229,12 @@ static int get_index_max_value(TABLE *table, TABLE_REF *ref, uint range_fl) HA_ERR_KEY_NOT_FOUND on impossible conditions @retval HA_ERR_... if a deadlock or a lock wait timeout happens, for example + @retval + ER_... e.g. ER_SUBQUERY_NO_1_ROW */ -int opt_sum_query(TABLE_LIST *tables, List &all_fields,COND *conds) +int opt_sum_query(THD *thd, + TABLE_LIST *tables, List &all_fields, COND *conds) { List_iterator_fast it(all_fields); int const_result= 1; @@ -242,6 +246,8 @@ int opt_sum_query(TABLE_LIST *tables, List &all_fields,COND *conds) Item *item; int error; + DBUG_ENTER("opt_sum_query"); + if (conds) where_tables= conds->used_tables(); @@ -269,7 +275,7 @@ int opt_sum_query(TABLE_LIST *tables, List &all_fields,COND *conds) WHERE t2.field IS NULL; */ if (tl->table->map & where_tables) - return 0; + DBUG_RETURN(0); } else used_tables|= tl->table->map; @@ -297,7 +303,7 @@ int opt_sum_query(TABLE_LIST *tables, List &all_fields,COND *conds) { tl->table->file->print_error(error, MYF(0)); tl->table->in_use->fatal_error(); - return error; + DBUG_RETURN(error); } count*= tl->table->file->stats.records; } @@ -390,10 +396,10 @@ int opt_sum_query(TABLE_LIST *tables, List &all_fields,COND *conds) if (error) { if (error == HA_ERR_KEY_NOT_FOUND || error == HA_ERR_END_OF_FILE) - return HA_ERR_KEY_NOT_FOUND; // No rows matching WHERE + DBUG_RETURN(HA_ERR_KEY_NOT_FOUND); // No rows matching WHERE /* HA_ERR_LOCK_DEADLOCK or some other error */ table->file->print_error(error, MYF(0)); - return(error); + DBUG_RETURN(error); } removed_tables|= table->map; } @@ -437,6 +443,10 @@ int opt_sum_query(TABLE_LIST *tables, List &all_fields,COND *conds) const_result= 0; } } + + if (thd->is_error()) + DBUG_RETURN(thd->main_da.sql_errno()); + /* If we have a where clause, we can only ignore searching in the tables if MIN/MAX optimisation replaced all used tables @@ -446,7 +456,7 @@ int opt_sum_query(TABLE_LIST *tables, List &all_fields,COND *conds) */ if (removed_tables && used_tables != removed_tables) const_result= 0; // We didn't remove all tables - return const_result; + DBUG_RETURN(const_result); } @@ -732,6 +742,12 @@ static bool matching_cond(bool max_fl, TABLE_REF *ref, KEY *keyinfo, if (is_null || (is_null_safe_eq && args[1]->is_null())) { + /* + If we have a non-nullable index, we cannot use it, + since set_null will be ignored, and we will compare uninitialized data. + */ + if (!part->field->real_maybe_null()) + DBUG_RETURN(false); part->field->set_null(); *key_ptr= (uchar) 1; } @@ -802,8 +818,9 @@ static bool matching_cond(bool max_fl, TABLE_REF *ref, KEY *keyinfo, @param[out] prefix_len Length of prefix for the search range @note - This function may set table->key_read to 1, which must be reset after - index is used! (This can only happen when function returns 1) + This function may set field->table->key_read to true, + which must be reset after index is used! + (This can only happen when function returns 1) @retval 0 Index can not be used to optimize MIN(field)/MAX(field) @@ -818,7 +835,9 @@ static bool find_key_for_maxmin(bool max_fl, TABLE_REF *ref, uint *range_fl, uint *prefix_len) { if (!(field->flags & PART_KEY_FLAG)) - return 0; // Not key field + return false; // Not key field + + DBUG_ENTER("find_key_for_maxmin"); TABLE *table= field->table; uint idx= 0; @@ -843,7 +862,7 @@ static bool find_key_for_maxmin(bool max_fl, TABLE_REF *ref, part++, jdx++, key_part_to_use= (key_part_to_use << 1) | 1) { if (!(table->file->index_flags(idx, jdx, 0) & HA_READ_ORDER)) - return 0; + DBUG_RETURN(false); /* Check whether the index component is partial */ Field *part_field= table->field[part->fieldnr-1]; @@ -892,12 +911,12 @@ static bool find_key_for_maxmin(bool max_fl, TABLE_REF *ref, */ if (field->part_of_key.is_set(idx)) table->set_keyread(TRUE); - return 1; + DBUG_RETURN(true); } } } } - return 0; + DBUG_RETURN(false); } diff --git a/sql/sql_select.cc b/sql/sql_select.cc index 84a09fbc7e6..ab287e57aa1 100644 --- a/sql/sql_select.cc +++ b/sql/sql_select.cc @@ -961,7 +961,7 @@ JOIN::optimize() If all items were resolved by opt_sum_query, there is no need to open any tables. */ - if ((res=opt_sum_query(select_lex->leaf_tables, all_fields, conds))) + if ((res=opt_sum_query(thd, select_lex->leaf_tables, all_fields, conds))) { if (res == HA_ERR_KEY_NOT_FOUND) { diff --git a/sql/sql_select.h b/sql/sql_select.h index 5350e28d8ff..dd810ae5156 100644 --- a/sql/sql_select.h +++ b/sql/sql_select.h @@ -612,7 +612,8 @@ Field* create_tmp_field_from_field(THD *thd, Field* org_field, /* functions from opt_sum.cc */ bool simple_pred(Item_func *func_item, Item **args, bool *inv_order); -int opt_sum_query(TABLE_LIST *tables, List &all_fields,COND *conds); +int opt_sum_query(THD* thd, + TABLE_LIST *tables, List &all_fields, COND *conds); /* from sql_delete.cc, used by opt_range.cc */ extern "C" int refpos_order_cmp(void* arg, const void *a,const void *b); From c95227ca54c291d372e1136d52a0ecc9eb0294cf Mon Sep 17 00:00:00 2001 From: Bjorn Munch Date: Fri, 15 Apr 2011 10:30:52 +0200 Subject: [PATCH 190/202] Bug #12360195 MTR DOES NOT IGNORE TABS IN EXPERIMENTAL FILE Instead of just filtering space, filter white space (\s) I left the default.experimental file as is, with tabs. --- mysql-test/mysql-test-run.pl | 6 +++--- 1 file changed, 3 insertions(+), 3 deletions(-) diff --git a/mysql-test/mysql-test-run.pl b/mysql-test/mysql-test-run.pl index 9b8b1dc67cf..2897ae3142a 100755 --- a/mysql-test/mysql-test-run.pl +++ b/mysql-test/mysql-test-run.pl @@ -1123,7 +1123,7 @@ sub command_line_setup { chomp; # remove comments (# foo) at the beginning of the line, or after a # blank at the end of the line - s/( +|^)#.*$//; + s/(\s+|^)#.*$//; # If @ platform specifier given, use this entry only if it contains # @ or @! where xxx != platform if (/\@.*/) @@ -1134,8 +1134,8 @@ sub command_line_setup { s/\@.*$//; } # remove whitespace - s/^ +//; - s/ +$//; + s/^\s+//; + s/\s+$//; # if nothing left, don't need to remember this line if ( $_ eq "" ) { next; From bba7b9ca0c96a1c140e725776b5e0382a4f62152 Mon Sep 17 00:00:00 2001 From: Sergey Glukhov Date: Fri, 15 Apr 2011 12:51:34 +0400 Subject: [PATCH 191/202] Bug#11765139 58069: LOAD DATA INFILE: VALGRIND REPORTS INVALID MEMORY READS AND WRITES WITH U Some multibyte sequences could be considered by my_mbcharlen() functions as multibyte character but more exact my_ismbchar() does not think so. In such a case this multibyte sequences is pushed into 'stack' buffer which is too small to accommodate the sequence. The fix is to allocate stack buffer in compliance with max character length. mysql-test/r/loaddata.result: test case mysql-test/t/loaddata.test: test case sql/sql_load.cc: allocate stack buffer in compliance with max character length. --- mysql-test/r/loaddata.result | 7 +++++++ mysql-test/t/loaddata.test | 13 +++++++++++++ sql/sql_load.cc | 2 +- 3 files changed, 21 insertions(+), 1 deletion(-) diff --git a/mysql-test/r/loaddata.result b/mysql-test/r/loaddata.result index 40c278380b1..3a421b3ea3f 100644 --- a/mysql-test/r/loaddata.result +++ b/mysql-test/r/loaddata.result @@ -532,4 +532,11 @@ a 0 1 DROP TABLE t1; +# +# Bug#11765139 58069: LOAD DATA INFILE: VALGRIND REPORTS INVALID MEMORY READS AND WRITES WITH U +# +CREATE TABLE t1(f1 INT); +SELECT 0xE1BB30 INTO OUTFILE 't1.dat'; +LOAD DATA INFILE 't1.dat' IGNORE INTO TABLE t1 CHARACTER SET utf8; +DROP TABLE t1; End of 5.1 tests diff --git a/mysql-test/t/loaddata.test b/mysql-test/t/loaddata.test index 821453777f5..e0764b67ec0 100644 --- a/mysql-test/t/loaddata.test +++ b/mysql-test/t/loaddata.test @@ -611,5 +611,18 @@ DROP TABLE t1; let $MYSQLD_DATADIR= `select @@datadir`; remove_file $MYSQLD_DATADIR/test/tmpp2.txt; +--echo # +--echo # Bug#11765139 58069: LOAD DATA INFILE: VALGRIND REPORTS INVALID MEMORY READS AND WRITES WITH U +--echo # + +CREATE TABLE t1(f1 INT); +EVAL SELECT 0xE1BB30 INTO OUTFILE 't1.dat'; +--disable_warnings +LOAD DATA INFILE 't1.dat' IGNORE INTO TABLE t1 CHARACTER SET utf8; +--enable_warnings + +DROP TABLE t1; +let $MYSQLD_DATADIR= `select @@datadir`; +remove_file $MYSQLD_DATADIR/test/t1.dat; --echo End of 5.1 tests diff --git a/sql/sql_load.cc b/sql/sql_load.cc index c227fe69b62..513cd62b510 100644 --- a/sql/sql_load.cc +++ b/sql/sql_load.cc @@ -1109,7 +1109,7 @@ READ_INFO::READ_INFO(File file_par, uint tot_length, CHARSET_INFO *cs, /* Set of a stack for unget if long terminators */ - uint length=max(field_term_length,line_term_length)+1; + uint length= max(cs->mbmaxlen, max(field_term_length, line_term_length)) + 1; set_if_bigger(length,line_start.length()); stack=stack_pos=(int*) sql_alloc(sizeof(int)*length); From 8dabe8aa92bb825d2bd2a78d2cb5ca30782576be Mon Sep 17 00:00:00 2001 From: Martin Hansson Date: Mon, 18 Apr 2011 10:44:41 +0200 Subject: [PATCH 192/202] Bug 11758558 - 50774: WRONG RESULTSET WHEN TIMESTAMP VALUES ARE APPENDED WITH .0 The bug was fixed by the patch for bug number BUG 11763109 - 55779: SELECT DOES NOT WORK PROPERLY IN MYSQL SERVER VERSION "5.1.42 SUSE MYSQL (Exact same fix as was proposed for this bug.) Since the motivation for the two bug reports was completely different, however, it still makes sense to push the test case. This patch contains only the test case. --- mysql-test/r/type_timestamp.result | 63 ++++++++++++++++++++++++++++++ mysql-test/t/type_timestamp.test | 47 ++++++++++++++++++++++ 2 files changed, 110 insertions(+) diff --git a/mysql-test/r/type_timestamp.result b/mysql-test/r/type_timestamp.result index e88d3462466..3176879343c 100644 --- a/mysql-test/r/type_timestamp.result +++ b/mysql-test/r/type_timestamp.result @@ -547,4 +547,67 @@ a 2000-01-01 00:00:01 2000-01-01 00:00:01 DROP TABLE t1; +# +# Bug#50774: failed to get the correct resultset when timestamp values +# are appended with .0 +# +CREATE TABLE t1 ( a TIMESTAMP, KEY ( a ) ); +INSERT INTO t1 VALUES( '2010-02-01 09:31:01' ); +INSERT INTO t1 VALUES( '2010-02-01 09:31:02' ); +INSERT INTO t1 VALUES( '2010-02-01 09:31:03' ); +INSERT INTO t1 VALUES( '2010-02-01 09:31:04' ); +SELECT * FROM t1 WHERE a >= '2010-02-01 09:31:02.0'; +a +2010-02-01 09:31:02 +2010-02-01 09:31:03 +2010-02-01 09:31:04 +SELECT * FROM t1 WHERE '2010-02-01 09:31:02.0' <= a; +a +2010-02-01 09:31:02 +2010-02-01 09:31:03 +2010-02-01 09:31:04 +SELECT * FROM t1 WHERE a <= '2010-02-01 09:31:02.0'; +a +2010-02-01 09:31:01 +2010-02-01 09:31:02 +SELECT * FROM t1 WHERE '2010-02-01 09:31:02.0' >= a; +a +2010-02-01 09:31:01 +2010-02-01 09:31:02 +EXPLAIN +SELECT * FROM t1 WHERE a >= '2010-02-01 09:31:02.0'; +id select_type table type possible_keys key key_len ref rows Extra +x x x range x x x x x x +SELECT * FROM t1 WHERE a >= '2010-02-01 09:31:02.0'; +a +2010-02-01 09:31:02 +2010-02-01 09:31:03 +2010-02-01 09:31:04 +CREATE TABLE t2 ( a TIMESTAMP, KEY ( a DESC ) ); +INSERT INTO t2 VALUES( '2010-02-01 09:31:01' ); +INSERT INTO t2 VALUES( '2010-02-01 09:31:02' ); +INSERT INTO t2 VALUES( '2010-02-01 09:31:03' ); +INSERT INTO t2 VALUES( '2010-02-01 09:31:04' ); +INSERT INTO t2 VALUES( '2010-02-01 09:31:05' ); +INSERT INTO t2 VALUES( '2010-02-01 09:31:06' ); +INSERT INTO t2 VALUES( '2010-02-01 09:31:07' ); +INSERT INTO t2 VALUES( '2010-02-01 09:31:08' ); +INSERT INTO t2 VALUES( '2010-02-01 09:31:09' ); +INSERT INTO t2 VALUES( '2010-02-01 09:31:10' ); +INSERT INTO t2 VALUES( '2010-02-01 09:31:11' ); +# The bug would cause the range optimizer's comparison to use an open +# interval here. This reveals itself only in the number of reads +# performed. +FLUSH STATUS; +EXPLAIN +SELECT * FROM t2 WHERE a < '2010-02-01 09:31:02.0'; +id select_type table type possible_keys key key_len ref rows Extra +x x x range x x x x x x +SELECT * FROM t2 WHERE a < '2010-02-01 09:31:02.0'; +a +2010-02-01 09:31:01 +SHOW STATUS LIKE 'Handler_read_next'; +Variable_name Value +Handler_read_next 1 +DROP TABLE t1, t2; End of 5.1 tests diff --git a/mysql-test/t/type_timestamp.test b/mysql-test/t/type_timestamp.test index 602f6f089c2..53b45fc6732 100644 --- a/mysql-test/t/type_timestamp.test +++ b/mysql-test/t/type_timestamp.test @@ -373,4 +373,51 @@ SELECT a FROM t1 WHERE a >= '20000101000000'; DROP TABLE t1; +--echo # +--echo # Bug#50774: failed to get the correct resultset when timestamp values +--echo # are appended with .0 +--echo # +CREATE TABLE t1 ( a TIMESTAMP, KEY ( a ) ); + +INSERT INTO t1 VALUES( '2010-02-01 09:31:01' ); +INSERT INTO t1 VALUES( '2010-02-01 09:31:02' ); +INSERT INTO t1 VALUES( '2010-02-01 09:31:03' ); +INSERT INTO t1 VALUES( '2010-02-01 09:31:04' ); + +SELECT * FROM t1 WHERE a >= '2010-02-01 09:31:02.0'; +SELECT * FROM t1 WHERE '2010-02-01 09:31:02.0' <= a; +SELECT * FROM t1 WHERE a <= '2010-02-01 09:31:02.0'; +SELECT * FROM t1 WHERE '2010-02-01 09:31:02.0' >= a; + +--replace_column 1 x 2 x 3 x 5 x 6 x 7 x 8 x 9 x 10 x +EXPLAIN +SELECT * FROM t1 WHERE a >= '2010-02-01 09:31:02.0'; +SELECT * FROM t1 WHERE a >= '2010-02-01 09:31:02.0'; + +CREATE TABLE t2 ( a TIMESTAMP, KEY ( a DESC ) ); + +INSERT INTO t2 VALUES( '2010-02-01 09:31:01' ); +INSERT INTO t2 VALUES( '2010-02-01 09:31:02' ); +INSERT INTO t2 VALUES( '2010-02-01 09:31:03' ); +INSERT INTO t2 VALUES( '2010-02-01 09:31:04' ); +INSERT INTO t2 VALUES( '2010-02-01 09:31:05' ); +INSERT INTO t2 VALUES( '2010-02-01 09:31:06' ); +INSERT INTO t2 VALUES( '2010-02-01 09:31:07' ); +INSERT INTO t2 VALUES( '2010-02-01 09:31:08' ); +INSERT INTO t2 VALUES( '2010-02-01 09:31:09' ); +INSERT INTO t2 VALUES( '2010-02-01 09:31:10' ); +INSERT INTO t2 VALUES( '2010-02-01 09:31:11' ); + +--echo # The bug would cause the range optimizer's comparison to use an open +--echo # interval here. This reveals itself only in the number of reads +--echo # performed. +FLUSH STATUS; +--replace_column 1 x 2 x 3 x 5 x 6 x 7 x 8 x 9 x 10 x +EXPLAIN +SELECT * FROM t2 WHERE a < '2010-02-01 09:31:02.0'; +SELECT * FROM t2 WHERE a < '2010-02-01 09:31:02.0'; +SHOW STATUS LIKE 'Handler_read_next'; + +DROP TABLE t1, t2; + --echo End of 5.1 tests From 7b1967ad4e4eff38e3f7119ff53db49b5bdc3fa8 Mon Sep 17 00:00:00 2001 From: Sven Sandberg Date: Mon, 18 Apr 2011 14:42:14 +0200 Subject: [PATCH 193/202] test fails on more platforms, removed @freebsd from default.experimental. --- mysql-test/collections/default.experimental | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) diff --git a/mysql-test/collections/default.experimental b/mysql-test/collections/default.experimental index 72e14135ef0..9e74fa9bc30 100644 --- a/mysql-test/collections/default.experimental +++ b/mysql-test/collections/default.experimental @@ -26,7 +26,7 @@ ndb.* # joro : NDB tests marked as experiment rpl.rpl_innodb_bug28430 @solaris # Bug#46029 rpl.rpl_row_sp011 @solaris # Joro : Bug #45445 -rpl.rpl_stop_slave @freebsd # Sven : BUG#12345981 +rpl.rpl_stop_slave # Sven : BUG#12345981 rpl.rpl_bug37426 # WL#5867: skozlov: test case moved from unused bugs suite From dba184237a2504c880ed08e34e91e40a76f738e7 Mon Sep 17 00:00:00 2001 From: Serge Kozlov Date: Mon, 18 Apr 2011 23:59:15 +0400 Subject: [PATCH 194/202] BUG#12371924 Update test case --- mysql-test/collections/default.experimental | 5 +---- mysql-test/suite/binlog/r/binlog_bug23533.result | 3 +++ mysql-test/suite/binlog/t/binlog_bug23533.test | 5 +++++ 3 files changed, 9 insertions(+), 4 deletions(-) diff --git a/mysql-test/collections/default.experimental b/mysql-test/collections/default.experimental index 9e74fa9bc30..fb8c6845a5f 100644 --- a/mysql-test/collections/default.experimental +++ b/mysql-test/collections/default.experimental @@ -2,8 +2,7 @@ # in alphabetical order. This also helps with merge conflict resolution. binlog.binlog_multi_engine # joro : NDB tests marked as experimental as agreed with bochklin -binlog.binlog_bug23533 # WL#5867: skozlov: test case moved from unused bugs suite -binlog.binlog_bug36391 # WL#5867: skozlov: test case moved from unused bugs suite +binlog.binlog_bug23533 # skozlov: BUG#12371924 funcs_1.charset_collation_1 # depends on compile-time decisions @@ -27,8 +26,6 @@ ndb.* # joro : NDB tests marked as experiment rpl.rpl_innodb_bug28430 @solaris # Bug#46029 rpl.rpl_row_sp011 @solaris # Joro : Bug #45445 rpl.rpl_stop_slave # Sven : BUG#12345981 -rpl.rpl_bug37426 # WL#5867: skozlov: test case moved from unused bugs suite - rpl_ndb.* # joro : NDB tests marked as experimental as agreed with bochklin rpl_ndb.rpl_ndb_log # Bug#38998 diff --git a/mysql-test/suite/binlog/r/binlog_bug23533.result b/mysql-test/suite/binlog/r/binlog_bug23533.result index 07b124793d1..02605839ab0 100644 --- a/mysql-test/suite/binlog/r/binlog_bug23533.result +++ b/mysql-test/suite/binlog/r/binlog_bug23533.result @@ -3,7 +3,9 @@ CREATE TABLE t1 (a INT NOT NULL AUTO_INCREMENT, b TEXT, PRIMARY KEY(a)) ENGINE=I SELECT COUNT(*) FROM t1; COUNT(*) 1000 +SET @saved_binlog_cache_size=@@binlog_cache_size; SET @saved_max_binlog_cache_size=@@max_binlog_cache_size; +SET GLOBAL binlog_cache_size=4096; SET GLOBAL max_binlog_cache_size=4096; START TRANSACTION; CREATE TABLE t2 SELECT * FROM t1; @@ -13,4 +15,5 @@ SHOW TABLES LIKE 't%'; Tables_in_test (t%) t1 SET GLOBAL max_binlog_cache_size=@saved_max_binlog_cache_size; +SET GLOBAL binlog_cache_size=@saved_binlog_cache_size; DROP TABLE t1; diff --git a/mysql-test/suite/binlog/t/binlog_bug23533.test b/mysql-test/suite/binlog/t/binlog_bug23533.test index fb2fc808b7b..05fe9fd9523 100644 --- a/mysql-test/suite/binlog/t/binlog_bug23533.test +++ b/mysql-test/suite/binlog/t/binlog_bug23533.test @@ -15,14 +15,18 @@ CREATE TABLE t1 (a INT NOT NULL AUTO_INCREMENT, b TEXT, PRIMARY KEY(a)) ENGINE=I let $i= 1000; while ($i) { + BEGIN; eval INSERT INTO t1 VALUES($i, REPEAT('x', 4096)); + COMMIT; dec $i; } --enable_query_log SELECT COUNT(*) FROM t1; # Set small value for max_binlog_cache_size +SET @saved_binlog_cache_size=@@binlog_cache_size; SET @saved_max_binlog_cache_size=@@max_binlog_cache_size; +SET GLOBAL binlog_cache_size=4096; SET GLOBAL max_binlog_cache_size=4096; # Copied data from t1 into t2 large than max_binlog_cache_size @@ -34,4 +38,5 @@ SHOW TABLES LIKE 't%'; # 5.1 End of Test SET GLOBAL max_binlog_cache_size=@saved_max_binlog_cache_size; +SET GLOBAL binlog_cache_size=@saved_binlog_cache_size; DROP TABLE t1; From 90bbf9d615a592c31464c1a689040a9758581fdd Mon Sep 17 00:00:00 2001 From: Sergey Glukhov Date: Wed, 20 Apr 2011 11:39:20 +0400 Subject: [PATCH 195/202] Bug#11765923 58937: MANY VALGRIND ERRORS AFTER GROUPING BY RESULT OF DECIMAL COLUMN FUNCTION Bug#11764671 57533: UNINITIALISED VALUES IN COPY_AND_CONVERT (SQL_STRING.CC) WITH CERTAIN CHA When ROUND evaluates decimal result it uses Item::decimal value as fraction value for the result. In some cases Item::decimal is greater than real result fraction value and uninitialised memory of result(decimal) buffer can be used in further calculations. Issue is introduced by Bug33143 fix. The fix is to remove erroneous assignment. mysql-test/r/func_math.result: test case mysql-test/t/func_math.test: test case sql/item_func.cc: remove erroneous assignment --- mysql-test/r/func_math.result | 22 ++++++++++++++++++++++ mysql-test/t/func_math.test | 16 ++++++++++++++++ sql/item_func.cc | 3 --- 3 files changed, 38 insertions(+), 3 deletions(-) diff --git a/mysql-test/r/func_math.result b/mysql-test/r/func_math.result index ad0b872145b..b9118feab1a 100644 --- a/mysql-test/r/func_math.result +++ b/mysql-test/r/func_math.result @@ -518,4 +518,26 @@ CREATE TABLE t1 SELECT CEIL(LINESTRINGFROMWKB(1) DIV NULL); DROP TABLE t1; CREATE TABLE t1 SELECT FLOOR(LINESTRINGFROMWKB(1) DIV NULL); DROP TABLE t1; +# +# Bug#11765923 58937: MANY VALGRIND ERRORS AFTER GROUPING BY RESULT OF DECIMAL COLUMN FUNCTION +# +CREATE TABLE t1(f1 DECIMAL(22,1)); +INSERT INTO t1 VALUES (0),(1); +SELECT ROUND(f1, f1) FROM t1; +ROUND(f1, f1) +0.0 +1.0 +SELECT ROUND(f1, f1) FROM t1 GROUP BY 1; +ROUND(f1, f1) +0.0 +1.0 +DROP TABLE t1; +# +# Bug#11764671 57533: UNINITIALISED VALUES IN COPY_AND_CONVERT (SQL_STRING.CC) WITH CERTAIN CHA +# +SELECT ROUND(LEAST(15, -4939092, 0.2704), STDDEV('a')); +ROUND(LEAST(15, -4939092, 0.2704), STDDEV('a')) +-4939092.0000 +Warnings: +Warning 1292 Truncated incorrect DOUBLE value: 'a' End of 5.1 tests diff --git a/mysql-test/t/func_math.test b/mysql-test/t/func_math.test index 64b6a3a4ea6..9d51a5c94f9 100644 --- a/mysql-test/t/func_math.test +++ b/mysql-test/t/func_math.test @@ -333,4 +333,20 @@ DROP TABLE t1; CREATE TABLE t1 SELECT FLOOR(LINESTRINGFROMWKB(1) DIV NULL); DROP TABLE t1; +--echo # +--echo # Bug#11765923 58937: MANY VALGRIND ERRORS AFTER GROUPING BY RESULT OF DECIMAL COLUMN FUNCTION +--echo # + +CREATE TABLE t1(f1 DECIMAL(22,1)); +INSERT INTO t1 VALUES (0),(1); +SELECT ROUND(f1, f1) FROM t1; +SELECT ROUND(f1, f1) FROM t1 GROUP BY 1; +DROP TABLE t1; + +--echo # +--echo # Bug#11764671 57533: UNINITIALISED VALUES IN COPY_AND_CONVERT (SQL_STRING.CC) WITH CERTAIN CHA +--echo # + +SELECT ROUND(LEAST(15, -4939092, 0.2704), STDDEV('a')); + --echo End of 5.1 tests diff --git a/sql/item_func.cc b/sql/item_func.cc index 595629b51be..6a9c47954b7 100644 --- a/sql/item_func.cc +++ b/sql/item_func.cc @@ -2122,10 +2122,7 @@ my_decimal *Item_func_round::decimal_op(my_decimal *decimal_value) if (!(null_value= (args[0]->null_value || args[1]->null_value || my_decimal_round(E_DEC_FATAL_ERROR, value, (int) dec, truncate, decimal_value) > 1))) - { - decimal_value->frac= decimals; return decimal_value; - } return 0; } From f3b024cafa4c316774c8122031a1bbbc08a83379 Mon Sep 17 00:00:00 2001 From: Jon Olav Hauglid Date: Wed, 20 Apr 2011 11:32:28 +0200 Subject: [PATCH 196/202] BUG#12377872 ASSERTION FAILED: !_ENTERED WHEN GETHOSTBYADDR_R FAILS ON SOLARIS This assertion was triggered if gethostbyaddr_r cannot do a reverse lookup on an ip address. The reason was a missing DBUG_RETURN macro. The problem affected only debug versions of the server. This patch fixes the problem by replacing return with DBUG_RETURN. No test case added. --- sql/hostname.cc | 4 ++-- 1 file changed, 2 insertions(+), 2 deletions(-) diff --git a/sql/hostname.cc b/sql/hostname.cc index c8cf46383a9..9796755e9fb 100644 --- a/sql/hostname.cc +++ b/sql/hostname.cc @@ -1,4 +1,4 @@ -/* Copyright (C) 2000-2006 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by @@ -183,7 +183,7 @@ char * ip_to_hostname(struct in_addr *in, uint *errors) &tmp_hostent,buff,sizeof(buff),&tmp_errno))) { DBUG_PRINT("error",("gethostbyaddr_r returned %d",tmp_errno)); - return 0; + DBUG_RETURN(0); } if (!(check=my_gethostbyname_r(hp->h_name,&tmp_hostent2,buff2,sizeof(buff2), &tmp_errno))) From bd92ea43116b8ce606de5e6fc825e1a8b87a7740 Mon Sep 17 00:00:00 2001 From: Mattias Jonsson Date: Wed, 20 Apr 2011 17:52:33 +0200 Subject: [PATCH 197/202] Bug#11766249 bug#59316: PARTITIONING AND INDEX_MERGE MEMORY LEAK Update for previous patch according to reviewers comments. Updated the constructors for ha_partitions to use the common init_handler_variables functions Added use of defines for size and offset to get better readability for the code that reads and writes the .par file. Also refactored the get_from_handler_file function. --- sql/ha_partition.cc | 310 +++++++++++++++++++++++++------------------- sql/ha_partition.h | 17 ++- sql/handler.cc | 23 ++-- 3 files changed, 209 insertions(+), 141 deletions(-) diff --git a/sql/ha_partition.cc b/sql/ha_partition.cc index 946ecc652ef..7685b3a8384 100644 --- a/sql/ha_partition.cc +++ b/sql/ha_partition.cc @@ -166,11 +166,6 @@ ha_partition::ha_partition(handlerton *hton, TABLE_SHARE *share) :handler(hton, share) { DBUG_ENTER("ha_partition::ha_partition(table)"); - m_part_info= NULL; - m_create_handler= FALSE; - m_is_sub_partitioned= 0; - m_is_clone_of= NULL; - m_clone_mem_root= NULL; init_handler_variables(); DBUG_VOID_RETURN; } @@ -192,21 +187,21 @@ ha_partition::ha_partition(handlerton *hton, partition_info *part_info) { DBUG_ENTER("ha_partition::ha_partition(part_info)"); DBUG_ASSERT(part_info); + init_handler_variables(); m_part_info= part_info; m_create_handler= TRUE; m_is_sub_partitioned= m_part_info->is_sub_partitioned(); - init_handler_variables(); DBUG_VOID_RETURN; } /** ha_partition constructor method used by ha_partition::clone() - @param hton Handlerton (partition_hton) - @param share Table share object - @param part_info_arg partition_info to use - @param clone_arg ha_partition to clone - @param clme_mem_root_arg MEM_ROOT to use + @param hton Handlerton (partition_hton) + @param share Table share object + @param part_info_arg partition_info to use + @param clone_arg ha_partition to clone + @param clme_mem_root_arg MEM_ROOT to use @return New partition handler */ @@ -218,14 +213,12 @@ ha_partition::ha_partition(handlerton *hton, TABLE_SHARE *share, :handler(hton, share) { DBUG_ENTER("ha_partition::ha_partition(clone)"); + init_handler_variables(); m_part_info= part_info_arg; m_create_handler= TRUE; m_is_sub_partitioned= m_part_info->is_sub_partitioned(); m_is_clone_of= clone_arg; m_clone_mem_root= clone_mem_root_arg; - init_handler_variables(); - m_tot_parts= clone_arg->m_tot_parts; - DBUG_ASSERT(m_tot_parts); DBUG_VOID_RETURN; } @@ -286,6 +279,11 @@ void ha_partition::init_handler_variables() this allows blackhole to work properly */ m_no_locks= 0; + m_part_info= NULL; + m_create_handler= FALSE; + m_is_sub_partitioned= 0; + m_is_clone_of= NULL; + m_clone_mem_root= NULL; #ifdef DONT_HAVE_TO_BE_INITALIZED m_start_key.flag= 0; @@ -2099,18 +2097,16 @@ static uint name_add(char *dest, const char *first_name, const char *sec_name) } -/* +/** Create the special .par file - SYNOPSIS - create_handler_file() - name Full path of table name + @param name Full path of table name - RETURN VALUE - >0 Error code - 0 Success + @return Operation status + @retval FALSE Error code + @retval TRUE Success - DESCRIPTION + @note Method used to create handler file with names of partitions, their engine types and the number of partitions. */ @@ -2174,19 +2170,22 @@ bool ha_partition::create_handler_file(const char *name) Array of engine types n * 4 bytes where n = (m_tot_parts + 3)/4 Length of name part in bytes 4 bytes + (Names in filename format) Name part m * 4 bytes where m = ((length_name_part + 3)/4)*4 All padding bytes are zeroed */ - tot_partition_words= (tot_parts + 3) / 4; - tot_name_words= (tot_name_len + 3) / 4; + tot_partition_words= (tot_parts + PAR_WORD_SIZE - 1) / PAR_WORD_SIZE; + tot_name_words= (tot_name_len + PAR_WORD_SIZE - 1) / PAR_WORD_SIZE; + /* 4 static words (tot words, checksum, tot partitions, name length) */ tot_len_words= 4 + tot_partition_words + tot_name_words; - tot_len_byte= 4 * tot_len_words; + tot_len_byte= PAR_WORD_SIZE * tot_len_words; if (!(file_buffer= (uchar *) my_malloc(tot_len_byte, MYF(MY_ZEROFILL)))) DBUG_RETURN(TRUE); - engine_array= (file_buffer + 12); - name_buffer_ptr= (char*) (file_buffer + ((4 + tot_partition_words) * 4)); + engine_array= (file_buffer + PAR_ENGINES_OFFSET); + name_buffer_ptr= (char*) (engine_array + tot_partition_words * PAR_WORD_SIZE + + PAR_WORD_SIZE); part_it.rewind(); for (i= 0; i < no_parts; i++) { @@ -2224,13 +2223,15 @@ bool ha_partition::create_handler_file(const char *name) } chksum= 0; int4store(file_buffer, tot_len_words); - int4store(file_buffer + 8, tot_parts); - int4store(file_buffer + 12 + (tot_partition_words * 4), tot_name_len); + int4store(file_buffer + PAR_NUM_PARTS_OFFSET, tot_parts); + int4store(file_buffer + PAR_ENGINES_OFFSET + + (tot_partition_words * PAR_WORD_SIZE), + tot_name_len); for (i= 0; i < tot_len_words; i++) - chksum^= uint4korr(file_buffer + 4 * i); - int4store(file_buffer + 4, chksum); + chksum^= uint4korr(file_buffer + PAR_WORD_SIZE * i); + int4store(file_buffer + PAR_CHECKSUM_OFFSET, chksum); /* - Remove .frm extension and replace with .par + Add .par extension to the file name. Create and write and close file to be used at open, delete_table and rename_table */ @@ -2248,14 +2249,9 @@ bool ha_partition::create_handler_file(const char *name) DBUG_RETURN(result); } -/* + +/** Clear handler variables and free some memory - - SYNOPSIS - clear_handler_file() - - RETURN VALUE - NONE */ void ha_partition::clear_handler_file() @@ -2268,16 +2264,15 @@ void ha_partition::clear_handler_file() m_engine_array= NULL; } -/* + +/** Create underlying handler objects - SYNOPSIS - create_handlers() - mem_root Allocate memory through this + @para mem_root Allocate memory through this - RETURN VALUE - TRUE Error - FALSE Success + @return Operation status + @retval TRUE Error + @retval FALSE Success */ bool ha_partition::create_handlers(MEM_ROOT *mem_root) @@ -2315,6 +2310,7 @@ bool ha_partition::create_handlers(MEM_ROOT *mem_root) DBUG_RETURN(FALSE); } + /* Create underlying handler objects from partition info @@ -2386,108 +2382,164 @@ error_end: } -/* - Get info about partition engines and their names from the .par file +/** + Read the .par file to get the partitions engines and names - SYNOPSIS - get_from_handler_file() - name Full path of table name - mem_root Allocate memory through this + @param name Name of table file (without extention) - RETURN VALUE - TRUE Error - FALSE Success + @return Operation status + @retval true Failure + @retval false Success - DESCRIPTION - Open handler file to get partition names, engine types and number of - partitions. + @note On success, m_file_buffer is allocated and must be + freed by the caller. m_name_buffer_ptr and m_tot_parts is also set. */ -bool ha_partition::get_from_handler_file(const char *name, MEM_ROOT *mem_root, - bool clone) +bool ha_partition::read_par_file(const char *name) { - char buff[FN_REFLEN], *address_tot_name_len; + char buff[FN_REFLEN], *tot_name_len_offset; File file; - char *file_buffer, *name_buffer_ptr; - handlerton **engine_array; + char *file_buffer; uint i, len_bytes, len_words, tot_partition_words, tot_name_words, chksum; - DBUG_ENTER("ha_partition::get_from_handler_file"); + DBUG_ENTER("ha_partition::read_par_file"); DBUG_PRINT("enter", ("table name: '%s'", name)); if (m_file_buffer) - DBUG_RETURN(FALSE); + DBUG_RETURN(false); fn_format(buff, name, "", ha_par_ext, MY_APPEND_EXT); /* Following could be done with my_stat to read in whole file */ if ((file= my_open(buff, O_RDONLY | O_SHARE, MYF(0))) < 0) - DBUG_RETURN(TRUE); - if (my_read(file, (uchar *) & buff[0], 8, MYF(MY_NABP))) + DBUG_RETURN(true); + if (my_read(file, (uchar *) & buff[0], PAR_WORD_SIZE, MYF(MY_NABP))) goto err1; len_words= uint4korr(buff); - len_bytes= 4 * len_words; + len_bytes= PAR_WORD_SIZE * len_words; + if (my_seek(file, 0, MY_SEEK_SET, MYF(0)) == MY_FILEPOS_ERROR) + goto err1; if (!(file_buffer= (char*) my_malloc(len_bytes, MYF(0)))) goto err1; - VOID(my_seek(file, 0, MY_SEEK_SET, MYF(0))); if (my_read(file, (uchar *) file_buffer, len_bytes, MYF(MY_NABP))) goto err2; chksum= 0; for (i= 0; i < len_words; i++) - chksum ^= uint4korr((file_buffer) + 4 * i); + chksum ^= uint4korr((file_buffer) + PAR_WORD_SIZE * i); if (chksum) goto err2; - m_tot_parts= uint4korr((file_buffer) + 8); + m_tot_parts= uint4korr((file_buffer) + PAR_NUM_PARTS_OFFSET); DBUG_PRINT("info", ("No of parts = %u", m_tot_parts)); - tot_partition_words= (m_tot_parts + 3) / 4; - if (!clone) - { - engine_array= (handlerton **) my_alloca(m_tot_parts * sizeof(handlerton*)); - for (i= 0; i < m_tot_parts; i++) - { - engine_array[i]= ha_resolve_by_legacy_type(ha_thd(), - (enum legacy_db_type) - *(uchar *) ((file_buffer) + - 12 + i)); - if (!engine_array[i]) - goto err3; - } - } - address_tot_name_len= file_buffer + 12 + 4 * tot_partition_words; - tot_name_words= (uint4korr(address_tot_name_len) + 3) / 4; + tot_partition_words= (m_tot_parts + PAR_WORD_SIZE - 1) / PAR_WORD_SIZE; + + tot_name_len_offset= file_buffer + PAR_ENGINES_OFFSET + + PAR_WORD_SIZE * tot_partition_words; + tot_name_words= (uint4korr(tot_name_len_offset) + PAR_WORD_SIZE - 1) / + PAR_WORD_SIZE; + /* + Verify the total length = tot size word, checksum word, num parts word + + engines array + name length word + name array. + */ if (len_words != (tot_partition_words + tot_name_words + 4)) - goto err3; - name_buffer_ptr= file_buffer + 16 + 4 * tot_partition_words; + goto err2; VOID(my_close(file, MYF(0))); m_file_buffer= file_buffer; // Will be freed in clear_handler_file() - m_name_buffer_ptr= name_buffer_ptr; - - if (!clone) - { - if (!(m_engine_array= (plugin_ref*) - my_malloc(m_tot_parts * sizeof(plugin_ref), MYF(MY_WME)))) - goto err3; + m_name_buffer_ptr= tot_name_len_offset + PAR_WORD_SIZE; - for (i= 0; i < m_tot_parts; i++) - m_engine_array[i]= ha_lock_engine(NULL, engine_array[i]); + DBUG_RETURN(false); - my_afree((gptr) engine_array); - } - - if (!clone && !m_file && create_handlers(mem_root)) - { - clear_handler_file(); - DBUG_RETURN(TRUE); - } - DBUG_RETURN(FALSE); - -err3: - if (!clone) - my_afree((gptr) engine_array); err2: my_free(file_buffer, MYF(0)); err1: VOID(my_close(file, MYF(0))); - DBUG_RETURN(TRUE); + DBUG_RETURN(true); +} + + +/** + Setup m_engine_array + + @param mem_root MEM_ROOT to use for allocating new handlers + + @return Operation status + @retval false Success + @retval true Failure +*/ + +bool ha_partition::setup_engine_array(MEM_ROOT *mem_root) +{ + uint i; + uchar *buff; + handlerton **engine_array; + + DBUG_ASSERT(!m_file); + DBUG_ENTER("ha_partition::setup_engine_array"); + engine_array= (handlerton **) my_alloca(m_tot_parts * sizeof(handlerton*)); + if (!engine_array) + DBUG_RETURN(true); + + buff= (uchar *) (m_file_buffer + PAR_ENGINES_OFFSET); + for (i= 0; i < m_tot_parts; i++) + { + engine_array[i]= ha_resolve_by_legacy_type(ha_thd(), + (enum legacy_db_type) + *(buff + i)); + if (!engine_array[i]) + goto err; + } + if (!(m_engine_array= (plugin_ref*) + my_malloc(m_tot_parts * sizeof(plugin_ref), MYF(MY_WME)))) + goto err; + + for (i= 0; i < m_tot_parts; i++) + m_engine_array[i]= ha_lock_engine(NULL, engine_array[i]); + + my_afree((gptr) engine_array); + + if (create_handlers(mem_root)) + { + clear_handler_file(); + DBUG_RETURN(true); + } + + DBUG_RETURN(false); + +err: + my_afree((gptr) engine_array); + DBUG_RETURN(true); +} + + +/** + Get info about partition engines and their names from the .par file + + @param name Full path of table name + @param mem_root Allocate memory through this + @param is_clone If it is a clone, don't create new handlers + + @return Operation status + @retval true Error + @retval false Success + + @note Open handler file to get partition names, engine types and number of + partitions. +*/ + +bool ha_partition::get_from_handler_file(const char *name, MEM_ROOT *mem_root, + bool is_clone) +{ + DBUG_ENTER("ha_partition::get_from_handler_file"); + DBUG_PRINT("enter", ("table name: '%s'", name)); + + if (m_file_buffer) + DBUG_RETURN(false); + + if (read_par_file(name)) + DBUG_RETURN(true); + + if (!is_clone && setup_engine_array(mem_root)) + DBUG_RETURN(true); + + DBUG_RETURN(false); } @@ -2615,8 +2667,7 @@ int ha_partition::open(const char *name, int mode, uint test_if_locked) { create_partition_name(name_buff, name, name_buffer_ptr, NORMAL_PART_NAME, FALSE); - if (!(m_file[i]= file[i]->clone((const char*) name_buff, - m_clone_mem_root))) + if (!(m_file[i]= file[i]->clone(name_buff, m_clone_mem_root))) { error= HA_ERR_INITIALIZATION; file= &m_file[i]; @@ -2632,8 +2683,7 @@ int ha_partition::open(const char *name, int mode, uint test_if_locked) { create_partition_name(name_buff, name, name_buffer_ptr, NORMAL_PART_NAME, FALSE); - if ((error= (*file)->ha_open(table, (const char*) name_buff, mode, - test_if_locked))) + if ((error= (*file)->ha_open(table, name_buff, mode, test_if_locked))) goto err_handler; m_no_locks+= (*file)->lock_count(); name_buffer_ptr+= strlen(name_buffer_ptr) + 1; @@ -2645,8 +2695,7 @@ int ha_partition::open(const char *name, int mode, uint test_if_locked) check_table_flags= (((*file)->ha_table_flags() & ~(PARTITION_DISABLED_TABLE_FLAGS)) | (PARTITION_ENABLED_TABLE_FLAGS)); - file++; - do + while (*(++file)) { DBUG_ASSERT(ref_length >= (*file)->ref_length); set_if_bigger(ref_length, ((*file)->ref_length)); @@ -2663,7 +2712,7 @@ int ha_partition::open(const char *name, int mode, uint test_if_locked) file = &m_file[m_tot_parts - 1]; goto err_handler; } - } while (*(++file)); + } key_used_on_scan= m_file[0]->key_used_on_scan; implicit_emptied= m_file[0]->implicit_emptied; /* @@ -2742,7 +2791,7 @@ err_alloc: /** Clone the open and locked partitioning handler. - @param mem_root MEM_ROOT to use. + @param mem_root MEM_ROOT to use. @return Pointer to the successfully created clone or NULL @@ -2750,33 +2799,32 @@ err_alloc: This function creates a new ha_partition handler as a clone/copy. The original (this) must already be opened and locked. The clone will use the originals m_part_info. - It also allocates memory to ref + ref_dup. + It also allocates memory for ref + ref_dup. In ha_partition::open() it will clone its original handlers partitions - which will allocate then om the correct MEM_ROOT and also open them. + which will allocate then on the correct MEM_ROOT and also open them. */ handler *ha_partition::clone(const char *name, MEM_ROOT *mem_root) { ha_partition *new_handler; - + DBUG_ENTER("ha_partition::clone"); new_handler= new (mem_root) ha_partition(ht, table_share, m_part_info, this, mem_root); - if (!new_handler) - DBUG_RETURN(NULL); - /* Allocate new_handler->ref here because otherwise ha_open will allocate it on this->table->mem_root and we will not be able to reclaim that memory when the clone handler object is destroyed. */ - new_handler->ref= (uchar*) alloc_root(mem_root, ALIGN_SIZE(m_ref_length)*2); - if (!new_handler->ref) - DBUG_RETURN(NULL); + if (new_handler && + !(new_handler->ref= (uchar*) alloc_root(mem_root, + ALIGN_SIZE(m_ref_length)*2))) + new_handler= NULL; - if (new_handler->ha_open(table, name, + if (new_handler && + new_handler->ha_open(table, name, table->db_stat, HA_OPEN_IGNORE_IF_LOCKED)) - DBUG_RETURN(NULL); + new_handler= NULL; DBUG_RETURN((handler*) new_handler); } diff --git a/sql/ha_partition.h b/sql/ha_partition.h index a38d56af8ff..cd90c4cc1d5 100644 --- a/sql/ha_partition.h +++ b/sql/ha_partition.h @@ -55,6 +55,16 @@ typedef struct st_ha_data_partition HA_DUPLICATE_POS | \ HA_CAN_SQL_HANDLER | \ HA_CAN_INSERT_DELAYED) + +/* First 4 bytes in the .par file is the number of 32-bit words in the file */ +#define PAR_WORD_SIZE 4 +/* offset to the .par file checksum */ +#define PAR_CHECKSUM_OFFSET 4 +/* offset to the total number of partitions */ +#define PAR_NUM_PARTS_OFFSET 8 +/* offset to the engines array */ +#define PAR_ENGINES_OFFSET 12 + class ha_partition :public handler { private: @@ -71,7 +81,7 @@ private: /* Data for the partition handler */ int m_mode; // Open mode uint m_open_test_lock; // Open test_if_locked - char *m_file_buffer; // Buffer with names + char *m_file_buffer; // Content of the .par file char *m_name_buffer_ptr; // Pointer to first partition name plugin_ref *m_engine_array; // Array of types of the handlers handler **m_file; // Array of references to handler inst. @@ -281,7 +291,10 @@ private: And one method to read it in. */ bool create_handler_file(const char *name); - bool get_from_handler_file(const char *name, MEM_ROOT *mem_root, bool clone); + bool setup_engine_array(MEM_ROOT *mem_root); + bool read_par_file(const char *name); + bool get_from_handler_file(const char *name, MEM_ROOT *mem_root, + bool is_clone); bool new_handlers_from_part_info(MEM_ROOT *mem_root); bool create_handlers(MEM_ROOT *mem_root); void clear_handler_file(); diff --git a/sql/handler.cc b/sql/handler.cc index 8adb8e061a3..718529fa5fc 100644 --- a/sql/handler.cc +++ b/sql/handler.cc @@ -2045,14 +2045,21 @@ handler *handler::clone(const char *name, MEM_ROOT *mem_root) on this->table->mem_root and we will not be able to reclaim that memory when the clone handler object is destroyed. */ - if (!(new_handler->ref= (uchar*) alloc_root(mem_root, ALIGN_SIZE(ref_length)*2))) - return NULL; - if (new_handler && !new_handler->ha_open(table, - name, - table->db_stat, - HA_OPEN_IGNORE_IF_LOCKED)) - return new_handler; - return NULL; + if (new_handler && + !(new_handler->ref= (uchar*) alloc_root(mem_root, + ALIGN_SIZE(ref_length)*2))) + new_handler= NULL; + /* + TODO: Implement a more efficient way to have more than one index open for + the same table instance. The ha_open call is not cachable for clone. + */ + if (new_handler && new_handler->ha_open(table, + name, + table->db_stat, + HA_OPEN_IGNORE_IF_LOCKED)) + new_handler= NULL; + + return new_handler; } From a5e8d9029b1340762bc88226c0a9344f241a044c Mon Sep 17 00:00:00 2001 From: Sergey Glukhov Date: Fri, 22 Apr 2011 11:20:55 +0400 Subject: [PATCH 198/202] Bug#11756928 48916: SERVER INCORRECTLY PROCESSING HAVING CLAUSES WITH AN ORDER BY CLAUSE Before sorting HAVING condition is split into two parts, first part is a table related condition and the rest of is HAVING part. Extraction of HAVING part does not take into account the fact that some of conditions might be non-const but have 'used_tables' == 0 (independent subqueries) and because of that these conditions are cut off by make_cond_for_table() function. The fix is to use (table_map) 0 instead of used_tables in third argument for make_cond_for_table() function. It allows to extract elements which belong to sorted table and in addition elements which are independend subqueries. mysql-test/r/having.result: test case mysql-test/t/having.test: test case sql/sql_select.cc: The fix is to use (table_map) 0 instead of used_tables in third argument for make_cond_for_table() function. It allows to extract elements which belong to sorted table and in addition elements which are independend subqueries. --- mysql-test/r/having.result | 22 ++++++++++++++++++++++ mysql-test/t/having.test | 26 ++++++++++++++++++++++++++ sql/sql_select.cc | 38 +++++++++++++++++++++++++++++++++++++- 3 files changed, 85 insertions(+), 1 deletion(-) diff --git a/mysql-test/r/having.result b/mysql-test/r/having.result index cd1b4ae0218..4253ac7e5c3 100644 --- a/mysql-test/r/having.result +++ b/mysql-test/r/having.result @@ -545,4 +545,26 @@ FROM t1 JOIN t2 ON t2.f2 LIKE 'x' HAVING field1 < 7; field1 DROP TABLE t1,t2; +# +# Bug#48916 Server incorrectly processing HAVING clauses with an ORDER BY clause +# +CREATE TABLE t1 (f1 INT, f2 INT); +INSERT INTO t1 VALUES (1, 0), (2, 1), (3, 2); +CREATE TABLE t2 (f1 INT, f2 INT); +SELECT t1.f1 +FROM t1 +HAVING (3, 2) IN (SELECT f1, f2 FROM t2) AND t1.f1 >= 0 +ORDER BY t1.f1; +f1 +SELECT t1.f1 +FROM t1 +HAVING (3, 2) IN (SELECT 4, 2) AND t1.f1 >= 0 +ORDER BY t1.f1; +f1 +SELECT t1.f1 +FROM t1 +HAVING 2 IN (SELECT f2 FROM t2) AND t1.f1 >= 0 +ORDER BY t1.f1; +f1 +DROP TABLE t1,t2; End of 5.1 tests diff --git a/mysql-test/t/having.test b/mysql-test/t/having.test index c808e747523..2ed8b40b858 100644 --- a/mysql-test/t/having.test +++ b/mysql-test/t/having.test @@ -564,4 +564,30 @@ HAVING field1 < 7; DROP TABLE t1,t2; +--echo # +--echo # Bug#48916 Server incorrectly processing HAVING clauses with an ORDER BY clause +--echo # + +CREATE TABLE t1 (f1 INT, f2 INT); +INSERT INTO t1 VALUES (1, 0), (2, 1), (3, 2); +CREATE TABLE t2 (f1 INT, f2 INT); + +SELECT t1.f1 +FROM t1 +HAVING (3, 2) IN (SELECT f1, f2 FROM t2) AND t1.f1 >= 0 +ORDER BY t1.f1; + +SELECT t1.f1 +FROM t1 +HAVING (3, 2) IN (SELECT 4, 2) AND t1.f1 >= 0 +ORDER BY t1.f1; + +SELECT t1.f1 +FROM t1 +HAVING 2 IN (SELECT f2 FROM t2) AND t1.f1 >= 0 +ORDER BY t1.f1; + +DROP TABLE t1,t2; + + --echo End of 5.1 tests diff --git a/sql/sql_select.cc b/sql/sql_select.cc index ab287e57aa1..46e9ad242b3 100644 --- a/sql/sql_select.cc +++ b/sql/sql_select.cc @@ -2215,7 +2215,7 @@ JOIN::exec() Item* sort_table_cond= make_cond_for_table(curr_join->tmp_having, used_tables, - used_tables); + (table_map) 0); if (sort_table_cond) { if (!curr_table->select) @@ -12852,6 +12852,42 @@ static bool test_if_ref(Item_field *left_item,Item *right_item) return 0; // keep test } +/** + Extract a condition that can be checked after reading given table + + @param cond Condition to analyze + @param tables Tables for which "current field values" are available + @param used_table Table that we're extracting the condition for (may + also include PSEUDO_TABLE_BITS, and may be zero) + @param exclude_expensive_cond Do not push expensive conditions + + @retval <>NULL Generated condition + @retval =NULL Already checked, OR error + + @details + Extract the condition that can be checked after reading the table + specified in 'used_table', given that current-field values for tables + specified in 'tables' bitmap are available. + If 'used_table' is 0 + - extract conditions for all tables in 'tables'. + - extract conditions are unrelated to any tables + in the same query block/level(i.e. conditions + which have used_tables == 0). + + The function assumes that + - Constant parts of the condition has already been checked. + - Condition that could be checked for tables in 'tables' has already + been checked. + + The function takes into account that some parts of the condition are + guaranteed to be true by employed 'ref' access methods (the code that + does this is located at the end, search down for "EQ_FUNC"). + + @note + Make sure to keep the implementations of make_cond_for_table() and + make_cond_after_sjm() synchronized. + make_cond_for_info_schema() uses similar algorithm as well. +*/ static COND * make_cond_for_table(COND *cond, table_map tables, table_map used_table) From c68a034e8382c03118f8c6708dd029a89aae30a7 Mon Sep 17 00:00:00 2001 From: Serge Kozlov Date: Mon, 25 Apr 2011 23:49:56 +0400 Subject: [PATCH 199/202] BUG#12371924. Fxi test case --- mysql-test/suite/binlog/r/binlog_bug23533.result | 4 ---- mysql-test/suite/binlog/t/binlog_bug23533.test | 16 ++++++++++++---- 2 files changed, 12 insertions(+), 8 deletions(-) diff --git a/mysql-test/suite/binlog/r/binlog_bug23533.result b/mysql-test/suite/binlog/r/binlog_bug23533.result index 02605839ab0..d5cd93284a2 100644 --- a/mysql-test/suite/binlog/r/binlog_bug23533.result +++ b/mysql-test/suite/binlog/r/binlog_bug23533.result @@ -3,8 +3,6 @@ CREATE TABLE t1 (a INT NOT NULL AUTO_INCREMENT, b TEXT, PRIMARY KEY(a)) ENGINE=I SELECT COUNT(*) FROM t1; COUNT(*) 1000 -SET @saved_binlog_cache_size=@@binlog_cache_size; -SET @saved_max_binlog_cache_size=@@max_binlog_cache_size; SET GLOBAL binlog_cache_size=4096; SET GLOBAL max_binlog_cache_size=4096; START TRANSACTION; @@ -14,6 +12,4 @@ COMMIT; SHOW TABLES LIKE 't%'; Tables_in_test (t%) t1 -SET GLOBAL max_binlog_cache_size=@saved_max_binlog_cache_size; -SET GLOBAL binlog_cache_size=@saved_binlog_cache_size; DROP TABLE t1; diff --git a/mysql-test/suite/binlog/t/binlog_bug23533.test b/mysql-test/suite/binlog/t/binlog_bug23533.test index 05fe9fd9523..c05abe788c6 100644 --- a/mysql-test/suite/binlog/t/binlog_bug23533.test +++ b/mysql-test/suite/binlog/t/binlog_bug23533.test @@ -24,11 +24,15 @@ while ($i) SELECT COUNT(*) FROM t1; # Set small value for max_binlog_cache_size -SET @saved_binlog_cache_size=@@binlog_cache_size; -SET @saved_max_binlog_cache_size=@@max_binlog_cache_size; +let $saved_binlog_cache_size= query_get_value(SELECT @@binlog_cache_size AS Value, Value, 1); +let $saved_max_binlog_cache_size= query_get_value(SELECT @@max_binlog_cache_size AS Value, Value, 1); SET GLOBAL binlog_cache_size=4096; SET GLOBAL max_binlog_cache_size=4096; +# New value of max_binlog_cache_size will apply to new session +disconnect default; +connect(default,localhost,root,,test); + # Copied data from t1 into t2 large than max_binlog_cache_size START TRANSACTION; --error 1197 @@ -37,6 +41,10 @@ COMMIT; SHOW TABLES LIKE 't%'; # 5.1 End of Test -SET GLOBAL max_binlog_cache_size=@saved_max_binlog_cache_size; -SET GLOBAL binlog_cache_size=@saved_binlog_cache_size; +--disable_query_log +eval SET GLOBAL max_binlog_cache_size=$saved_max_binlog_cache_size; +eval SET GLOBAL binlog_cache_size=$saved_binlog_cache_size; +--enable_query_log DROP TABLE t1; +disconnect default; +connect(default,localhost,root,,test); From bdaaee5d0495ad66e95bcb42e06866855cf417b8 Mon Sep 17 00:00:00 2001 From: Mattias Jonsson Date: Tue, 26 Apr 2011 10:21:09 +0200 Subject: [PATCH 200/202] post fix for werror build for bug#11766249. --- sql/ha_partition.cc | 10 +++++----- 1 file changed, 5 insertions(+), 5 deletions(-) diff --git a/sql/ha_partition.cc b/sql/ha_partition.cc index a0f346f7a64..460d5826a91 100644 --- a/sql/ha_partition.cc +++ b/sql/ha_partition.cc @@ -2587,7 +2587,7 @@ void ha_data_partition_destroy(void *ha_data) int ha_partition::open(const char *name, int mode, uint test_if_locked) { char *name_buffer_ptr; - int error; + int error= HA_ERR_INITIALIZATION; uint alloc_len; handler **file; char name_buff[FN_REFLEN]; @@ -2601,7 +2601,7 @@ int ha_partition::open(const char *name, int mode, uint test_if_locked) m_open_test_lock= test_if_locked; m_part_field_array= m_part_info->full_part_field_array; if (get_from_handler_file(name, &table->mem_root, test(m_is_clone_of))) - DBUG_RETURN(1); + DBUG_RETURN(error); name_buffer_ptr= m_name_buffer_ptr; m_start_key.length= 0; m_rec0= table->record[0]; @@ -2612,7 +2612,7 @@ int ha_partition::open(const char *name, int mode, uint test_if_locked) { if (!(m_ordered_rec_buffer= (uchar*)my_malloc(alloc_len, MYF(MY_WME)))) { - DBUG_RETURN(1); + DBUG_RETURN(error); } { /* @@ -2635,7 +2635,7 @@ int ha_partition::open(const char *name, int mode, uint test_if_locked) /* Initialize the bitmap we use to minimize ha_start_bulk_insert calls */ if (bitmap_init(&m_bulk_insert_started, NULL, m_tot_parts + 1, FALSE)) - DBUG_RETURN(1); + DBUG_RETURN(error); bitmap_clear_all(&m_bulk_insert_started); /* Initialize the bitmap we use to determine what partitions are used */ if (!m_is_clone_of) @@ -2644,7 +2644,7 @@ int ha_partition::open(const char *name, int mode, uint test_if_locked) if (bitmap_init(&(m_part_info->used_partitions), NULL, m_tot_parts, TRUE)) { bitmap_free(&m_bulk_insert_started); - DBUG_RETURN(1); + DBUG_RETURN(error); } bitmap_set_all(&(m_part_info->used_partitions)); } From a60c39a2ffc7ec0c0b4ae8bbadf733773ec7557f Mon Sep 17 00:00:00 2001 From: Sergey Glukhov Date: Wed, 27 Apr 2011 11:35:57 +0400 Subject: [PATCH 201/202] Bug#11889186 60503: CRASH IN MAKE_DATE_TIME WITH DATE_FORMAT / STR_TO_DATE COMBINATION calc_daynr() function returns negative result if malformed date with zero year and month is used. Attempt to calculate week day on negative value leads to crash. The fix is return NULL for 'W', 'a', 'w' specifiers if zero year and month is used. Additional fix for calc_daynr(): --added assertion that result can not be negative --return 0 if zero year and month is used mysql-test/r/func_time.result: test case mysql-test/t/func_time.test: test case sql-common/my_time.c: --added assertion that result can not be negative --return 0 if zero year and month is used sql/item_timefunc.cc: eturn NULL for 'W', 'a', 'w' specifiers if zero year and month is used. --- mysql-test/r/func_time.result | 12 ++++++++++++ mysql-test/t/func_time.test | 8 ++++++++ sql-common/my_time.c | 3 ++- sql/item_timefunc.cc | 6 +++--- 4 files changed, 25 insertions(+), 4 deletions(-) diff --git a/mysql-test/r/func_time.result b/mysql-test/r/func_time.result index f67171af99f..1e05443d8ac 100644 --- a/mysql-test/r/func_time.result +++ b/mysql-test/r/func_time.result @@ -1405,4 +1405,16 @@ NULL SELECT ADDDATE(MONTH(FROM_UNIXTIME(NULL)),INTERVAL 1 HOUR); ADDDATE(MONTH(FROM_UNIXTIME(NULL)),INTERVAL 1 HOUR) NULL +# +# Bug#11889186 60503: CRASH IN MAKE_DATE_TIME WITH DATE_FORMAT / STR_TO_DATE COMBINATION +# +SELECT DATE_FORMAT('0000-00-11', '%W'); +DATE_FORMAT('0000-00-11', '%W') +NULL +SELECT DATE_FORMAT('0000-00-11', '%a'); +DATE_FORMAT('0000-00-11', '%a') +NULL +SELECT DATE_FORMAT('0000-00-11', '%w'); +DATE_FORMAT('0000-00-11', '%w') +NULL End of 5.1 tests diff --git a/mysql-test/t/func_time.test b/mysql-test/t/func_time.test index 938359f8c11..2000d81f80d 100644 --- a/mysql-test/t/func_time.test +++ b/mysql-test/t/func_time.test @@ -913,4 +913,12 @@ SELECT CAST((MONTH(FROM_UNIXTIME(@@GLOBAL.SQL_MODE))) AS BINARY(1025)); SELECT ADDDATE(MONTH(FROM_UNIXTIME(NULL)),INTERVAL 1 HOUR); +--echo # +--echo # Bug#11889186 60503: CRASH IN MAKE_DATE_TIME WITH DATE_FORMAT / STR_TO_DATE COMBINATION +--echo # + +SELECT DATE_FORMAT('0000-00-11', '%W'); +SELECT DATE_FORMAT('0000-00-11', '%a'); +SELECT DATE_FORMAT('0000-00-11', '%w'); + --echo End of 5.1 tests diff --git a/sql-common/my_time.c b/sql-common/my_time.c index ca11c54a999..80a7e0daa2c 100644 --- a/sql-common/my_time.c +++ b/sql-common/my_time.c @@ -772,7 +772,7 @@ long calc_daynr(uint year,uint month,uint day) int y= year; /* may be < 0 temporarily */ DBUG_ENTER("calc_daynr"); - if (y == 0 && month == 0 && day == 0) + if (y == 0 && month == 0) DBUG_RETURN(0); /* Skip errors */ /* Cast to int to be able to handle month == 0 */ delsum= (long) (365 * y + 31 *((int) month - 1) + (int) day); @@ -783,6 +783,7 @@ long calc_daynr(uint year,uint month,uint day) temp=(int) ((y/100+1)*3)/4; DBUG_PRINT("exit",("year: %d month: %d day: %d -> daynr: %ld", y+(month <= 2),month,day,delsum+y/4-temp)); + DBUG_ASSERT(delsum+(int) y/4-temp > 0); DBUG_RETURN(delsum+(int) y/4-temp); } /* calc_daynr */ diff --git a/sql/item_timefunc.cc b/sql/item_timefunc.cc index ecf790cc061..1044b4682ef 100644 --- a/sql/item_timefunc.cc +++ b/sql/item_timefunc.cc @@ -648,7 +648,7 @@ bool make_date_time(DATE_TIME_FORMAT *format, MYSQL_TIME *l_time, system_charset_info); break; case 'W': - if (type == MYSQL_TIMESTAMP_TIME) + if (type == MYSQL_TIMESTAMP_TIME || !(l_time->month || l_time->year)) return 1; weekday= calc_weekday(calc_daynr(l_time->year,l_time->month, l_time->day),0); @@ -657,7 +657,7 @@ bool make_date_time(DATE_TIME_FORMAT *format, MYSQL_TIME *l_time, system_charset_info); break; case 'a': - if (type == MYSQL_TIMESTAMP_TIME) + if (type == MYSQL_TIMESTAMP_TIME || !(l_time->month || l_time->year)) return 1; weekday=calc_weekday(calc_daynr(l_time->year,l_time->month, l_time->day),0); @@ -816,7 +816,7 @@ bool make_date_time(DATE_TIME_FORMAT *format, MYSQL_TIME *l_time, } break; case 'w': - if (type == MYSQL_TIMESTAMP_TIME) + if (type == MYSQL_TIMESTAMP_TIME || !(l_time->month || l_time->year)) return 1; weekday=calc_weekday(calc_daynr(l_time->year,l_time->month, l_time->day),1); From a1f7ceb281f9d87c9baea125ebab26f99a0370f8 Mon Sep 17 00:00:00 2001 From: Nirbhay Choubey Date: Wed, 27 Apr 2011 17:24:10 +0530 Subject: [PATCH 202/202] BUG#12329909 - BUILDING MYSQL WITH DEBUG SUPPORT FAILS WITH LIBEDIT Fixed by checking the return value of the write() function calls and handling the open files and fd appropriately. cmd-line-utils/libedit/vi.c: BUG#12329909 - BUILDING MYSQL WITH DEBUG SUPPORT FAILS WITH LIBEDIT Added a check on the return value of the write() function calls. --- cmd-line-utils/libedit/vi.c | 12 ++++++++++-- 1 file changed, 10 insertions(+), 2 deletions(-) diff --git a/cmd-line-utils/libedit/vi.c b/cmd-line-utils/libedit/vi.c index d628f076a1d..beffc7b40b5 100644 --- a/cmd-line-utils/libedit/vi.c +++ b/cmd-line-utils/libedit/vi.c @@ -1012,8 +1012,10 @@ vi_histedit(EditLine *el, int c __attribute__((__unused__))) if (fd < 0) return CC_ERROR; cp = el->el_line.buffer; - write(fd, cp, el->el_line.lastchar - cp +0u); - write(fd, "\n", 1); + if (write(fd, cp, el->el_line.lastchar - cp +0u) == -1) + goto error; + if (write(fd, "\n", 1) == -1) + goto error; pid = fork(); switch (pid) { case -1: @@ -1041,6 +1043,12 @@ vi_histedit(EditLine *el, int c __attribute__((__unused__))) unlink(tempfile); /* return CC_REFRESH; */ return ed_newline(el, 0); + +/* XXXMYSQL: Avoid compiler warnings. */ +error: + close(fd); + unlink(tempfile); + return CC_ERROR; } /* vi_history_word():