From 0e28a072e362d2185d8a55ba4feda7df0d06ae8b Mon Sep 17 00:00:00 2001 From: Georgi Kodinov Date: Tue, 8 Feb 2011 17:36:25 +0200 Subject: [PATCH 01/91] Bug #59815: Missing License information with enterprise GPL packages on behalf of Kent: Include the README into the binary packages --- scripts/make_win_bin_dist | 1 + 1 file changed, 1 insertion(+) diff --git a/scripts/make_win_bin_dist b/scripts/make_win_bin_dist index c1d01a0342d..7859f42ca29 100755 --- a/scripts/make_win_bin_dist +++ b/scripts/make_win_bin_dist @@ -198,6 +198,7 @@ cp Docs/INSTALL-BINARY $DESTDIR/Docs/ cp Docs/manual.chm $DESTDIR/Docs/ || /bin/true cp ChangeLog $DESTDIR/Docs/ || /bin/true cp support-files/my-*.ini $DESTDIR/ +cp README $DESTDIR/ if [ -f COPYING ] ; then cp COPYING $DESTDIR/ From c278961c335c08804a76f7d95f05b7c46120a97f Mon Sep 17 00:00:00 2001 From: Jonathan Perkin Date: Fri, 11 Feb 2011 11:32:03 +0100 Subject: [PATCH 02/91] Raise version number after cloning 5.1.56 --- configure.in | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) diff --git a/configure.in b/configure.in index 6d5bc07ba9a..dc944386f22 100644 --- a/configure.in +++ b/configure.in @@ -12,7 +12,7 @@ dnl dnl When changing the major version number please also check the switch dnl statement in mysqlbinlog::check_master_version(). You may also need dnl to update version.c in ndb. -AC_INIT([MySQL Server], [5.1.56], [], [mysql]) +AC_INIT([MySQL Server], [5.1.57], [], [mysql]) AC_CONFIG_SRCDIR([sql/mysqld.cc]) AC_CANONICAL_SYSTEM From 27166fc64f54ef82f1800988ffff431868377645 Mon Sep 17 00:00:00 2001 From: Magne Mahre Date: Thu, 24 Feb 2011 12:23:38 +0100 Subject: [PATCH 03/91] Bug#11767480 - SPATIAL INDEXES ON NON-SPATIAL COLUMNS CAUSE CRASHES. This is a backport of the patch for MySQL Bug#50574. Adding a SPATIAL INDEX on non-geometrical columns caused a segmentation fault when the table was subsequently inserted into. A test was added in mysql_prepare_create_table to explicitly check whether non-geometrical columns are used in a spatial index, and throw an error if so. For MySQL 5.5 and later, a new and more meaningful error message was introduced. For 5.1, we (re-)use an existing error code. --- mysql-test/r/gis.result | 33 +++++++++++++++++++++++++++++ mysql-test/t/gis.test | 47 +++++++++++++++++++++++++++++++++++++++++ sql/sql_table.cc | 22 +++++++++++++------ 3 files changed, 96 insertions(+), 6 deletions(-) diff --git a/mysql-test/r/gis.result b/mysql-test/r/gis.result index a9beb9631ae..151d0cfffa1 100644 --- a/mysql-test/r/gis.result +++ b/mysql-test/r/gis.result @@ -1034,4 +1034,37 @@ p NULL NULL drop table t1; +CREATE TABLE t0 (a BINARY(32) NOT NULL); +CREATE SPATIAL INDEX i on t0 (a); +ERROR HY000: Incorrect arguments to SPATIAL INDEX +INSERT INTO t0 VALUES (1); +CREATE TABLE t1( +col0 BINARY NOT NULL, +col2 TIMESTAMP, +SPATIAL INDEX i1 (col0) +) ENGINE=MyISAM; +ERROR HY000: Incorrect arguments to SPATIAL INDEX +CREATE TABLE t1 ( +col0 BINARY NOT NULL, +col2 TIMESTAMP +) ENGINE=MyISAM; +CREATE SPATIAL INDEX idx0 ON t1(col0); +ERROR HY000: Incorrect arguments to SPATIAL INDEX +ALTER TABLE t1 ADD SPATIAL INDEX i1 (col0); +ERROR HY000: Incorrect arguments to SPATIAL INDEX +CREATE TABLE t2 ( +col0 INTEGER NOT NULL, +col1 POINT, +col2 POINT +); +CREATE SPATIAL INDEX idx0 ON t2 (col1, col2); +ERROR HY000: Incorrect arguments to SPATIAL INDEX +CREATE TABLE t3 ( +col0 INTEGER NOT NULL, +col1 POINT, +col2 LINESTRING, +SPATIAL INDEX i1 (col1, col2) +); +ERROR HY000: Incorrect arguments to SPATIAL INDEX +DROP TABLE t0, t1, t2; End of 5.1 tests diff --git a/mysql-test/t/gis.test b/mysql-test/t/gis.test index bdbbfc7c064..b50df062d7e 100644 --- a/mysql-test/t/gis.test +++ b/mysql-test/t/gis.test @@ -754,4 +754,51 @@ insert into t1 values (geomfromtext("point(1 0)")); select * from (select polygon(t1.a) as p from t1 order by t1.a) d; drop table t1; +# +# Bug#11767480 - SPATIAL INDEXES ON NON-SPATIAL COLUMNS CAUSE CRASHES. +# +CREATE TABLE t0 (a BINARY(32) NOT NULL); +--error ER_WRONG_ARGUMENTS +CREATE SPATIAL INDEX i on t0 (a); +INSERT INTO t0 VALUES (1); + +--error ER_WRONG_ARGUMENTS +CREATE TABLE t1( + col0 BINARY NOT NULL, + col2 TIMESTAMP, + SPATIAL INDEX i1 (col0) +) ENGINE=MyISAM; + +# Test other ways to add indices +CREATE TABLE t1 ( + col0 BINARY NOT NULL, + col2 TIMESTAMP +) ENGINE=MyISAM; + +--error ER_WRONG_ARGUMENTS +CREATE SPATIAL INDEX idx0 ON t1(col0); + +--error ER_WRONG_ARGUMENTS +ALTER TABLE t1 ADD SPATIAL INDEX i1 (col0); + +CREATE TABLE t2 ( + col0 INTEGER NOT NULL, + col1 POINT, + col2 POINT +); + +--error ER_WRONG_ARGUMENTS +CREATE SPATIAL INDEX idx0 ON t2 (col1, col2); + +--error ER_WRONG_ARGUMENTS +CREATE TABLE t3 ( + col0 INTEGER NOT NULL, + col1 POINT, + col2 LINESTRING, + SPATIAL INDEX i1 (col1, col2) +); + +# cleanup +DROP TABLE t0, t1, t2; + --echo End of 5.1 tests diff --git a/sql/sql_table.cc b/sql/sql_table.cc index b919ea9eae7..c5fc037a49e 100644 --- a/sql/sql_table.cc +++ b/sql/sql_table.cc @@ -1,4 +1,4 @@ -/* Copyright 2000-2008 MySQL AB, 2008 Sun Microsystems, Inc. +/* Copyright 2000-2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by @@ -11,7 +11,8 @@ You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software - Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA */ + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, + MA 02110-1301 USA */ /* drop and alter of tables */ @@ -3184,11 +3185,20 @@ mysql_prepare_create_table(THD *thd, HA_CREATE_INFO *create_info, { column->length*= sql_field->charset->mbmaxlen; - if (key->type == Key::SPATIAL && column->length) + if (key->type == Key::SPATIAL) { - my_error(ER_WRONG_SUB_KEY, MYF(0)); - DBUG_RETURN(TRUE); - } + if (column->length) + { + my_error(ER_WRONG_SUB_KEY, MYF(0)); + DBUG_RETURN(TRUE); + } + + if (!f_is_geom(sql_field->pack_flag)) + { + my_error(ER_WRONG_ARGUMENTS, MYF(0), "SPATIAL INDEX"); + DBUG_RETURN(TRUE); + } + } if (f_is_blob(sql_field->pack_flag) || (f_is_geom(sql_field->pack_flag) && key->type != Key::SPATIAL)) From 5a805fe7c4b0ec4907376c4439c677d88b2bb0dd Mon Sep 17 00:00:00 2001 From: Vasil Dimov Date: Fri, 25 Feb 2011 11:50:18 +0200 Subject: [PATCH 04/91] Fix BUG#11798085 - INCORRECT INTEGER TYPES USED IN CALCULATION RESULT IN OVERFLOW Do not assign the result of the difference to a signed variable and checking whether it is negative afterwards because this limits the max diff to 2G on 32 bit systems. E.g. "signed = 3.5G - 1G" would be negative and the code would assume that 3.5G < 1G. Instead compare the two variables directly and assign to unsigned only if we know that the result of the subtraction will be positive. Discussed with: Jimmy and Sunny (via IRC) --- storage/innodb_plugin/buf/buf0buf.c | 9 ++++++--- 1 file changed, 6 insertions(+), 3 deletions(-) diff --git a/storage/innodb_plugin/buf/buf0buf.c b/storage/innodb_plugin/buf/buf0buf.c index 6bbd5565c58..51a3a393d36 100644 --- a/storage/innodb_plugin/buf/buf0buf.c +++ b/storage/innodb_plugin/buf/buf0buf.c @@ -1893,16 +1893,19 @@ buf_block_align( /* TODO: protect buf_pool->chunks with a mutex (it will currently remain constant after buf_pool_init()) */ for (chunk = buf_pool->chunks, i = buf_pool->n_chunks; i--; chunk++) { - lint offs = ptr - chunk->blocks->frame; + ulint offs; - if (UNIV_UNLIKELY(offs < 0)) { + if (UNIV_UNLIKELY(ptr < chunk->blocks->frame)) { continue; } + /* else */ + + offs = ptr - chunk->blocks->frame; offs >>= UNIV_PAGE_SIZE_SHIFT; - if (UNIV_LIKELY((ulint) offs < chunk->size)) { + if (UNIV_LIKELY(offs < chunk->size)) { buf_block_t* block = &chunk->blocks[offs]; /* The function buf_chunk_init() invokes From 0f8ae318c7203158e1ea70cbf3a6bba41fd2dde6 Mon Sep 17 00:00:00 2001 From: =?UTF-8?q?Marko=20M=C3=A4kel=C3=A4?= Date: Mon, 28 Feb 2011 13:51:18 +0200 Subject: [PATCH 05/91] Bug #58549 Race condition in buf_LRU_drop_page_hash_for_tablespace() and compressed tables buf_LRU_drop_page_hash_for_tablespace(): after releasing and reacquiring the buffer pool mutex, do not dereference any block descriptor pointer that is not known to be a pointer to an uncompressed page frame (type buf_block_t; state == BUF_BLOCK_FILE_PAGE). Also, defer the acquisition of the block_mutex until it is needed. buf_page_get_gen(): Add mode == BUF_GET_IF_IN_POOL_PEEK for buffer-fixing a block without making it young in the LRU list. buf_page_get_gen(), buf_page_init(), buf_LRU_block_remove_hashed_page(): Set bpage->state = BUF_BLOCK_ZIP_FREE before buf_buddy_free(bpage), so that similar race conditions might be detected a little easier. btr_search_drop_page_hash_when_freed(): Use BUF_GET_IF_IN_POOL_PEEK when dropping the hash indexes. rb://528 approved by Jimmy Yang --- storage/innodb_plugin/ChangeLog | 6 ++ storage/innodb_plugin/btr/btr0sea.c | 4 +- storage/innodb_plugin/buf/buf0buf.c | 32 ++++++--- storage/innodb_plugin/buf/buf0lru.c | 87 +++++++++++++------------ storage/innodb_plugin/include/buf0buf.h | 4 +- 5 files changed, 81 insertions(+), 52 deletions(-) diff --git a/storage/innodb_plugin/ChangeLog b/storage/innodb_plugin/ChangeLog index 1b2747ab012..1ece3ad1825 100644 --- a/storage/innodb_plugin/ChangeLog +++ b/storage/innodb_plugin/ChangeLog @@ -1,3 +1,9 @@ +2011-02-28 The InnoDB Team + + * btr/btr0sea.c, buf/buf0buf.c, buf/buf0lru.c: + Fix Bug#58549 Race condition in buf_LRU_drop_page_hash_for_tablespace() + and compressed tables + 2011-02-15 The InnoDB Team * sync/sync0rw.c, innodb_bug59307.test: diff --git a/storage/innodb_plugin/btr/btr0sea.c b/storage/innodb_plugin/btr/btr0sea.c index 9835efcf712..cd0eadbb1b8 100644 --- a/storage/innodb_plugin/btr/btr0sea.c +++ b/storage/innodb_plugin/btr/btr0sea.c @@ -1201,8 +1201,8 @@ btr_search_drop_page_hash_when_freed( having to fear a deadlock. */ block = buf_page_get_gen(space, zip_size, page_no, RW_S_LATCH, NULL, - BUF_GET_IF_IN_POOL, __FILE__, __LINE__, - &mtr); + BUF_PEEK_IF_IN_POOL, __FILE__, __LINE__, + &mtr); /* Because the buffer pool mutex was released by buf_page_peek_if_search_hashed(), it is possible that the block was removed from the buffer pool by another thread diff --git a/storage/innodb_plugin/buf/buf0buf.c b/storage/innodb_plugin/buf/buf0buf.c index 51a3a393d36..14ec7b75911 100644 --- a/storage/innodb_plugin/buf/buf0buf.c +++ b/storage/innodb_plugin/buf/buf0buf.c @@ -2031,7 +2031,7 @@ buf_page_get_gen( ulint rw_latch,/*!< in: RW_S_LATCH, RW_X_LATCH, RW_NO_LATCH */ buf_block_t* guess, /*!< in: guessed block or NULL */ ulint mode, /*!< in: BUF_GET, BUF_GET_IF_IN_POOL, - BUF_GET_NO_LATCH */ + BUF_PEEK_IF_IN_POOL, BUF_GET_NO_LATCH */ const char* file, /*!< in: file name */ ulint line, /*!< in: line where called */ mtr_t* mtr) /*!< in: mini-transaction */ @@ -2047,9 +2047,19 @@ buf_page_get_gen( ut_ad((rw_latch == RW_S_LATCH) || (rw_latch == RW_X_LATCH) || (rw_latch == RW_NO_LATCH)); - ut_ad((mode != BUF_GET_NO_LATCH) || (rw_latch == RW_NO_LATCH)); - ut_ad((mode == BUF_GET) || (mode == BUF_GET_IF_IN_POOL) - || (mode == BUF_GET_NO_LATCH)); +#ifdef UNIV_DEBUG + switch (mode) { + case BUF_GET_NO_LATCH: + ut_ad(rw_latch == RW_NO_LATCH); + break; + case BUF_GET: + case BUF_GET_IF_IN_POOL: + case BUF_PEEK_IF_IN_POOL: + break; + default: + ut_error; + } +#endif /* UNIV_DEBUG */ ut_ad(zip_size == fil_space_get_zip_size(space)); ut_ad(ut_is_2pow(zip_size)); #ifndef UNIV_LOG_DEBUG @@ -2091,7 +2101,8 @@ loop2: buf_pool_mutex_exit(); - if (mode == BUF_GET_IF_IN_POOL) { + if (mode == BUF_GET_IF_IN_POOL + || mode == BUF_PEEK_IF_IN_POOL) { return(NULL); } @@ -2130,7 +2141,8 @@ loop2: must_read = buf_block_get_io_fix(block) == BUF_IO_READ; - if (must_read && mode == BUF_GET_IF_IN_POOL) { + if (must_read && (mode == BUF_GET_IF_IN_POOL + || mode == BUF_PEEK_IF_IN_POOL)) { /* The page is only being read to buffer */ buf_pool_mutex_exit(); @@ -2248,6 +2260,7 @@ wait_until_unfixed: mutex_exit(&buf_pool_zip_mutex); buf_pool->n_pend_unzip++; + bpage->state = BUF_BLOCK_ZIP_FREE; buf_buddy_free(bpage, sizeof *bpage); buf_pool_mutex_exit(); @@ -2324,7 +2337,9 @@ wait_until_unfixed: buf_pool_mutex_exit(); - buf_page_set_accessed_make_young(&block->page, access_time); + if (UNIV_LIKELY(mode != BUF_PEEK_IF_IN_POOL)) { + buf_page_set_accessed_make_young(&block->page, access_time); + } #if defined UNIV_DEBUG_FILE_ACCESSES || defined UNIV_DEBUG ut_a(!block->page.file_page_was_freed); @@ -2377,7 +2392,7 @@ wait_until_unfixed: mtr_memo_push(mtr, block, fix_type); - if (!access_time) { + if (UNIV_LIKELY(mode != BUF_PEEK_IF_IN_POOL) && !access_time) { /* In the case of a first access, try to apply linear read-ahead */ @@ -2926,6 +2941,7 @@ err_exit: && UNIV_LIKELY_NULL(buf_page_hash_get(space, offset))) { /* The block was added by some other thread. */ + bpage->state = BUF_BLOCK_ZIP_FREE; buf_buddy_free(bpage, sizeof *bpage); buf_buddy_free(data, zip_size); diff --git a/storage/innodb_plugin/buf/buf0lru.c b/storage/innodb_plugin/buf/buf0lru.c index 39feb06ff23..a69b2658c51 100644 --- a/storage/innodb_plugin/buf/buf0lru.c +++ b/storage/innodb_plugin/buf/buf0lru.c @@ -246,71 +246,75 @@ buf_LRU_drop_page_hash_for_tablespace( page_arr = ut_malloc(sizeof(ulint) * BUF_LRU_DROP_SEARCH_HASH_SIZE); buf_pool_mutex_enter(); + num_entries = 0; scan_again: - num_entries = 0; bpage = UT_LIST_GET_LAST(buf_pool->LRU); while (bpage != NULL) { - mutex_t* block_mutex = buf_page_get_mutex(bpage); buf_page_t* prev_bpage; + ibool is_fixed; - mutex_enter(block_mutex); prev_bpage = UT_LIST_GET_PREV(LRU, bpage); ut_a(buf_page_in_file(bpage)); if (buf_page_get_state(bpage) != BUF_BLOCK_FILE_PAGE || bpage->space != id - || bpage->buf_fix_count > 0 || bpage->io_fix != BUF_IO_NONE) { - /* We leave the fixed pages as is in this scan. - To be dealt with later in the final scan. */ - mutex_exit(block_mutex); + /* Compressed pages are never hashed. + Skip blocks of other tablespaces. + Skip I/O-fixed blocks (to be dealt with later). */ +next_page: + bpage = prev_bpage; + continue; + } + + mutex_enter(&((buf_block_t*) bpage)->mutex); + is_fixed = bpage->buf_fix_count > 0 + || !((buf_block_t*) bpage)->is_hashed; + mutex_exit(&((buf_block_t*) bpage)->mutex); + + if (is_fixed) { goto next_page; } - if (((buf_block_t*) bpage)->is_hashed) { + /* Store the page number so that we can drop the hash + index in a batch later. */ + page_arr[num_entries] = bpage->offset; + ut_a(num_entries < BUF_LRU_DROP_SEARCH_HASH_SIZE); + ++num_entries; - /* Store the offset(i.e.: page_no) in the array - so that we can drop hash index in a batch - later. */ - page_arr[num_entries] = bpage->offset; - mutex_exit(block_mutex); - ut_a(num_entries < BUF_LRU_DROP_SEARCH_HASH_SIZE); - ++num_entries; - - if (num_entries < BUF_LRU_DROP_SEARCH_HASH_SIZE) { - goto next_page; - } - /* Array full. We release the buf_pool_mutex to - obey the latching order. */ - buf_pool_mutex_exit(); - - buf_LRU_drop_page_hash_batch(id, zip_size, page_arr, - num_entries); - num_entries = 0; - buf_pool_mutex_enter(); - } else { - mutex_exit(block_mutex); + if (num_entries < BUF_LRU_DROP_SEARCH_HASH_SIZE) { + goto next_page; } -next_page: - /* Note that we may have released the buf_pool mutex - above after reading the prev_bpage during processing - of a page_hash_batch (i.e.: when the array was full). - This means that prev_bpage can change in LRU list. - This is OK because this function is a 'best effort' - to drop as many search hash entries as possible and - it does not guarantee that ALL such entries will be - dropped. */ - bpage = prev_bpage; + /* Array full. We release the buf_pool_mutex to + obey the latching order. */ + buf_pool_mutex_exit(); + buf_LRU_drop_page_hash_batch(id, zip_size, page_arr, + num_entries); + buf_pool_mutex_enter(); + num_entries = 0; + + /* Note that we released the buf_pool mutex above + after reading the prev_bpage during processing of a + page_hash_batch (i.e.: when the array was full). + Because prev_bpage could belong to a compressed-only + block, it may have been relocated, and thus the + pointer cannot be trusted. Because bpage is of type + buf_block_t, it is safe to dereference. + + bpage can change in the LRU list. This is OK because + this function is a 'best effort' to drop as many + search hash entries as possible and it does not + guarantee that ALL such entries will be dropped. */ /* If, however, bpage has been removed from LRU list to the free list then we should restart the scan. bpage->state is protected by buf_pool mutex. */ - if (bpage && !buf_page_in_file(bpage)) { - ut_a(num_entries == 0); + if (bpage + && buf_page_get_state(bpage) != BUF_BLOCK_FILE_PAGE) { goto scan_again; } } @@ -1799,6 +1803,7 @@ buf_LRU_block_remove_hashed_page( buf_pool_mutex_exit_forbid(); buf_buddy_free(bpage->zip.data, page_zip_get_size(&bpage->zip)); + bpage->state = BUF_BLOCK_ZIP_FREE; buf_buddy_free(bpage, sizeof(*bpage)); buf_pool_mutex_exit_allow(); UNIV_MEM_UNDESC(bpage); diff --git a/storage/innodb_plugin/include/buf0buf.h b/storage/innodb_plugin/include/buf0buf.h index a16de67aa3a..05dead5ac9e 100644 --- a/storage/innodb_plugin/include/buf0buf.h +++ b/storage/innodb_plugin/include/buf0buf.h @@ -41,6 +41,8 @@ Created 11/5/1995 Heikki Tuuri /* @{ */ #define BUF_GET 10 /*!< get always */ #define BUF_GET_IF_IN_POOL 11 /*!< get if in pool */ +#define BUF_PEEK_IF_IN_POOL 12 /*!< get if in pool, do not make + the block young in the LRU list */ #define BUF_GET_NO_LATCH 14 /*!< get and bufferfix, but set no latch; we have separated this case, because @@ -284,7 +286,7 @@ buf_page_get_gen( ulint rw_latch,/*!< in: RW_S_LATCH, RW_X_LATCH, RW_NO_LATCH */ buf_block_t* guess, /*!< in: guessed block or NULL */ ulint mode, /*!< in: BUF_GET, BUF_GET_IF_IN_POOL, - BUF_GET_NO_LATCH */ + BUF_PEEK_IF_IN_POOL, BUF_GET_NO_LATCH */ const char* file, /*!< in: file name */ ulint line, /*!< in: line where called */ mtr_t* mtr); /*!< in: mini-transaction */ From 54755c78cfd78ca081f20af2edbace8cd03891b0 Mon Sep 17 00:00:00 2001 From: Sergey Vojtovich Date: Thu, 3 Mar 2011 11:43:07 +0300 Subject: [PATCH 06/91] BUG#11764339 - valgrind errors, random data when returning ordered data from archive tables Archive was using wrong memory address to check if field is NULL (after filesort, when reading record again). mysql-test/r/archive.result: A test case for BUG#11764339. mysql-test/t/archive.test: A test case for BUG#11764339. storage/archive/ha_archive.cc: Null bytes are restored to "record" buffer, which may or may not be equal to record buffer for field. Check null bits in "record" buffer, instead of Field::null_ptr. --- mysql-test/r/archive.result | 16 ++++++++++++++++ mysql-test/t/archive.test | 15 +++++++++++++++ storage/archive/ha_archive.cc | 2 +- 3 files changed, 32 insertions(+), 1 deletion(-) diff --git a/mysql-test/r/archive.result b/mysql-test/r/archive.result index f90bcb521e1..15ded03f414 100644 --- a/mysql-test/r/archive.result +++ b/mysql-test/r/archive.result @@ -12756,3 +12756,19 @@ a 1 2 DROP TABLE t1; +# +# BUG#57162 - valgrind errors, random data when returning +# ordered data from archive tables +# +SET sort_buffer_size=32804; +CREATE TABLE t1(a INT, b CHAR(255), c CHAR(255), d CHAR(255), +e CHAR(255), f INT) ENGINE=ARCHIVE DEFAULT CHARSET utf8; +INSERT INTO t1 VALUES(-1,'b','c','d','e',1); +INSERT INTO t1 SELECT * FROM t1; +INSERT INTO t1 SELECT * FROM t1; +INSERT INTO t1 SELECT t1.* FROM t1,t1 t2,t1 t3,t1 t4,t1 t5,t1 t6; +SELECT * FROM t1 ORDER BY f LIMIT 1; +a b c d e f +-1 b c d e 1 +DROP TABLE t1; +SET sort_buffer_size=DEFAULT; diff --git a/mysql-test/t/archive.test b/mysql-test/t/archive.test index 7084f5f540e..98ba5e03ede 100644 --- a/mysql-test/t/archive.test +++ b/mysql-test/t/archive.test @@ -1678,3 +1678,18 @@ SELECT * FROM t1; REPAIR TABLE t1 EXTENDED; SELECT * FROM t1; DROP TABLE t1; + +--echo # +--echo # BUG#57162 - valgrind errors, random data when returning +--echo # ordered data from archive tables +--echo # +SET sort_buffer_size=32804; +CREATE TABLE t1(a INT, b CHAR(255), c CHAR(255), d CHAR(255), + e CHAR(255), f INT) ENGINE=ARCHIVE DEFAULT CHARSET utf8; +INSERT INTO t1 VALUES(-1,'b','c','d','e',1); +INSERT INTO t1 SELECT * FROM t1; +INSERT INTO t1 SELECT * FROM t1; +INSERT INTO t1 SELECT t1.* FROM t1,t1 t2,t1 t3,t1 t4,t1 t5,t1 t6; +SELECT * FROM t1 ORDER BY f LIMIT 1; +DROP TABLE t1; +SET sort_buffer_size=DEFAULT; diff --git a/storage/archive/ha_archive.cc b/storage/archive/ha_archive.cc index 988337ec50e..9740bf934cd 100644 --- a/storage/archive/ha_archive.cc +++ b/storage/archive/ha_archive.cc @@ -1111,7 +1111,7 @@ int ha_archive::unpack_row(azio_stream *file_to_read, uchar *record) ptr+= table->s->null_bytes; for (Field **field=table->field ; *field ; field++) { - if (!((*field)->is_null())) + if (!((*field)->is_null_in_record(record))) { ptr= (*field)->unpack(record + (*field)->offset(table->record[0]), ptr); } From 16ae38bd8025144e0e9b083239ad0ea13fb822aa Mon Sep 17 00:00:00 2001 From: Georgi Kodinov Date: Wed, 9 Mar 2011 17:21:22 +0200 Subject: [PATCH 07/91] Fixed a wrong error code in gis.test --- mysql-test/r/gis.result | 2 +- mysql-test/t/gis.test | 3 +-- 2 files changed, 2 insertions(+), 3 deletions(-) diff --git a/mysql-test/r/gis.result b/mysql-test/r/gis.result index d700865d5f3..acb55d225a7 100644 --- a/mysql-test/r/gis.result +++ b/mysql-test/r/gis.result @@ -1040,7 +1040,7 @@ drop table t1; # create table t1(a char(32) not null) engine=myisam; create spatial index i on t1 (a); -ERROR HY000: Can't create table '#sql-temporary' (errno: 140) +ERROR HY000: Incorrect arguments to SPATIAL INDEX drop table t1; CREATE TABLE t0 (a BINARY(32) NOT NULL); CREATE SPATIAL INDEX i on t0 (a); diff --git a/mysql-test/t/gis.test b/mysql-test/t/gis.test index f81cd4a72a6..f8cec14d9ae 100644 --- a/mysql-test/t/gis.test +++ b/mysql-test/t/gis.test @@ -760,8 +760,7 @@ drop table t1; --echo # on char > 31 bytes". --echo # create table t1(a char(32) not null) engine=myisam; ---replace_regex /'[^']*test\.#sql-[0-9a-f_]*'/'#sql-temporary'/ ---error ER_CANT_CREATE_TABLE +--error ER_WRONG_ARGUMENTS create spatial index i on t1 (a); drop table t1; From 17e77a7e49c0359fa66d4bd0b7c43246728f2a09 Mon Sep 17 00:00:00 2001 From: Kristofer Pettersson Date: Fri, 11 Mar 2011 15:10:15 +0100 Subject: [PATCH 08/91] Certain fields in the protcol required a strict formatting. If off bound values were sent to the server this could under some circumstances lead to a crash on the Windows platform. --- sql/sql_connect.cc | 175 ++++++++++++++++++++++++++++++++++++++------- 1 file changed, 149 insertions(+), 26 deletions(-) diff --git a/sql/sql_connect.cc b/sql/sql_connect.cc index 9fa6966baa2..4c4f30600de 100644 --- a/sql/sql_connect.cc +++ b/sql/sql_connect.cc @@ -630,6 +630,94 @@ bool init_new_connection_handler_thread() return 0; } +#ifndef EMBEDDED_LIBRARY +/** + Get a null character terminated string from a user-supplied buffer. + + @param buffer[in, out] Pointer to the buffer to be scanned. + @param max_bytes_available[in, out] Limit the bytes to scan. + @param string_length[out] The number of characters scanned not including + the null character. + + @remark The string_length does not include the terminating null character. + However, after the call, the buffer is increased by string_length+1 + bytes, beyond the null character if there still available bytes to + scan. + + @return pointer to beginning of the string scanned. + @retval NULL The buffer content is malformed +*/ + +static +char *get_null_terminated_string(char **buffer, + size_t *max_bytes_available, + size_t *string_length) +{ + char *str= (char *)memchr(*buffer, '\0', *max_bytes_available); + + if (str == NULL) + return NULL; + + *string_length= (size_t)(str - *buffer); + *max_bytes_available-= *string_length + 1; + str= *buffer; + *buffer += *string_length + 1; + + return str; +} + + +/** + Get a length encoded string from a user-supplied buffer. + + @param buffer[in, out] The buffer to scan; updates position after scan. + @param max_bytes_available[in, out] Limit the number of bytes to scan + @param string_length[out] Number of characters scanned + + @remark In case the length is zero, then the total size of the string is + considered to be 1 byte; the size byte. + + @return pointer to first byte after the header in buffer. + @retval NULL The buffer content is malformed +*/ + +static +char *get_length_encoded_string(char **buffer, + size_t *max_bytes_available, + size_t *string_length) +{ + if (*max_bytes_available == 0) + return NULL; + + /* Do double cast to prevent overflow from signed / unsigned conversion */ + size_t str_len= (size_t)(unsigned char)**buffer; + + /* + If the length encoded string has the length 0 + the total size of the string is only one byte long (the size byte) + */ + if (str_len == 0) + { + ++*buffer; + *string_length= 0; + /* + Return a pointer to the 0 character so the return value will be + an empty string. + */ + return *buffer-1; + } + + if (str_len >= *max_bytes_available) + return NULL; + + char *str= *buffer+1; + *string_length= str_len; + *max_bytes_available-= *string_length + 1; + *buffer+= *string_length + 1; + return str; +} + + /* Perform handshake, authorize client and update thd ACL variables. @@ -643,7 +731,6 @@ bool init_new_connection_handler_thread() > 0 error code (not sent to user) */ -#ifndef EMBEDDED_LIBRARY static int check_connection(THD *thd) { uint connect_errors= 0; @@ -831,7 +918,7 @@ static int check_connection(THD *thd) } #endif /* HAVE_OPENSSL */ - if (end >= (char*) net->read_pos+ pkt_len +2) + if (end > (char *)net->read_pos + pkt_len) { inc_host_errors(&thd->remote.sin_addr); my_error(ER_HANDSHAKE_ERROR, MYF(0), thd->main_security_ctx.host_or_ip); @@ -843,39 +930,75 @@ static int check_connection(THD *thd) if ((thd->client_capabilities & CLIENT_TRANSACTIONS) && opt_using_transactions) net->return_status= &thd->server_status; - - char *user= end; - char *passwd= strend(user)+1; - uint user_len= passwd - user - 1; - char *db= passwd; - char db_buff[NAME_LEN + 1]; // buffer to store db in utf8 - char user_buff[USERNAME_LENGTH + 1]; // buffer to store user in utf8 - uint dummy_errors; - + /* - Old clients send null-terminated string as password; new clients send - the size (1 byte) + string (not null-terminated). Hence in case of empty - password both send '\0'. - - This strlen() can't be easily deleted without changing protocol. - - Cast *passwd to an unsigned char, so that it doesn't extend the sign for - *passwd > 127 and become 2**32-127+ after casting to uint. + In order to safely scan a head for '\0' string terminators + we must keep track of how many bytes remain in the allocated + buffer or we might read past the end of the buffer. */ - uint passwd_len= thd->client_capabilities & CLIENT_SECURE_CONNECTION ? - (uchar)(*passwd++) : strlen(passwd); - db= thd->client_capabilities & CLIENT_CONNECT_WITH_DB ? - db + passwd_len + 1 : 0; - /* strlen() can't be easily deleted without changing protocol */ - uint db_len= db ? strlen(db) : 0; + size_t bytes_remaining_in_packet= pkt_len - (end - (char *)net->read_pos); - if (passwd + passwd_len + db_len > (char *)net->read_pos + pkt_len) + size_t user_len; + char *user= get_null_terminated_string(&end, &bytes_remaining_in_packet, + &user_len); + if (user == NULL) { inc_host_errors(&thd->remote.sin_addr); my_error(ER_HANDSHAKE_ERROR, MYF(0), thd->main_security_ctx.host_or_ip); return 1; } + /* + Old clients send a null-terminated string as password; new clients send + the size (1 byte) + string (not null-terminated). Hence in case of empty + password both send '\0'. + */ + size_t passwd_len= 0; + char *passwd= NULL; + + if (thd->client_capabilities & CLIENT_SECURE_CONNECTION) + { + /* + 4.1+ password. First byte is password length. + */ + passwd= get_length_encoded_string(&end, &bytes_remaining_in_packet, + &passwd_len); + } + else + { + /* + Old passwords are zero terminated strings. + */ + passwd= get_null_terminated_string(&end, &bytes_remaining_in_packet, + &passwd_len); + } + + if (passwd == NULL) + { + inc_host_errors(&thd->remote.sin_addr); + my_error(ER_HANDSHAKE_ERROR, MYF(0), thd->main_security_ctx.host_or_ip); + return 1; + } + + size_t db_len= 0; + char *db= NULL; + + if (thd->client_capabilities & CLIENT_CONNECT_WITH_DB) + { + db= get_null_terminated_string(&end, &bytes_remaining_in_packet, + &db_len); + if (db == NULL) + { + inc_host_errors(&thd->remote.sin_addr); + my_error(ER_HANDSHAKE_ERROR, MYF(0), thd->main_security_ctx.host_or_ip); + return 1; + } + } + + char db_buff[NAME_LEN + 1]; // buffer to store db in utf8 + char user_buff[USERNAME_LENGTH + 1]; // buffer to store user in utf8 + uint dummy_errors; + /* Since 4.1 all database names are stored in utf8 */ if (db) { From 4f4b404e59ec941a3128caaa753f26a0ad8bef88 Mon Sep 17 00:00:00 2001 From: =?UTF-8?q?Marko=20M=C3=A4kel=C3=A4?= Date: Tue, 15 Mar 2011 12:01:02 +0200 Subject: [PATCH 09/91] Bug#11849231 inflateInit() invoked without initializing all memory According to the zlib documentation, next_in and avail_in must be initialized before invoking inflateInit or inflateInit2. Furthermore, the zalloc function must clear the allocated memory. btr_copy_zblob_prefix(): Replace the d_stream parameter with buf,len and return the copied length. page_zip_decompress(): Invoke inflateInit2 a little later. page_zip_zalloc(): Rename from page_zip_alloc(). Invoke mem_heap_zalloc() instead of mem_heap_alloc(). rb:619 approved by Jimmy Yang --- storage/innodb_plugin/ChangeLog | 5 ++ storage/innodb_plugin/btr/btr0cur.c | 76 ++++++++++++++------------- storage/innodb_plugin/page/page0zip.c | 17 +++--- 3 files changed, 53 insertions(+), 45 deletions(-) diff --git a/storage/innodb_plugin/ChangeLog b/storage/innodb_plugin/ChangeLog index fdd29908192..7c82cd9c27f 100644 --- a/storage/innodb_plugin/ChangeLog +++ b/storage/innodb_plugin/ChangeLog @@ -1,3 +1,8 @@ +2011-03-15 The InnoDB Team + + * btr/btr0cur.c, page/page0zip.c: + Fix Bug#11849231 inflateInit() invoked without initializing all memory + 2011-02-28 The InnoDB Team * btr/btr0sea.c, buf/buf0buf.c, buf/buf0lru.c: diff --git a/storage/innodb_plugin/btr/btr0cur.c b/storage/innodb_plugin/btr/btr0cur.c index 86d77c79e7b..d7b5ed0d135 100644 --- a/storage/innodb_plugin/btr/btr0cur.c +++ b/storage/innodb_plugin/btr/btr0cur.c @@ -4627,27 +4627,45 @@ btr_copy_blob_prefix( /*******************************************************************//** Copies the prefix of a compressed BLOB. The clustered index record -that points to this BLOB must be protected by a lock or a page latch. */ +that points to this BLOB must be protected by a lock or a page latch. +@return number of bytes written to buf */ static -void +ulint btr_copy_zblob_prefix( /*==================*/ - z_stream* d_stream,/*!< in/out: the decompressing stream */ + byte* buf, /*!< out: the externally stored part of + the field, or a prefix of it */ + ulint len, /*!< in: length of buf, in bytes */ ulint zip_size,/*!< in: compressed BLOB page size */ ulint space_id,/*!< in: space id of the BLOB pages */ ulint page_no,/*!< in: page number of the first BLOB page */ ulint offset) /*!< in: offset on the first BLOB page */ { - ulint page_type = FIL_PAGE_TYPE_ZBLOB; + ulint page_type = FIL_PAGE_TYPE_ZBLOB; + mem_heap_t* heap; + int err; + z_stream d_stream; + + d_stream.next_out = buf; + d_stream.avail_out = len; + d_stream.next_in = Z_NULL; + d_stream.avail_in = 0; + + /* Zlib inflate needs 32 kilobytes for the default + window size, plus a few kilobytes for small objects. */ + heap = mem_heap_create(40000); + page_zip_set_alloc(&d_stream, heap); ut_ad(ut_is_2pow(zip_size)); ut_ad(zip_size >= PAGE_ZIP_MIN_SIZE); ut_ad(zip_size <= UNIV_PAGE_SIZE); ut_ad(space_id); + err = inflateInit(&d_stream); + ut_a(err == Z_OK); + for (;;) { buf_page_t* bpage; - int err; ulint next_page_no; /* There is no latch on bpage directly. Instead, @@ -4663,7 +4681,7 @@ btr_copy_zblob_prefix( " compressed BLOB" " page %lu space %lu\n", (ulong) page_no, (ulong) space_id); - return; + goto func_exit; } if (UNIV_UNLIKELY @@ -4689,13 +4707,13 @@ btr_copy_zblob_prefix( offset += 4; } - d_stream->next_in = bpage->zip.data + offset; - d_stream->avail_in = zip_size - offset; + d_stream.next_in = bpage->zip.data + offset; + d_stream.avail_in = zip_size - offset; - err = inflate(d_stream, Z_NO_FLUSH); + err = inflate(&d_stream, Z_NO_FLUSH); switch (err) { case Z_OK: - if (!d_stream->avail_out) { + if (!d_stream.avail_out) { goto end_of_blob; } break; @@ -4712,13 +4730,13 @@ inflate_error: " compressed BLOB" " page %lu space %lu returned %d (%s)\n", (ulong) page_no, (ulong) space_id, - err, d_stream->msg); + err, d_stream.msg); case Z_BUF_ERROR: goto end_of_blob; } if (next_page_no == FIL_NULL) { - if (!d_stream->avail_in) { + if (!d_stream.avail_in) { ut_print_timestamp(stderr); fprintf(stderr, " InnoDB: unexpected end of" @@ -4727,7 +4745,7 @@ inflate_error: (ulong) page_no, (ulong) space_id); } else { - err = inflate(d_stream, Z_FINISH); + err = inflate(&d_stream, Z_FINISH); switch (err) { case Z_STREAM_END: case Z_BUF_ERROR: @@ -4739,7 +4757,7 @@ inflate_error: end_of_blob: buf_page_release_zip(bpage); - return; + goto func_exit; } buf_page_release_zip(bpage); @@ -4751,6 +4769,12 @@ end_of_blob: offset = FIL_PAGE_NEXT; page_type = FIL_PAGE_TYPE_ZBLOB2; } + +func_exit: + inflateEnd(&d_stream); + mem_heap_free(heap); + UNIV_MEM_ASSERT_RW(buf, d_stream.total_out); + return(d_stream.total_out); } /*******************************************************************//** @@ -4776,28 +4800,8 @@ btr_copy_externally_stored_field_prefix_low( } if (UNIV_UNLIKELY(zip_size)) { - int err; - z_stream d_stream; - mem_heap_t* heap; - - /* Zlib inflate needs 32 kilobytes for the default - window size, plus a few kilobytes for small objects. */ - heap = mem_heap_create(40000); - page_zip_set_alloc(&d_stream, heap); - - err = inflateInit(&d_stream); - ut_a(err == Z_OK); - - d_stream.next_out = buf; - d_stream.avail_out = len; - d_stream.avail_in = 0; - - btr_copy_zblob_prefix(&d_stream, zip_size, - space_id, page_no, offset); - inflateEnd(&d_stream); - mem_heap_free(heap); - UNIV_MEM_ASSERT_RW(buf, d_stream.total_out); - return(d_stream.total_out); + return(btr_copy_zblob_prefix(buf, len, zip_size, + space_id, page_no, offset)); } else { return(btr_copy_blob_prefix(buf, len, space_id, page_no, offset)); diff --git a/storage/innodb_plugin/page/page0zip.c b/storage/innodb_plugin/page/page0zip.c index a1dd4177ba8..6e866b3f016 100644 --- a/storage/innodb_plugin/page/page0zip.c +++ b/storage/innodb_plugin/page/page0zip.c @@ -653,13 +653,13 @@ page_zip_dir_encode( Allocate memory for zlib. */ static void* -page_zip_malloc( +page_zip_zalloc( /*============*/ void* opaque, /*!< in/out: memory heap */ uInt items, /*!< in: number of items to allocate */ uInt size) /*!< in: size of an item in bytes */ { - return(mem_heap_alloc(opaque, items * size)); + return(mem_heap_zalloc(opaque, items * size)); } /**********************************************************************//** @@ -684,7 +684,7 @@ page_zip_set_alloc( { z_stream* strm = stream; - strm->zalloc = page_zip_malloc; + strm->zalloc = page_zip_zalloc; strm->zfree = page_zip_free; strm->opaque = heap; } @@ -2912,19 +2912,18 @@ zlib_error: page_zip_set_alloc(&d_stream, heap); - if (UNIV_UNLIKELY(inflateInit2(&d_stream, UNIV_PAGE_SIZE_SHIFT) - != Z_OK)) { - ut_error; - } - d_stream.next_in = page_zip->data + PAGE_DATA; /* Subtract the space reserved for the page header and the end marker of the modification log. */ d_stream.avail_in = page_zip_get_size(page_zip) - (PAGE_DATA + 1); - d_stream.next_out = page + PAGE_ZIP_START; d_stream.avail_out = UNIV_PAGE_SIZE - PAGE_ZIP_START; + if (UNIV_UNLIKELY(inflateInit2(&d_stream, UNIV_PAGE_SIZE_SHIFT) + != Z_OK)) { + ut_error; + } + /* Decode the zlib header and the index information. */ if (UNIV_UNLIKELY(inflate(&d_stream, Z_BLOCK) != Z_OK)) { From 7a37a7c0c8dfece51bb7fdcb171d74ab04ef2736 Mon Sep 17 00:00:00 2001 From: Georgi Kodinov Date: Tue, 15 Mar 2011 13:19:30 +0200 Subject: [PATCH 10/91] Bug #11765023: 57934: DOS POSSIBLE SINCE BINARY CASTING DOESN'T ADHERE TO MAX_ALLOWED_PACKET Added a check for max_packet_length in CONVERT(, BINARY|CHAR). Added a test case. --- mysql-test/r/cast.result | 15 +++++++++++++++ mysql-test/t/cast.test | 14 ++++++++++++++ sql/item_timefunc.cc | 13 +++++++++++++ 3 files changed, 42 insertions(+) diff --git a/mysql-test/r/cast.result b/mysql-test/r/cast.result index dd61396e485..974a6bee63f 100644 --- a/mysql-test/r/cast.result +++ b/mysql-test/r/cast.result @@ -451,4 +451,19 @@ SELECT CONVERT(t2.a USING UTF8) FROM t1, t1 t2 LIMIT 1 1 1 DROP TABLE t1; +# +# Bug #11765023: 57934: DOS POSSIBLE SINCE BINARY CASTING +# DOESN'T ADHERE TO MAX_ALLOWED_PACKET +SET @@GLOBAL.max_allowed_packet=2048; +SELECT CONVERT('a', BINARY(2049)); +CONVERT('a', BINARY(2049)) +NULL +Warnings: +Warning 1301 Result of cast_as_binary() was larger than max_allowed_packet (2048) - truncated +SELECT CONVERT('a', CHAR(2049)); +CONVERT('a', CHAR(2049)) +NULL +Warnings: +Warning 1301 Result of cast_as_char() was larger than max_allowed_packet (2048) - truncated +SET @@GLOBAL.max_allowed_packet=default; End of 5.1 tests diff --git a/mysql-test/t/cast.test b/mysql-test/t/cast.test index 8e60d548c2f..426d7c7fdf2 100644 --- a/mysql-test/t/cast.test +++ b/mysql-test/t/cast.test @@ -282,5 +282,19 @@ SELECT 1 FROM ) AS s LIMIT 1; DROP TABLE t1; +--echo # +--echo # Bug #11765023: 57934: DOS POSSIBLE SINCE BINARY CASTING +--echo # DOESN'T ADHERE TO MAX_ALLOWED_PACKET + +SET @@GLOBAL.max_allowed_packet=2048; +# reconnect to make the new max packet size take effect +--connect (newconn, localhost, root,,) + +SELECT CONVERT('a', BINARY(2049)); +SELECT CONVERT('a', CHAR(2049)); + +connection default; +disconnect newconn; +SET @@GLOBAL.max_allowed_packet=default; --echo End of 5.1 tests diff --git a/sql/item_timefunc.cc b/sql/item_timefunc.cc index 6335199b8de..74aae94b6f2 100644 --- a/sql/item_timefunc.cc +++ b/sql/item_timefunc.cc @@ -2444,6 +2444,19 @@ String *Item_char_typecast::val_str(String *str) String *res; uint32 length; + if (cast_length >= 0 && + ((unsigned) cast_length) > current_thd->variables.max_allowed_packet) + { + push_warning_printf(current_thd, MYSQL_ERROR::WARN_LEVEL_WARN, + ER_WARN_ALLOWED_PACKET_OVERFLOWED, + ER(ER_WARN_ALLOWED_PACKET_OVERFLOWED), + cast_cs == &my_charset_bin ? + "cast_as_binary" : func_name(), + current_thd->variables.max_allowed_packet); + null_value= 1; + return 0; + } + if (!charset_conversion) { if (!(res= args[0]->val_str(str))) From ebba068d26115f6d65ca12163bb771b56003edd5 Mon Sep 17 00:00:00 2001 From: Bjorn Munch Date: Tue, 15 Mar 2011 16:06:59 +0100 Subject: [PATCH 11/91] Bug #11762804 55442: MYSQLD DEBUG CRASHES WHILE RUNNING MYISAM_CRASH_BEFORE_FLUSH_KEYS.TEST This will cause affected tests to skip if CrashReporter would popup Found 5 tests that needed modification --- mysql-test/include/not_crashrep.inc | 24 +++++++++++++++++++ mysql-test/suite/binlog/t/binlog_index.test | 2 ++ .../suite/innodb/t/innodb_bug53756.test | 3 +++ .../innodb_plugin/t/innodb_bug53756.test | 3 +++ mysql-test/t/crash_commit_before.test | 2 ++ .../t/myisam_crash_before_flush_keys.test | 3 +++ 6 files changed, 37 insertions(+) create mode 100644 mysql-test/include/not_crashrep.inc diff --git a/mysql-test/include/not_crashrep.inc b/mysql-test/include/not_crashrep.inc new file mode 100644 index 00000000000..e126f339a5f --- /dev/null +++ b/mysql-test/include/not_crashrep.inc @@ -0,0 +1,24 @@ +# Check if CrashReporter is enabled and would open a window + +perl; +sub skip_test { + # Only relevant on Mac OS X + return 0 unless $^O eq 'darwin'; + my $crep= `defaults read com.apple.CrashReporter DialogType`; + return 0 if $?; + chomp ($crep); + $crep= lc $crep; + return ($crep eq 'basic' || $crep eq 'developer'); +} +my $skip= skip_test(); +open (F, ">" . $ENV{'MYSQL_TMP_DIR'} . "/crashrep.inc"); +print F "let \$crashrep= $skip;\n"; +close F; +EOF + +--source $MYSQL_TMP_DIR/crashrep.inc +--remove_file $MYSQL_TMP_DIR/crashrep.inc + +if ($crashrep) { + --skip CrashReporter would popup a window +} diff --git a/mysql-test/suite/binlog/t/binlog_index.test b/mysql-test/suite/binlog/t/binlog_index.test index b735574fdb9..086c0842b20 100644 --- a/mysql-test/suite/binlog/t/binlog_index.test +++ b/mysql-test/suite/binlog/t/binlog_index.test @@ -6,6 +6,8 @@ source include/not_embedded.inc; # Don't test this under valgrind, memory leaks will occur --source include/not_valgrind.inc source include/have_debug.inc; +# Avoid CrashReporter popup on Mac +--source include/not_crashrep.inc call mtr.add_suppression('Attempting backtrace'); call mtr.add_suppression('MSYQL_BIN_LOG::purge_logs failed to process registered files that would be purged.'); call mtr.add_suppression('MSYQL_BIN_LOG::open failed to sync the index file'); diff --git a/mysql-test/suite/innodb/t/innodb_bug53756.test b/mysql-test/suite/innodb/t/innodb_bug53756.test index d3b0a77c680..7a48f130b2c 100644 --- a/mysql-test/suite/innodb/t/innodb_bug53756.test +++ b/mysql-test/suite/innodb/t/innodb_bug53756.test @@ -17,6 +17,9 @@ # This test case needs InnoDB. --source include/have_innodb.inc +# Avoid CrashReporter popup on Mac +--source include/not_crashrep.inc + # # Precautionary clean up. # diff --git a/mysql-test/suite/innodb_plugin/t/innodb_bug53756.test b/mysql-test/suite/innodb_plugin/t/innodb_bug53756.test index 8c48550a64d..37a79ea3021 100644 --- a/mysql-test/suite/innodb_plugin/t/innodb_bug53756.test +++ b/mysql-test/suite/innodb_plugin/t/innodb_bug53756.test @@ -17,6 +17,9 @@ # This test case needs InnoDB. -- source include/have_innodb_plugin.inc +# Avoid CrashReporter popup on Mac +--source include/not_crashrep.inc + # # Precautionary clean up. # diff --git a/mysql-test/t/crash_commit_before.test b/mysql-test/t/crash_commit_before.test index e3dba58d4df..6e36d2345e1 100644 --- a/mysql-test/t/crash_commit_before.test +++ b/mysql-test/t/crash_commit_before.test @@ -1,6 +1,8 @@ -- source include/not_embedded.inc # Don't test this under valgrind, memory leaks will occur --source include/not_valgrind.inc +# Avoid CrashReporter popup on Mac +--source include/not_crashrep.inc # Binary must be compiled with debug for crash to occur --source include/have_debug.inc diff --git a/mysql-test/t/myisam_crash_before_flush_keys.test b/mysql-test/t/myisam_crash_before_flush_keys.test index 1860ddd27e3..ea41b3559ca 100644 --- a/mysql-test/t/myisam_crash_before_flush_keys.test +++ b/mysql-test/t/myisam_crash_before_flush_keys.test @@ -8,6 +8,9 @@ --echo # Binary must be compiled with debug for crash to occur --source include/have_debug.inc +# Avoid CrashReporter popup on Mac +--source include/not_crashrep.inc + let $MYSQLD_DATADIR= `select @@datadir`; SET GLOBAL delay_key_write=ALL; CREATE TABLE t1(a INT, From 3e97851eb6569a113a9d6e888af7dcbf5eb65082 Mon Sep 17 00:00:00 2001 From: Kent Boortz Date: Wed, 16 Mar 2011 23:04:29 +0100 Subject: [PATCH 12/91] Removed the "Third-Party Component Notices" part --- README | 2209 +------------------------------------------------------- 1 file changed, 1 insertion(+), 2208 deletions(-) diff --git a/README b/README index 2e18fb55a22..795d325e2d5 100644 --- a/README +++ b/README @@ -1,4 +1,4 @@ -MySQL Server +MySQL Server 5.0 This is a release of MySQL, a dual-license SQL database server. For the avoidance of doubt, this particular copy of the software @@ -54,2210 +54,3 @@ You can browse the MySQL Reference Manual online or download it in any of several formats at the URL given earlier in this file. Source distributions include a local copy of the manual in the Docs directory. - -******************************************************************** - -Third-Party Component Notices - -********************************************************************* - -%%The following software may be included in this product: -FindGTest.cmake (part of CMake 2.8.0) - -Use of any of this software is governed by the terms of the license below: - -# Copyright 2009 Kitware, Inc. -# Copyright 2009 Philip Lowman -# Copyright 2009 Daniel Blezek -# -# Distributed under the OSI-approved BSD License (the "License"); -# see accompanying file Copyright.txt for details. -# -# This software is distributed WITHOUT ANY WARRANTY; without even the -# implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. -# See the License for more information. -#=========================================================================== -# (To distributed this file outside of CMake, substitute the full -# License text for the above reference.) -# -# Thanks to Daniel Blezek for the GTEST_ADD_TESTS code - - -Text of Copyright.txt mentioned above: - -CMake - Cross Platform Makefile Generator -Copyright 2000-2009 Kitware, Inc., Insight Software Consortium -All rights reserved. - -Redistribution and use in source and binary forms, with or without -modification, are permitted provided that the following conditions -are met: - -* Redistributions of source code must retain the above copyright - notice, this list of conditions and the following disclaimer. - -* Redistributions in binary form must reproduce the above copyright - notice, this list of conditions and the following disclaimer in the - documentation and/or other materials provided with the distribution. - -* Neither the names of Kitware, Inc., the Insight Software Consortium, - nor the names of their contributors may be used to endorse or promote - products derived from this software without specific prior written - permission. - -THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS -"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT -LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR -A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT -HOLDER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, -SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT -LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, -DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY -THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT -(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE -OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. - -*************************************************************************** - -%%The following software may be included in this product: -Cmake - -Use of any of this software is governed by the terms of the license below: - -CMake is distributed under BSD License - - Copyright (c) 2008, Kitware, Inc. - All rights reserved. - - Redistribution and use in source and binary forms, with or without - modification, are permitted provided that the following conditions are - met: - - * Redistributions of source code must retain the above copyright - notice, this list of conditions and the following disclaimer. - * Redistributions in binary form must reproduce the above copyright - notice, this list of conditions and the following disclaimer in - the documentation and/or other materials provided with the - distribution. - * Neither the name of Kitware, Inc. nor the names of its - contributors may be used to endorse or promote products derived - from this software without specific prior written permission. - - THIS SOFTWARE IS PROVIDED BY Kitware, Inc. "AS IS" AND ANY EXPRESS OR - IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED - WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE - DISCLAIMED. IN NO EVENT SHALL Kitware Inc. BE LIABLE FOR ANY DIRECT, - INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES - (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR - SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) - HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, - STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING - IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE - POSSIBILITY OF SUCH DAMAGE. - -Additional License(s) - -cmake-2.4.8/Utilities/cmtar/compat/gethostname.c: - gethostname.c: minimal substitute for missing gethostname() function - created 2000-Mar-02 jmk - requires SVR4 uname() and -lc - - by Jim Knoble - Copyright ? 2000 Jim Knoble - - Permission to use, copy, modify, distribute, and sell this software - and its documentation for any purpose is hereby granted without fee, - provided that the above copyright notice appear in all copies and - that both that copyright notice and this permission notice appear in - supporting documentation. - - This software is provided "as is", without warranty of any kind, - express or implied, including but not limited to the warranties of - merchantability, fitness for a particular purpose and - noninfringement. In no event shall the author(s) be liable for any - claim, damages or other liability, whether in an action of contract, - tort or otherwise, arising from, out of or in connection with the - software or the use or other dealings in the software. - ----------------------------------- - -* Originally written by Steven M. Bellovin while -* at the University of North Carolina at Chapel Hill. Later tweaked by -* a couple of people on Usenet. Completely overhauled by Rich $alz -* and Jim Berets in August, 1990. -* -* This code is in the public domain and has no copyright. - -------------------------------- - - THIS CODE IS SPECIFICALLY EXEMPTED FROM THE NCURSES PACKAGE COPYRIGHT. - You may freely copy it for use as a template for your own field types. - If you develop a field type that might be of general use, please send - it back to the ncurses maintainers for inclusion in the next version. - -************************************************************************** - - * Author : Per Foreby, perf@efd.lth.se - * Author : Juergen Pfeifer, juergen.pfeifer@gmx.net - -************************************************************************** - ----------------------------------------- - - Copyright (c) 2002 Insight Consortium. All rights reserved. - See ITKCopyright.txt or http://www.itk.org/HTML/Copyright.htm for - details. - - This software is distributed WITHOUT ANY WARRANTY; without even - the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR - PURPOSE. See the above copyright notices for more information. - --------------------------------------------- - - Skeleton parser for Yacc-like parsing with Bison, - Copyright (C) 1984, 1989, 1990, 2000, 2001, 2002, 2003 Free Software - Foundation, Inc. - - This program is free software; you can redistribute it and/or modify - it under the terms of the GNU General Public License as published by - the Free Software Foundation; either version 2, or (at your option) - any later version. - - This program is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the - GNU General Public License for more details. - - You should have received a copy of the GNU General Public License - along with this program; if not, write to the Free Software - Foundation, Inc., 51 Franklin Street, Fifth Floor, - Boston, MA 02110-1301, USA. - - As a special exception, when this file is copied by Bison into a - Bison output file, you may use that output file without restriction. - This special exception was added by the Free Software Foundation - in version 1.24 of Bison. - ---------------------------------------------------- - -cmake-2.4.8/Utilities/cmzlib/zlib.h: - zlib.h -- interface of the 'zlib' general purpose compression library - version 1.1.4, March 11th, 2002 - - Copyright (C) 1995-2002 Jean-loup Gailly and Mark Adler - - This software is provided 'as-is', without any express or implied - warranty. In no event will the authors be held liable for any damages - arising from the use of this software. - - Permission is granted to anyone to use this software for any purpose, - including commercial applications, and to alter it and redistribute it - freely, subject to the following restrictions: - - 1. The origin of this software must not be misrepresented; you must not - claim that you wrote the original software. If you use this software - in a product, an acknowledgment in the product documentation would be - appreciated but is not required. - 2. Altered source versions must be plainly marked as such, and must - not be misrepresented as being the original software. - 3. This notice may not be removed or altered from any source - distribution. - - Jean-loup Gailly Mark Adler - ----------------------------------------------- - - This source code was modified by Martin Hedenfalk for use in Curl. His - latest changes were done 2000-09-18. - - It has since been patched away like a madman by Daniel Stenberg to make it - better applied to curl conditions, and to make it not use globals, pollute - name space and more. This source code awaits a rewrite to work around the - paragraph 2 in the BSD licenses as explained below. - - Copyright (c) 1995, 1996, 1997, 1998, 1999 Kungliga Tekniska Hgskolan - It has since been patched and modified a lot by Daniel Stenberg to make it - better applied to curl conditions, and to make it not use globals, pollute - name space and more. This source code awaits a rewrite to work around the - paragraph 2 in the BSD licenses as explained below. - - Copyright (c) 1998, 1999 Kungliga Tekniska Hgskolan - (Royal Institute of Technology, Stockholm, Sweden). - All rights reserved. - - Redistribution and use in source and binary forms, with or without - modification, are permitted provided that the following conditions - are met: - - 1. Redistributions of source code must retain the above copyright - notice, this list of conditions and the following disclaimer. - - 2. Redistributions in binary form must reproduce the above copyright - notice, this list of conditions and the following disclaimer in the - documentation and/or other materials provided with the distribution. - - 3. Neither the name of the Institute nor the names of its contributors - may be used to endorse or promote products derived from this software - without specific prior written permission. - - THIS SOFTWARE IS PROVIDED BY THE INSTITUTE AND CONTRIBUTORS ``AS IS'' AND - ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE - IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE - ARE DISCLAIMED. IN NO EVENT SHALL THE INSTITUTE OR CONTRIBUTORS BE LIABLE - FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL - DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR - SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER - CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT - LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY - OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF - SUCH DAMAGE. - ---------------------------------------------- - - Permission to use, copy, modify, and distribute this software for any - purpose with or without fee is hereby granted, provided that the above - copyright notice and this permission notice appear in all copies. - - THIS SOFTWARE IS PROVIDED ``AS IS'' AND WITHOUT ANY EXPRESS OR IMPLIED - WARRANTIES, INCLUDING, WITHOUT LIMITATION, THE IMPLIED WARRANTIES OF - MERCHANTIBILITY AND FITNESS FOR A PARTICULAR PURPOSE. THE AUTHORS AND - CONTRIBUTORS ACCEPT NO RESPONSIBILITY IN ANY CONCEIVABLE MANNER. - --------------------------------------------------- - -cmake-2.4.8/Utilities/cmcurl/inet_pton.c, -cmake-2.4.8/Source/CTest/Curl/inet_pton.c: - This is from the BIND 4.9.4 release, modified to compile by itself - - Copyright (c) 1996 by Internet Software Consortium. - - Permission to use, copy, modify, and distribute this software for any - purpose with or without fee is hereby granted, provided that the above - copyright notice and this permission notice appear in all copies. - - THE SOFTWARE IS PROVIDED "AS IS" AND INTERNET SOFTWARE CONSORTIUM - DISCLAIMS ALL WARRANTIES WITH REGARD TO THIS SOFTWARE INCLUDING ALL - IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL - INTERNET SOFTWARE CONSORTIUM BE LIABLE FOR ANY SPECIAL, DIRECT, INDIRECT, - OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES WHATSOEVER RESULTING FROM LOSS OF - USE, DATA OR PROFITS, WHETHER IN AN ACTION OF CONTRACT, NEGLIGENCE OR - OTHER TORTIOUS ACTION, ARISING OUT OF OR IN CONNECTION WITH THE USE OR - PERFORMANCE OF THIS SOFTWARE. - -------------------------------------------------------- - -* Copyright (C) 2001 by Eric Kidd. All rights reserved. -* Copyright (C) 2001 by Luke Howard. All rights reserved. -* Copyright (C) 2002 Ximian, Inc. -* -* Redistribution and use in source and binary forms, with or without -* modification, are permitted provided that the following conditions -* are met: -* 1. Redistributions of source code must retain the above copyright -* notice, this list of conditions and the following disclaimer. -* 2. Redistributions in binary form must reproduce the above copyright -* notice, this list of conditions and the following disclaimer in the -* documentation and/or other materials provided with the distribution. -* 3. The name of the author may not be used to endorse or promote products -* derived from this software without specific prior written permission. -* -* THIS SOFTWARE IS PROVIDED BY THE AUTHOR AND CONTRIBUTORS ``AS IS'' AND ANY -* EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED -* WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE -* DISCLAIMED. IN NO EVENT SHALL THE AUTHOR OR CONTRIBUTORS BE LIABLE FOR -* ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL -* DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR -* SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER -* CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT -* LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY -* OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF -* SUCH DAMAGE. - ---------------------------------------------------- - - Copyright (c) 1994 - The Regents of the University of California. All rights reserved. - - This code is derived from software contributed to Berkeley by - Chuck Karish of Mindcraft, Inc. - - Redistribution and use in source and binary forms, with or without - modification, are permitted provided that the following conditions - are met: - 1. Redistributions of source code must retain the above copyright - notice, this list of conditions and the following disclaimer. - 2. Redistributions in binary form must reproduce the above copyright - notice, this list of conditions and the following disclaimer in the - documentation and/or other materials provided with the distribution. - 3. Neither the name of the University nor the names of its contributors - Copyright (c) 1985, 1986 The Regents of the University of California. - All rights reserved. - - This code is derived from software contributed to Berkeley by - James A. Woods, derived from original work by Spencer Thomas - and Joseph Orost. - ------------------------------------------------- - - Copyright (c) 1989, 1993, 1994 - The Regents of the University of California. All rights reserved. - - This code is derived from software contributed to Berkeley by - Guido van Rossum. - - Copyright (c) 1990 The Regents of the University of California. - All rights reserved. - - Redistribution and use in source and binary forms, with or without - modification, are permitted provided that the following conditions - are met: - 1. Redistributions of source code must retain the above copyright - notice, this list of conditions and the following disclaimer. - 2. Redistributions in binary form must reproduce the above copyright - notice, this list of conditions and the following disclaimer in the - documentation and/or other materials provided with the distribution. - 3. All advertising materials mentioning features or use of this software - must display the following acknowledgement: - This product includes software developed by the University of - California, Berkeley and its contributors. - 4. Neither the name of the University nor the names of its contributors - may be used to endorse or promote products derived from this software - without specific prior written permission. - - THIS SOFTWARE IS PROVIDED BY THE REGENTS AND CONTRIBUTORS ``AS IS'' AND - ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE - IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE - ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE LIABLE - FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL - DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR - SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER - CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT - LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY - OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF - SUCH DAMAGE. - ------------------------------------------------------- - - Project ___| | | | _ \| | - / __| | | | |_) | | - | (__| |_| | _ <| |___ - \___|\___/|_| \_\_____| - - Copyright (C) 1998 - 2004, Daniel Stenberg, , et al. - - Copyright (C) 2004, Daniel Stenberg, , et al. - - This software is licensed as described in the file COPYING, which - you should have received as part of this distribution. The terms - are also available at http://curl.haxx.se/docs/copyright.html. - - You may opt to use, copy, modify, merge, publish, distribute and/or sell - copies of the Software, and permit persons to whom the Software is - furnished to do so, under the terms of the COPYING file. - - This software is distributed on an "AS IS" basis, WITHOUT WARRANTY OF ANY - KIND, either express or implied. - ------------------------------------------------------------- - -*************************************************************************** - Copyright (c) 1998 Free Software Foundation, Inc. - Copyright (c) 1998,2000 Free Software Foundation, Inc. - - Permission is hereby granted, free of charge, to any person obtaining a - copy of this software and associated documentation files (the - "Software"), to deal in the Software without restriction, including - without limitation the rights to use, copy, modify, merge, publish, - distribute, distribute with modifications, sublicense, and/or sell copies - of the Software, and to permit persons to whom the Software is furnished - to do so, subject to the following conditions: - - The above copyright notice and this permission notice shall be included in - all copies or substantial portions of the Software. - - THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR - IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF - MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN - NO EVENT SHALL THE ABOVE COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, - DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR - OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE - USE OR OTHER DEALINGS IN THE SOFTWARE. - - - Except as contained in this notice, the name(s) of the above copyright - holders shall not be used in advertising or otherwise to promote the sale, - use or other dealings in this Software without prior written - authorization. -*************************************************************************** - ------------------------------------------------------- - - Copyright (c) 1997 Todd C. Miller - All rights reserved. - - Redistribution and use in source and binary forms, with or without - modification, are permitted provided that the following conditions - are met: - 1. Redistributions of source code must retain the above copyright - notice, this list of conditions and the following disclaimer. - 2. Redistributions in binary form must reproduce the above copyright - notice, this list of conditions and the following disclaimer in the - documentation and/or other materials provided with the distribution. - 3. The name of the author may not be used to endorse or promote products - derived from this software without specific prior written permission. - - THIS SOFTWARE IS PROVIDED ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, - INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY - AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL - THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, - EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, - PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR - PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF - LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING - NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS - SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. - - THIS SOFTWARE IS PROVIDED BY THE AUTHOR AND CONTRIBUTORS ``AS IS'' AND ANY - EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED - WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE - DISCLAIMED. IN NO EVENT SHALL THE AUTHOR OR CONTRIBUTORS BE LIABLE FOR - ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL - DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR - SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER - CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT - LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY - OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF - SUCH DAMAGE. - -*************************************************************************** - -%%The following software may be included in this product: -Fred Fish's Dbug Library - -Use of any of this software is governed by the terms of the license below: - - * N O T I C E * - * * - * Copyright Abandoned, 1987, Fred Fish * - * * - * * - * This previously copyrighted work has been placed into the public * - * domain by the author and may be freely used for any purpose, * - * private or commercial. * - * * - * Because of the number of inquiries I was receiving about the use * - * of this product in commercially developed works I have decided to * - * simply make it public domain to further its unrestricted use. I * - * specifically would be most happy to see this material become a * - * part of the standard Unix distributions by AT&T and the Berkeley * - * Computer Science Research Group, and a standard part of the GNU * - * system from the Free Software Foundation. * - * * - * I would appreciate it, as a courtesy, if this notice is left in * - * all copies and derivative works. Thank you. * - * * - * The author makes no warranty of any kind with respect to this * - * product and explicitly disclaims any implied warranties of mer- * - * chantability or fitness for any particular purpose. * - -*************************************************************************** - -%%The following software may be included in this product: -dbug_analyze.c (part of Fred Fish's Dbug Library) - -Use of any of this software is governed by the terms of the license below: - -* Copyright Abandoned, 1987, Fred Fish * -* * -* * -* This previously copyrighted work has been placed into the public * -* domain by the author and may be freely used for any purpose, * -* private or commercial. * -* * -* Because of the number of inquiries I was receiving about the use * -* of this product in commercially developed works I have decided to * -* simply make it public domain to further its unrestricted use. I * -* specifically would be most happy to see this material become a * -* part of the standard Unix distributions by AT&T and the Berkeley * -* Computer Science Research Group, and a standard part of the GNU * -* system from the Free Software Foundation. * -* * -* I would appreciate it, as a courtesy, if this notice is left in * -* all copies and derivative works. Thank you. * -* * -* The author makes no warranty of any kind with respect to this * -* product and explicitly disclaims any implied warranties of mer- * -* chantability or fitness for any particular purpose. * - -*************************************************************************** - -%%The following software may be included in this product: -GNU Libtool, only ltmain.sh, libtool, auto-gen fil - -Use of any of this software is governed by the terms of the license below: - -ltmain.sh inclusion: -# ltmain.sh - Provide generalized library-building support services. -# NOTE: Changing this file will not affect anything until you rerun configure. -# -# Copyright (C) 1996, 1997, 1998, 1999, 2000, 2001, 2003, 2004, 2005, 2006, -# 2007 Free Software Foundation, Inc. -# Originally by Gordon Matzigkeit , 1996 -# -# This program is free software; you can redistribute it and/or modify -# it under the terms of the GNU General Public License as published by -# the Free Software Foundation; either version 2 of the License, or -# (at your option) any later version. -# -# This program is distributed in the hope that it will be useful, but -# WITHOUT ANY WARRANTY; without even the implied warranty of -# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU -# General Public License for more details. -# -# You should have received a copy of the GNU General Public License -# along with this program; if not, write to the Free Software -# Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301, USA. -# -# As a special exception to the GNU General Public License, if you -# distribute this file as part of a program that contains a -# configuration script generated by Autoconf, you may include it under -# the same distribution terms that you use for the rest of that program. - - -libtool inclusion: -# libtoolT - Provide generalized library-building support services. -# Generated automatically by (GNU mysql 5.1.30) -# NOTE: Changes made to this file will be lost: look at ltmain.sh. -# -# Copyright (C) 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004, 2005, -# 2006, 2007 Free Software Foundation, Inc. -# -# This file is part of GNU Libtool: -# Originally by Gordon Matzigkeit , 1996 -# -# This program is free software; you can redistribute it and/or modify -# it under the terms of the GNU General Public License as published by -# the Free Software Foundation; either version 2 of the License, or -# (at your option) any later version. -# -# This program is distributed in the hope that it will be useful, but -# WITHOUT ANY WARRANTY; without even the implied warranty of -# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU -# General Public License for more details. -# -# You should have received a copy of the GNU General Public License -# along with this program; if not, write to the Free Software -# Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301, USA. -# -# As a special exception to the GNU General Public License, if you -# distribute this file as part of a program that contains a -# configuration script generated by Autoconf, you may include it under -# the same distribution terms that you use for the rest of that program. - - -Auto-generated files: -# `$echo "$cfgfile" | sed 's%^.*/%%'` - Provide generalized library-building -# support services. -# Generated automatically by $PROGRAM (GNU $PACKAGE $VERSION$TIMESTAMP) -# NOTE: Changes made to this file will be lost: look at ltmain.sh. -# -# Copyright (C) 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, -# 2004, 2005, 2006, 2007 Free Software Foundation, Inc. -# -# This file is part of GNU Libtool: -# Originally by Gordon Matzigkeit , 1996 -# -# This program is free software; you can redistribute it and/or modify -# it under the terms of the GNU General Public License as published by -# the Free Software Foundation; either version 2 of the License, or -# (at your option) any later version. -# -# This program is distributed in the hope that it will be useful, but -# WITHOUT ANY WARRANTY; without even the implied warranty of -# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU -# General Public License for more details. -# -# You should have received a copy of the GNU General Public License -# along with this program; if not, write to the Free Software -# Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301, USA. -# -# As a special exception to the GNU General Public License, if you -# distribute this file as part of a program that contains a -# configuration script generated by Autoconf, you may include it under -# the same distribution terms that you use for the rest of that program. - -Additional License(s) - -# As a special exception to the GNU General Public License, if you -# distribute this file as part of a program that contains a -# configuration script generated by Autoconf, you may include it under -# the same distribution terms that you use for the rest of that program. - -*************************************************************************** - -%%The following software may be included in this product: -innochecksum.c - -Use of any of this software is governed by the terms of the license below: - -GNU GENERAL PUBLIC LICENSE - -Version 2, June 1991 - -Copyright (C) 1989, 1991 Free Software Foundation, Inc. -51 Franklin Street, Fifth Floor, Boston, MA 02110-1301, USA - -Everyone is permitted to copy and distribute verbatim copies -of this license document, but changing it is not allowed. - -Preamble - -The licenses for most software are designed to take away your freedom to share -and change it. By contrast, the GNU General Public License is intended to -guarantee your freedom to share and change free software--to make sure the -software is free for all its users. This General Public License applies to most -of the Free Software Foundation's software and to any other program whose -authors commit to using it. (Some other Free Software Foundation software is -covered by the GNU Lesser General Public License instead.) You can apply it to -your programs, too. - -When we speak of free software, we are referring to freedom, not price. Our -General Public Licenses are designed to make sure that you have the freedom to -distribute copies of free software (and charge for this service if you wish), -that you receive source code or can get it if you want it, that you can change -the software or use pieces of it in new free programs; and that you know you can -do these things. - -To protect your rights, we need to make restrictions that forbid anyone to deny -you these rights or to ask you to surrender the rights. These restrictions -translate to certain responsibilities for you if you distribute copies of the -software, or if you modify it. - -For example, if you distribute copies of such a program, whether gratis or for a -fee, you must give the recipients all the rights that you have. You must make -sure that they, too, receive or can get the source code. And you must show them -these terms so they know their rights. - -We protect your rights with two steps: (1) copyright the software, and (2) offer -you this license which gives you legal permission to copy, distribute and/or -modify the software. - -Also, for each author's protection and ours, we want to make certain that -everyone understands that there is no warranty for this free software. If the -software is modified by someone else and passed on, we want its recipients to -know that what they have is not the original, so that any problems introduced by -others will not reflect on the original authors' reputations. - -Finally, any free program is threatened constantly by software patents. We wish -to avoid the danger that redistributors of a free program will individually -obtain patent licenses, in effect making the program proprietary. To prevent -this, we have made it clear that any patent must be licensed for everyone's free -use or not licensed at all. - -The precise terms and conditions for copying, distribution and modification follow. -TERMS AND CONDITIONS FOR COPYING, DISTRIBUTION AND MODIFICATION - -0. This License applies to any program or other work which contains a notice -placed by the copyright holder saying it may be distributed under the terms of -this General Public License. The "Program", below, refers to any such program or -work, and a "work based on the Program" means either the Program or any -derivative work under copyright law: that is to say, a work containing the -Program or a portion of it, either verbatim or with modifications and/or -translated into another language. (Hereinafter, translation is included without -limitation in the term "modification".) Each licensee is addressed as "you". - -Activities other than copying, distribution and modification are not covered by -this License; they are outside its scope. The act of running the Program is not -restricted, and the output from the Program is covered only if its contents -constitute a work based on the Program (independent of having been made by -running the Program). Whether that is true depends on what the Program does. - -1. You may copy and distribute verbatim copies of the Program's source code as -you receive it, in any medium, provided that you conspicuously and appropriately -publish on each copy an appropriate copyright notice and disclaimer of warranty; -keep intact all the notices that refer to this License and to the absence of any -warranty; and give any other recipients of the Program a copy of this License -along with the Program. - -You may charge a fee for the physical act of transferring a copy, and you may at -your option offer warranty protection in exchange for a fee. - -2. You may modify your copy or copies of the Program or any portion of it, thus -forming a work based on the Program, and copy and distribute such modifications -or work under the terms of Section 1 above, provided that you also meet all of -these conditions: - - a) You must cause the modified files to carry prominent notices stating that -you changed the files and the date of any change. - b) You must cause any work that you distribute or publish, that in whole or -in part contains or is derived from the Program or any part thereof, to be -licensed as a whole at no charge to all third parties under the terms of this -License. - c) If the modified program normally reads commands interactively when run, -you must cause it, when started running for such interactive use in the most -ordinary way, to print or display an announcement including an appropriate -copyright notice and a notice that there is no warranty (or else, saying that -you provide a warranty) and that users may redistribute the program under these -conditions, and telling the user how to view a copy of this License. (Exception: -if the Program itself is interactive but does not normally print such an -announcement, your work based on the Program is not required to print an -announcement.) - -These requirements apply to the modified work as a whole. If identifiable -sections of that work are not derived from the Program, and can be reasonably -considered independent and separate works in themselves, then this License, and -its terms, do not apply to those sections when you distribute them as separate -works. But when you distribute the same sections as part of a whole which is a -work based on the Program, the distribution of the whole must be on the terms of -this License, whose permissions for other licensees extend to the entire whole, -and thus to each and every part regardless of who wrote it. - -Thus, it is not the intent of this section to claim rights or contest your -rights to work written entirely by you; rather, the intent is to exercise the -right to control the distribution of derivative or collective works based on the -Program. - -In addition, mere aggregation of another work not based on the Program with the -Program (or with a work based on the Program) on a volume of a storage or -distribution medium does not bring the other work under the scope of this License. - -3. You may copy and distribute the Program (or a work based on it, under Section -2) in object code or executable form under the terms of Sections 1 and 2 above -provided that you also do one of the following: - - a) Accompany it with the complete corresponding machine-readable source -code, which must be distributed under the terms of Sections 1 and 2 above on a -medium customarily used for software interchange; or, - b) Accompany it with a written offer, valid for at least three years, to -give any third party, for a charge no more than your cost of physically -performing source distribution, a complete machine-readable copy of the -corresponding source code, to be distributed under the terms of Sections 1 and 2 -above on a medium customarily used for software interchange; or, - c) Accompany it with the information you received as to the offer to -distribute corresponding source code. (This alternative is allowed only for -noncommercial distribution and only if you received the program in object code -or executable form with such an offer, in accord with Subsection b above.) - -The source code for a work means the preferred form of the work for making -modifications to it. For an executable work, complete source code means all the -source code for all modules it contains, plus any associated interface -definition files, plus the scripts used to control compilation and installation -of the executable. However, as a special exception, the source code distributed -need not include anything that is normally distributed (in either source or -binary form) with the major components (compiler, kernel, and so on) of the -operating system on which the executable runs, unless that component itself -accompanies the executable. - -If distribution of executable or object code is made by offering access to copy -from a designated place, then offering equivalent access to copy the source code -from the same place counts as distribution of the source code, even though third -parties are not compelled to copy the source along with the object code. - -4. You may not copy, modify, sublicense, or distribute the Program except as -expressly provided under this License. Any attempt otherwise to copy, modify, -sublicense or distribute the Program is void, and will automatically terminate -your rights under this License. However, parties who have received copies, or -rights, from you under this License will not have their licenses terminated so -long as such parties remain in full compliance. - -5. You are not required to accept this License, since you have not signed it. -However, nothing else grants you permission to modify or distribute the Program -or its derivative works. These actions are prohibited by law if you do not -accept this License. Therefore, by modifying or distributing the Program (or any -work based on the Program), you indicate your acceptance of this License to do -so, and all its terms and conditions for copying, distributing or modifying the -Program or works based on it. - -6. Each time you redistribute the Program (or any work based on the Program), -the recipient automatically receives a license from the original licensor to -copy, distribute or modify the Program subject to these terms and conditions. -You may not impose any further restrictions on the recipients' exercise of the -rights granted herein. You are not responsible for enforcing compliance by third -parties to this License. - -7. If, as a consequence of a court judgment or allegation of patent infringement -or for any other reason (not limited to patent issues), conditions are imposed -on you (whether by court order, agreement or otherwise) that contradict the -conditions of this License, they do not excuse you from the conditions of this -License. If you cannot distribute so as to satisfy simultaneously your -obligations under this License and any other pertinent obligations, then as a -consequence you may not distribute the Program at all. For example, if a patent -license would not permit royalty-free redistribution of the Program by all those -who receive copies directly or indirectly through you, then the only way you -could satisfy both it and this License would be to refrain entirely from -distribution of the Program. - -If any portion of this section is held invalid or unenforceable under any -particular circumstance, the balance of the section is intended to apply and the -section as a whole is intended to apply in other circumstances. - -It is not the purpose of this section to induce you to infringe any patents or -other property right claims or to contest validity of any such claims; this -section has the sole purpose of protecting the integrity of the free software -distribution system, which is implemented by public license practices. Many -people have made generous contributions to the wide range of software -distributed through that system in reliance on consistent application of that -system; it is up to the author/donor to decide if he or she is willing to -distribute software through any other system and a licensee cannot impose that -choice. - -This section is intended to make thoroughly clear what is believed to be a -consequence of the rest of this License. - -8. If the distribution and/or use of the Program is restricted in certain -countries either by patents or by copyrighted interfaces, the original copyright -holder who places the Program under this License may add an explicit -geographical distribution limitation excluding those countries, so that -distribution is permitted only in or among countries not thus excluded. In such -case, this License incorporates the limitation as if written in the body of this -License. - -9. The Free Software Foundation may publish revised and/or new versions of the -General Public License from time to time. Such new versions will be similar in -spirit to the present version, but may differ in detail to address new problems -or concerns. - -Each version is given a distinguishing version number. If the Program specifies -a version number of this License which applies to it and "any later version", -you have the option of following the terms and conditions either of that version -or of any later version published by the Free Software Foundation. If the -Program does not specify a version number of this License, you may choose any -version ever published by the Free Software Foundation. - -10. If you wish to incorporate parts of the Program into other free programs -whose distribution conditions are different, write to the author to ask for -permission. For software which is copyrighted by the Free Software Foundation, -write to the Free Software Foundation; we sometimes make exceptions for this. -Our decision will be guided by the two goals of preserving the free status of -all derivatives of our free software and of promoting the sharing and reuse of -software generally. - -NO WARRANTY - -11. BECAUSE THE PROGRAM IS LICENSED FREE OF CHARGE, THERE IS NO WARRANTY FOR THE -PROGRAM, TO THE EXTENT PERMITTED BY APPLICABLE LAW. EXCEPT WHEN OTHERWISE STATED -IN WRITING THE COPYRIGHT HOLDERS AND/OR OTHER PARTIES PROVIDE THE PROGRAM "AS -IS" WITHOUT WARRANTY OF ANY KIND, EITHER EXPRESSED OR IMPLIED, INCLUDING, BUT -NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A -PARTICULAR PURPOSE. THE ENTIRE RISK AS TO THE QUALITY AND PERFORMANCE OF THE -PROGRAM IS WITH YOU. SHOULD THE PROGRAM PROVE DEFECTIVE, YOU ASSUME THE COST OF -ALL NECESSARY SERVICING, REPAIR OR CORRECTION. - -12. IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR AGREED TO IN WRITING WILL -ANY COPYRIGHT HOLDER, OR ANY OTHER PARTY WHO MAY MODIFY AND/OR REDISTRIBUTE THE -PROGRAM AS PERMITTED ABOVE, BE LIABLE TO YOU FOR DAMAGES, INCLUDING ANY GENERAL, -SPECIAL, INCIDENTAL OR CONSEQUENTIAL DAMAGES ARISING OUT OF THE USE OR INABILITY -TO USE THE PROGRAM (INCLUDING BUT NOT LIMITED TO LOSS OF DATA OR DATA BEING -RENDERED INACCURATE OR LOSSES SUSTAINED BY YOU OR THIRD PARTIES OR A FAILURE OF -THE PROGRAM TO OPERATE WITH ANY OTHER PROGRAMS), EVEN IF SUCH HOLDER OR OTHER -PARTY HAS BEEN ADVISED OF THE POSSIBILITY OF SUCH DAMAGES. -END OF TERMS AND CONDITIONS -How to Apply These Terms to Your New Programs - -If you develop a new program, and you want it to be of the greatest possible use -to the public, the best way to achieve this is to make it free software which -everyone can redistribute and change under these terms. - -To do so, attach the following notices to the program. It is safest to attach -them to the start of each source file to most effectively convey the exclusion -of warranty; and each file should have at least the "copyright" line and a -pointer to where the full notice is found. - -one line to give the program's name and an idea of what it does. -Copyright (C) yyyy name of author - -This program is free software; you can redistribute it and/or -modify it under the terms of the GNU General Public License -as published by the Free Software Foundation; either version 2 -of the License, or (at your option) any later version. - -This program is distributed in the hope that it will be useful, -but WITHOUT ANY WARRANTY; without even the implied warranty of -MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the -GNU General Public License for more details. - -You should have received a copy of the GNU General Public License -along with this program; if not, write to the Free Software -Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301, USA. - -Also add information on how to contact you by electronic and paper mail. - -If the program is interactive, make it output a short notice like this when it -starts in an interactive mode: - -Gnomovision version 69, Copyright (C) year name of author -Gnomovision comes with ABSOLUTELY NO WARRANTY; for details -type `show w'. This is free software, and you are welcome -to redistribute it under certain conditions; type `show c' -for details. - -The hypothetical commands `show w' and `show c' should show the appropriate -parts of the General Public License. Of course, the commands you use may be -called something other than `show w' and `show c'; they could even be -mouse-clicks or menu items--whatever suits your program. - -You should also get your employer (if you work as a programmer) or your school, -if any, to sign a "copyright disclaimer" for the program, if necessary. Here is -a sample; alter the names: - -Yoyodyne, Inc., hereby disclaims all copyright -interest in the program `Gnomovision' -(which makes passes at compilers) written -by James Hacker. - -signature of Ty Coon, 1 April 1989 -Ty Coon, President of Vice - -This General Public License does not permit incorporating your program into -proprietary programs. If your program is a subroutine library, you may consider -it more useful to permit linking proprietary applications with the library. If -this is what you want to do, use the GNU Lesser General Public License instead -of this License. - -Additional Documentation License(s) - -innochecksum.c is documented in the MySQL Reference -Manual at http://dev.mysql.com/doc/refman/5.1/en/innochecksum.html -The Reference Manual is not licensed under the GPL; rather, it -is offered under normal copyright, but with permission to -copy/redistribute electronically. - -*************************************************************************** - -%%The following software may be included in this product: -lib_sql.cc - -Use of any of this software is governed by the terms of the license below: - -/* - * Copyright (c) 2000 - * SWsoft company - * - * This material is provided "as is", with absolutely no warranty expressed - * or implied. Any use is at your own risk. - * - * Permission to use or copy this software for any purpose is hereby granted - * without fee, provided the above notices are retained on all copies. - * Permission to modify the code and to distribute modified code is granted, - * provided the above notices are retained, and a notice that the code was - * modified is included with the above copyright notice. - * - - This code was modified by the MySQL team -*/ - -*************************************************************************** - -%%The following software may be included in this product: -libevent - -Use of any of this software is governed by the terms of the license below: - -/* - * Copyright (c) 2000-2004 Niels Provos - * All rights reserved. - * - * Redistribution and use in source and binary forms, with or without - * modification, are permitted provided that the following conditions - * are met: - * 1. Redistributions of source code must retain the above copyright - * notice, this list of conditions and the following disclaimer. - * 2. Redistributions in binary form must reproduce the above copyright - * notice, this list of conditions and the following disclaimer in the - * documentation and/or other materials provided with the distribution. - * 3. The name of the author may not be used to endorse or promote products - * derived from this software without specific prior written permission. - * - * THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR - * IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES - * OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. - * IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, - * INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT - * NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, - * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY - * THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT - * (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF - * THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. - */ - -Additional License(s) - -http://creativecommons.org/licenses/publicdomain - -*************************************************************************** - -%%The following software may be included in this product: -Async DNS Library - -Use of any of this software is governed by the terms of the license below: - -/* Async DNS Library - * Adam Langley - * http://www.imperialviolet.org/eventdns.html - * Public Domain code - * - * This software is Public Domain. To view a copy of the public domain dedication, - * visit http://creativecommons.org/licenses/publicdomain/ or send a letter to - * Creative Commons, 559 Nathan Abbott Way, Stanford, California 94305, USA. - * - * I ask and expect, but do not require, that all derivative works contain an - * attribution similar to: - * Parts developed by Adam Langley - * - * You may wish to replace the word "Parts" with something else depending on - * the amount of original code. - * - * (Derivative works does not include programs which link against, run or include - * the source verbatim in their source distributions) - * - * Version: 0.1b - */ - -*************************************************************************** - -%%The following software may be included in this product: -log.c - -Use of any of this software is governed by the terms of the license below: - -/* $OpenBSD: err.c,v 1.2 2002/06/25 15:50:15 mickey Exp $ */ - -/* - * log.c - * - * Based on err.c, which was adapted from OpenBSD libc *err* *warn* code. - * - * Copyright (c) 2005 Nick Mathewson - * - * Copyright (c) 2000 Dug Song - * - * Copyright (c) 1993 - * The Regents of the University of California. All rights -reserved. - * - * Redistribution and use in source and binary forms, with or without - * modification, are permitted provided that the following conditions - * are met: - * 1. Redistributions of source code must retain the above copyright - * notice, this list of conditions and the following disclaimer. - * 2. Redistributions in binary form must reproduce the above copyright - * notice, this list of conditions and the following disclaimer in the - * documentation and/or other materials provided with the distribution. - * 3. Neither the name of the University nor the names of its contributors - * may be used to endorse or promote products derived from this software - * without specific prior written permission. - * - * THIS SOFTWARE IS PROVIDED BY THE REGENTS AND CONTRIBUTORS ``AS IS'' AND - * ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE - * IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE - * ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE LIABLE - * FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL - * DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS - * OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) - * HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT - * LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY - * OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF - * SUCH DAMAGE. - */ - -*************************************************************************** - -%%The following software may be included in this product: -min_heap.h - -Use of any of this software is governed by the terms of the license below: - -/* - * Copyright (c) 2006 Maxim Yegorushkin - * All rights reserved. - * - * Redistribution and use in source and binary forms, with or without - * modification, are permitted provided that the following conditions - * are met: - * 1. Redistributions of source code must retain the above copyright - * notice, this list of conditions and the following disclaimer. - * 2. Redistributions in binary form must reproduce the above copyright - * notice, this list of conditions and the following disclaimer in the - * documentation and/or other materials provided with the distribution. - * 3. The name of the author may not be used to endorse or promote products - * derived from this software without specific prior written permission. - * - * THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR - * IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES - * OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. - * IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, - * INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT - * NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, - * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY - * THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT - * (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF - * THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. - */ - -*************************************************************************** - -%%The following software may be included in this product: -win32.c - -Use of any of this software is governed by the terms of the license below: - -/* - * Copyright 2000-2002 Niels Provos - * Copyright 2003 Michael A. Davis - * All rights reserved. - * - * Redistribution and use in source and binary forms, with or without - * modification, are permitted provided that the following conditions - * are met: - * 1. Redistributions of source code must retain the above copyright - * notice, this list of conditions and the following disclaimer. - * 2. Redistributions in binary form must reproduce the above copyright - * notice, this list of conditions and the following disclaimer in the - * documentation and/or other materials provided with the distribution. - * 3. The name of the author may not be used to endorse or promote products - * derived from this software without specific prior written permission. - * - * THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR - * IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES - * OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. - * IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, - * INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT - * NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, - * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY - * THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT - * (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF - * THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. - */ - -*************************************************************************** - -%%The following software may be included in this product: -regex++ - -Use of any of this software is governed by the terms of the license below: - -Copyright 1992, 1993, 1994 Henry Spencer. All rights reserved. -This software is not subject to any license of the American Telephone -and Telegraph Company or of the Regents of the University of California. - -Permission is granted to anyone to use this software for any purpose on -any computer system, and to alter it and redistribute it, subject -to the following restrictions: - -1. The author is not responsible for the consequences of use of this - software, no matter how awful, even if they arise from flaws in it. - -2. The origin of this software must not be misrepresented, either by - explicit claim or by omission. Since few users ever read sources, - credits must appear in the documentation. - -3. Altered versions must be plainly marked as such, and must not be - misrepresented as being the original software. Since few users - ever read sources, credits must appear in the documentation. - -4. This notice may not be removed or altered. - -=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-= -/*- - * Copyright (c) 1994 - * The Regents of the University of California. All rights reserved. - * - * Redistribution and use in source and binary forms, with or without - * modification, are permitted provided that the following conditions - * are met: - * 1. Redistributions of source code must retain the above copyright - * notice, this list of conditions and the following disclaimer. - * 2. Redistributions in binary form must reproduce the above copyright - * notice, this list of conditions and the following disclaimer in the - * documentation and/or other materials provided with the distribution. - * 3. All advertising materials mentioning features or use of this software - * must display the following acknowledgement: - * This product includes software developed by the University of - * California, Berkeley and its contributors. - * 4. Neither the name of the University nor the names of its contributors - * may be used to endorse or promote products derived from this software - * without specific prior written permission. - * - * THIS SOFTWARE IS PROVIDED BY THE REGENTS AND CONTRIBUTORS ``AS IS'' AND - * ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE - * IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE - * ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE LIABLE - * FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL - * DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS - * OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) - * HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT - * LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY - * OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF - * SUCH DAMAGE. - * - * @(#)COPYRIGHT 8.1 (Berkeley) 3/16/94 - */ - -*************************************************************************** - -%%The following software may be included in this product: -Richard A. O'Keefe strings package - -Use of any of this software is governed by the terms of the license below: - -These files are in the public domain. This includes getopt.c, which -is the work of Henry Spencer, University of Toronto Zoology, who says of -it "None of this software is derived from Bell software. I had no access -to the source for Bell's versions at the time I wrote it. This software -is hereby explicitly placed in the public domain. It may be used for -any purpose on any machine by anyone." I would greatly prefer it if *my* -material received no military use. - -*************************************************************************** - -%%The following software may be included in this product: -t_ctype.h - -Use of any of this software is governed by the terms of the license below: - -http://bioinfo.mbb.yale.edu/genome/yeast/cluster/database/mysql/include/t_ctype.h - -/* - Copyright (C) 1998, 1999 by Pruet Boonma, all rights reserved. - Copyright (C) 1998 by Theppitak Karoonboonyanan, all rights reserved. - Permission to use, copy, modify, distribute and sell this software - and its documentation for any purpose is hereby granted without fee, - provided that the above copyright notice appear in all copies. - Smaphan Raruenrom and Pruet Boonma makes no representations about - the suitability of this software for any purpose. It is provided - "as is" without express or implied warranty. -*/ - -*************************************************************************** - -%%The following software may be included in this product: -SHA-1 in C - -Use of any of this software is governed by the terms of the license below: - - SHA-1 in C - By Steve Reid - 100% Public Domain - -Additional License(s) - -100% Public Domain - -*************************************************************************** - -%%The following software may be included in this product: -TCMalloc (part of google-perftools) - -Use of any of this software is governed by the terms of the license below: - -# Copyright (c) 1998-2006, Google Inc. -# All rights reserved. -# -# Redistribution and use in source and binary forms, with or without -# modification, are permitted provided that the following conditions are -# met: -# -# * Redistributions of source code must retain the above copyright -# notice, this list of conditions and the following disclaimer. -# * Redistributions in binary form must reproduce the above -# copyright notice, this list of conditions and the following disclaimer -# in the documentation and/or other materials provided with the -# distribution. -# * Neither the name of Google Inc. nor the names of its -# contributors may be used to endorse or promote products derived from -# this software without specific prior written permission. -# -# THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS -# "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT -# LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR -# A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT -# OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, -# SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT -# LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, -# DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY -# THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT -# (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE -# OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. - -Additional License(s) - -*** File src/tests/ptmalloc/thread-m.h contains this GPLv2 (or later) -text: - -/* Basic platform-independent macro definitions for mutexes and - thread-specific data. - Copyright (C) 1996, 1997, 1998 Free Software Foundation, Inc. - This file is part of the GNU C Library. - Contributed by Wolfram Gloger , 1996. - - The GNU C Library is free software; you can redistribute it and/or - modify it under the terms of the GNU Library General Public License as - published by the Free Software Foundation; either version 2 of the - License, or (at your option) any later version. - - The GNU C Library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Library General Public License for more details. - - You should have received a copy of the GNU Library General Public - License along with the GNU C Library; see the file COPYING.LIB. If not, - write to the Free Software Foundation, Inc., 59 Temple Place - Suite - 330, Boston, MA 02111-1307, USA. */ - - - -*** File src/tests/ptmalloc/malloc-machine.h contains this BSD like text: - -/* Basic platform-independent macro definitions for mutexes, - thread-specific data and parameters for malloc. - Posix threads (pthreads) version. - Copyright (C) 2004 Wolfram Gloger . - -Permission to use, copy, modify, distribute, and sell this software -and its documentation for any purpose is hereby granted without fee, -provided that (i) the above copyright notices and this permission -notice appear in all copies of the software and related documentation, -and (ii) the name of Wolfram Gloger may not be used in any advertising -or publicity relating to the software. - -THE SOFTWARE IS PROVIDED "AS-IS" AND WITHOUT WARRANTY OF ANY KIND, -EXPRESS, IMPLIED OR OTHERWISE, INCLUDING WITHOUT LIMITATION, ANY -WARRANTY OF MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE. - -IN NO EVENT SHALL WOLFRAM GLOGER BE LIABLE FOR ANY SPECIAL, -INCIDENTAL, INDIRECT OR CONSEQUENTIAL DAMAGES OF ANY KIND, OR ANY -DAMAGES WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, -WHETHER OR NOT ADVISED OF THE POSSIBILITY OF DAMAGE, AND ON ANY THEORY -OF LIABILITY, ARISING OUT OF OR IN CONNECTION WITH THE USE OR -PERFORMANCE OF THIS SOFTWARE. -*/ - -*************************************************************************** - -%%The following software may be included in this product: -The tz database - -Use of any of this software is governed by the terms of the license below: - -Sources for Time Zone and Daylight Saving Time Data -@(#)tz-link.htm 7.54 - -Please send corrections to this web page to the time zone mailing list. -The tz database - -The public-domain time zone database contains code and data that represent the -history of local time for many representative locations around the globe. It is -updated periodically to reflect changes made by political bodies to time zone -boundaries, UTC offsets, and daylight-saving rules. This database (often called -tz or zoneinfo) is used by several implementations, including the GNU C Library -used in GNU/Linux, FreeBSD, NetBSD, OpenBSD, Cygwin, DJGPP, HP-UX, IRIX, Mac OS -X, OpenVMS, Solaris, Tru64, and UnixWare. - -Each location in the database represents a national region where all clocks -keeping local time have agreed since 1970. Locations are identified by continent -or ocean and then by the name of the location, which is typically the largest -city within the region. For example, America/New_York represents most of the US -eastern time zone; America/Phoenix represents most of Arizona, which uses -mountain time without daylight saving time (DST); America/Detroit represents -most of Michigan, which uses eastern time but with different DST rules in 1975; -and other entries represent smaller regions like Starke County, Indiana, which -switched from central to eastern time in 1991 and switched back in 2006. To use -the database on an extended POSIX implementation set the TZ environment variable -to the location's full name, e.g., TZ="America/New_York". - -In the tz database's FTP distribution the code is in the file tzcodeC.tar.gz, -where C is the code's version; similarly, the data are in tzdataD.tar.gz, where -D is the data's version. The following shell commands download these files to a -GNU/Linux or similar host; see the downloaded README file for what to do next. - -wget 'ftp://elsie.nci.nih.gov/pub/tz*.tar.gz' -gzip -dc tzcode*.tar.gz | tar -xf - -gzip -dc tzdata*.tar.gz | tar -xf - - -The code lets you compile the tz source files into machine-readable binary -files, one for each location. It also lets you read a tz binary file and -interpret time stamps for that location. - -The data are by no means authoritative. If you find errors, please send changes -to the time zone mailing list. You can also subscribe to the mailing list, -retrieve the archive of old messages (in gzip compressed format), or retrieve -archived older versions of code and data; there is also a smaller HTTP mirror. - -*************************************************************************** - -%%The following software may be included in this product: -UnicodeData.txt - -Use of any of this software is governed by the terms of the license below: - -Unicode Terms of Use - - For the general privacy policy governing access to this site, see the - Unicode Privacy Policy. For trademark usage, see the Unicode - Consortium (R) Trademarks and Logo Policy. - Notice to End User: Terms of Use - Carefully read the following legal agreement ("Agreement"). Use or - copying of the software and/or codes provided with this agreement (The - "Software") constitutes your acceptance of these terms - - 1. Unicode Copyright. - 1. Copyright (c) 1991-2008 Unicode, Inc. All rights reserved. - 2. Certain documents and files on this website contain a - legend indicating that "Modification is permitted." Any person - is hereby authorized, without fee, to modify such documents - and files to create derivative works conforming to the - Unicode (R) Standard, subject to Terms and Conditions herein. - 3. Any person is hereby authorized, without fee, to view, use, - reproduce, and distribute all documents and files solely for - informational purposes in the creation of products supporting - the Unicode Standard, subject to the Terms and Conditions - herein. - 4. Further specifications of rights and restrictions - pertaining to the use of the particular set of data files - known as the "Unicode Character Database" can be found in - Exhibit 1. - 5. Each version of the Unicode Standard has further - specifications of rights and restrictions of use. For the book - editions, these are found on the back of the title page. For - the online edition, certain files (such as the PDF files for - book chapters and code charts) carry specific restrictions. - All other files are covered under these general Terms of Use. - To request a permission to reproduce any part of the Unicode - Standard, please contact the Unicode Consortium. - 6. No license is granted to "mirror" the Unicode website where - a fee is charged for access to the "mirror" site. - 7. Modification is not permitted with respect to this - document. All copies of this document must be verbatim. - 2. Restricted Rights Legend. Any technical data or software which is - licensed to the United States of America, its agencies and/or - instrumentalities under this Agreement is commercial technical data - or commercial computer software developed exclusively at private - expense as defined in FAR 2.101, or DFARS 252.227-7014 (June 1995), - as applicable. For technical data, use, duplication, or disclosure - by the Government is subject to restrictions as set forth in DFARS - 202.227-7015 Technical Data, Commercial and Items (Nov 1995) and - this Agreement. For Software, in accordance with FAR 12-212 or DFARS - 227-7202, as applicable, use, duplication or disclosure by the - Government is subject to the restrictions set forth in this - Agreement. - 3. Warranties and Disclaimers. - 1. This publication and/or website may include technical or - typographical errors or other inaccuracies . Changes are - periodically added to the information herein; these changes - will be incorporated in new editions of the publication and/or - website. Unicode may make improvements and/or changes in the - product(s) and/or program(s) described in this publication - and/or website at any time. - 2. If this file has been purchased on magnetic or optical - media from Unicode, Inc. the sole and exclusive remedy for any - claim will be exchange of the defective media within ninety - (90) days of original purchase. - 3. EXCEPT AS PROVIDED IN SECTION C.2, THIS PUBLICATION AND/OR - SOFTWARE IS PROVIDED "AS IS" WITHOUT WARRANTY OF ANY KIND - EITHER EXPRESS, IMPLIED, OR STATUTORY, INCLUDING, BUT NOT - LIMITED TO, ANY WARRANTIES OF MERCHANTABILITY, FITNESS FOR A - PARTICULAR PURPOSE, OR NON-INFRINGEMENT. UNICODE AND ITS - LICENSORS ASSUME NO RESPONSIBILITY FOR ERRORS OR OMISSIONS IN - THIS PUBLICATION AND/OR SOFTWARE OR OTHER DOCUMENTS WHICH ARE - REFERENCED BY OR LINKED TO THIS PUBLICATION OR THE UNICODE - WEBSITE. - 4. Waiver of Damages. In no event shall Unicode or its licensors be - liable for any special, incidental, indirect or consequential - damages of any kind, or any damages whatsoever, whether or not - Unicode was advised of the possibility of the damage, including, - without limitation, those resulting from the following: loss of use, - data or profits, in connection with the use, modification or - distribution of this information or its derivatives. - 5. Trademarks. - 1. Unicode and the Unicode logo are registered trademarks of - Unicode, Inc. - 2. This site contains product names and corporate names of - other companies. All product names and company names and logos - mentioned herein are the trademarks or registered trademarks - of their respective owners. Other products and corporate names - mentioned herein which are trademarks of a third party are - used only for explanation and for the owners' benefit and with - no intent to infringe. - 3. Use of third party products or information referred to - herein is at the user's risk. - 6. Miscellaneous. - 1. Jurisdiction and Venue. This server is operated from a - location in the State of California, United States of America. - Unicode makes no representation that the materials are - appropriate for use in other locations. If you access this - server from other locations, you are responsible for - compliance with local laws. This Agreement, all use of this - site and any claims and damages resulting from use of this - site are governed solely by the laws of the State of - California without regard to any principles which would apply - the laws of a different jurisdiction. The user agrees that any - disputes regarding this site shall be resolved solely in the - courts located in Santa Clara County, California. The user - agrees said courts have personal jurisdiction and agree to - waive any right to transfer the dispute to any other forum. - 2. Modification by Unicode Unicode shall have the right to - modify this Agreement at any time by posting it to this site. - The user may not assign any part of this Agreement without - Unicode's prior written consent. - 3. Taxes. The user agrees to pay any taxes arising from access - to this website or use of the information herein, except for - those based on Unicode's net income. - 4. Severability. If any provision of this Agreement is - declared invalid or unenforceable, the remaining provisions of - this Agreement shall remain in effect. - 5. Entire Agreement. This Agreement constitutes the entire - agreement between the parties. - -EXHIBIT 1 -UNICODE, INC. LICENSE AGREEMENT - DATA FILES AND SOFTWARE - - Unicode Data Files include all data files under the directories -http://www.unicode.org/Public/, http://www.unicode.org/reports/, and -http://www.unicode.org/cldr/data/ . Unicode Software includes any source code -published in the Unicode Standard or under the directories -http://www.unicode.org/Public/, http://www.unicode.org/reports/, and -http://www.unicode.org/cldr/data/. - - NOTICE TO USER: Carefully read the following legal agreement. BY -DOWNLOADING, INSTALLING, COPYING OR OTHERWISE USING UNICODE INC.'S DATA FILES -("DATA FILES"), AND/OR SOFTWARE ("SOFTWARE"), YOU UNEQUIVOCALLY ACCEPT, AND -AGREE TO BE BOUND BY, ALL OF THE TERMS AND CONDITIONS OF THIS AGREEMENT. IF YOU -DO NOT AGREE, DO NOT DOWNLOAD, INSTALL, COPY, DISTRIBUTE OR USE THE DATA FILES -OR SOFTWARE. - - COPYRIGHT AND PERMISSION NOTICE - - Copyright (c) 1991-2008 Unicode, Inc. All rights reserved. Distributed under -the Terms of Use in http://www.unicode.org/copyright.html. - - Permission is hereby granted, free of charge, to any person obtaining a copy -of the Unicode data files and any associated documentation (the "Data Files") or -Unicode software and any associated documentation (the "Software") to deal in -the Data Files or Software without restriction, including without limitation the -rights to use, copy, modify, merge, publish, distribute, and/or sell copies of -the Data Files or Software, and to permit persons to whom the Data Files or -Software are furnished to do so, provided that (a) the above copyright notice(s) -and this permission notice appear with all copies of the Data Files or Software, -(b) both the above copyright notice(s) and this permission notice appear in -associated documentation, and (c) there is clear notice in each modified Data -File or in the Software as well as in the documentation associated with the Data -File(s) or Software that the data or software has been modified. - - THE DATA FILES AND SOFTWARE ARE PROVIDED "AS IS", WITHOUT WARRANTY OF ANY -KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF -MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT OF THIRD -PARTY RIGHTS. IN NO EVENT SHALL THE COPYRIGHT HOLDER OR HOLDERS INCLUDED IN THIS -NOTICE BE LIABLE FOR ANY CLAIM, OR ANY SPECIAL INDIRECT OR CONSEQUENTIAL -DAMAGES, OR ANY DAMAGES WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, -WHETHER IN AN ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING -OUT OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THE DATA FILES OR SOFTWARE. - - Except as contained in this notice, the name of a copyright holder shall not -be used in advertising or otherwise to promote the sale, use or other dealings -in these Data Files or Software without prior written authorization of the -copyright holder. - - Unicode and the Unicode logo are trademarks of Unicode, Inc., and may be -registered in some jurisdictions. All other trademarks and registered trademarks -mentioned herein are the property of their respective owners. - -*************************************************************************** - -%%The following software may be included in this product: -zlib - -Use of any of this software is governed by the terms of the license below: - -/* zlib.h -- interface of the 'zlib' general purpose compression library - version 1.2.3, July 18th, 2005 - - Copyright (C) 1995-2005 Jean-loup Gailly and Mark Adler - - This software is provided 'as-is', without any express or implied - warranty. In no event will the authors be held liable for any damages - arising from the use of this software. - - Permission is granted to anyone to use this software for any purpose, - including commercial applications, and to alter it and redistribute it - freely, subject to the following restrictions: - - 1. The origin of this software must not be misrepresented; you must not - claim that you wrote the original software. If you use this software - in a product, an acknowledgment in the product documentation would be - appreciated but is not required. - 2. Altered source versions must be plainly marked as such, and must not be - misrepresented as being the original software. - 3. This notice may not be removed or altered from any source distribution. - - Jean-loup Gailly jloup@gzip.org - Mark Adler madler@alumni.caltech.edu - -*/ - -*************************************************************************** - -%%The following software may be included in this product: -dtoa.c - -Use of any of this software is governed by the terms of the license below: - -/**************************************************************** - - This file incorporates work covered by the following copyright and - permission notice: - - The author of this software is David M. Gay. - - Copyright (c) 1991, 2000, 2001 by Lucent Technologies. - - Permission to use, copy, modify, and distribute this software for any - purpose without fee is hereby granted, provided that this entire - notice is included in all copies of any software which is or includes a copy - or modification of this software and in all copies of the supporting - documentation for such software. - - THIS SOFTWARE IS BEING PROVIDED "AS IS", WITHOUT ANY EXPRESS OR IMPLIED - WARRANTY. IN PARTICULAR, NEITHER THE AUTHOR NOR LUCENT MAKES ANY - REPRESENTATION OR WARRANTY OF ANY KIND CONCERNING THE MERCHANTABILITY - OF THIS SOFTWARE OR ITS FITNESS FOR ANY PARTICULAR PURPOSE. - - ***************************************************************/ - -*************************************************************************** - -%%The following software may be included in this product: -getarg.{c,h} - -Use of any of this software is governed by the terms of the license below: - -/* Copyright (C) 2003 MySQL AB - - This program is free software; you can redistribute it and/or modify - it under the terms of the GNU General Public License as published by - the Free Software Foundation; version 2 of the License. - - This program is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the - GNU General Public License for more details. - - You should have received a copy of the GNU General Public License - along with this program; if not, write to the Free Software - Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA */ - -/* - * Copyright (c) 1997, 1999 Kungliga Tekniska H366gskolan - * (Royal Institute of Technology, Stockholm, Sweden). - * All rights reserved. - * - * Redistribution and use in source and binary forms, with or without - * modification, are permitted provided that the following conditions - * are met: - * - * 1. Redistributions of source code must retain the above copyright - * notice, this list of conditions and the following disclaimer. - * - * 2. Redistributions in binary form must reproduce the above copyright - * notice, this list of conditions and the following disclaimer in the - * documentation and/or other materials provided with the distribution. - * - * 3. Neither the name of the Institute nor the names of its contributors - * may be used to endorse or promote products derived from this software - * without specific prior written permission. - * - * THIS SOFTWARE IS PROVIDED BY THE INSTITUTE AND CONTRIBUTORS ``AS IS'' AND - * ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE - * IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE - * ARE DISCLAIMED. IN NO EVENT SHALL THE INSTITUTE OR CONTRIBUTORS BE LIABLE - * FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL - * DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS - * OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) - * HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT - * LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY - * OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF - * SUCH DAMAGE. - */ - -*************************************************************************** - -%%The following software may be included in this product: -MD5 message-digest algorithm (md5_hash.cpp) - -Use of any of this software is governed by the terms of the license below: - -/* - * This code implements the MD5 message-digest algorithm. - * The algorithm is due to Ron Rivest. This code was - * written by Colin Plumb in 1993, no copyright is claimed. - * This code is in the public domain; do with it what you wish. - * - * Equivalent code is available from RSA Data Security, Inc. - * This code has been tested against that, and is equivalent, - * except that you don't need to include two pages of legalese - * with every copy. - * - * The code has been modified by Mikael Ronstroem to handle - * calculating a hash value of a key that is always a multiple - * of 4 bytes long. Word 0 of the calculated 4-word hash value - * is returned as the hash value. - */ - -*************************************************************************** - -%%The following software may be included in this product: -nt_servc.{cc,h} - -Use of any of this software is governed by the terms of the license below: - -/** - @file - - @brief - Windows NT Service class library. - - Copyright Abandoned 1998 Irena Pancirov - Irnet Snc - This file is public domain and comes with NO WARRANTY of any kind -*/ - -*************************************************************************** - -%%The following software may be included in this product: -GNU Readline - -Use of any of this software is governed by the terms of the license below: - -GNU GENERAL PUBLIC LICENSE - Version 2, June 1991 - - Copyright (C) 1989, 1991 Free Software Foundation, Inc., - 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - Everyone is permitted to copy and distribute verbatim copies - of this license document, but changing it is not allowed. - - Preamble - - The licenses for most software are designed to take away your -freedom to share and change it. By contrast, the GNU General Public -License is intended to guarantee your freedom to share and change free -software--to make sure the software is free for all its users. This -General Public License applies to most of the Free Software -Foundation's software and to any other program whose authors commit to -using it. (Some other Free Software Foundation software is covered by -the GNU Lesser General Public License instead.) You can apply it to -your programs, too. - - When we speak of free software, we are referring to freedom, not -price. Our General Public Licenses are designed to make sure that you -have the freedom to distribute copies of free software (and charge for -this service if you wish), that you receive source code or can get it -if you want it, that you can change the software or use pieces of it -in new free programs; and that you know you can do these things. - - To protect your rights, we need to make restrictions that forbid -anyone to deny you these rights or to ask you to surrender the rights. -These restrictions translate to certain responsibilities for you if you -distribute copies of the software, or if you modify it. - - For example, if you distribute copies of such a program, whether -gratis or for a fee, you must give the recipients all the rights that -you have. You must make sure that they, too, receive or can get the -source code. And you must show them these terms so they know their -rights. - - We protect your rights with two steps: (1) copyright the software, and -(2) offer you this license which gives you legal permission to copy, -distribute and/or modify the software. - - Also, for each author's protection and ours, we want to make certain -that everyone understands that there is no warranty for this free -software. If the software is modified by someone else and passed on, we -want its recipients to know that what they have is not the original, so -that any problems introduced by others will not reflect on the original -authors' reputations. - - Finally, any free program is threatened constantly by software -patents. We wish to avoid the danger that redistributors of a free -program will individually obtain patent licenses, in effect making the -program proprietary. To prevent this, we have made it clear that any -patent must be licensed for everyone's free use or not licensed at all. - - The precise terms and conditions for copying, distribution and -modification follow. - - GNU GENERAL PUBLIC LICENSE - TERMS AND CONDITIONS FOR COPYING, DISTRIBUTION AND MODIFICATION - - 0. This License applies to any program or other work which contains -a notice placed by the copyright holder saying it may be distributed -under the terms of this General Public License. The "Program", below, -refers to any such program or work, and a "work based on the Program" -means either the Program or any derivative work under copyright law: -that is to say, a work containing the Program or a portion of it, -either verbatim or with modifications and/or translated into another -language. (Hereinafter, translation is included without limitation in -the term "modification".) Each licensee is addressed as "you". - -Activities other than copying, distribution and modification are not -covered by this License; they are outside its scope. The act of -running the Program is not restricted, and the output from the Program -is covered only if its contents constitute a work based on the -Program (independent of having been made by running the Program). -Whether that is true depends on what the Program does. - - 1. You may copy and distribute verbatim copies of the Program's -source code as you receive it, in any medium, provided that you -conspicuously and appropriately publish on each copy an appropriate -copyright notice and disclaimer of warranty; keep intact all the -notices that refer to this License and to the absence of any warranty; -and give any other recipients of the Program a copy of this License -along with the Program. - -You may charge a fee for the physical act of transferring a copy, and -you may at your option offer warranty protection in exchange for a fee. - - 2. You may modify your copy or copies of the Program or any portion -of it, thus forming a work based on the Program, and copy and -distribute such modifications or work under the terms of Section 1 -above, provided that you also meet all of these conditions: - - a) You must cause the modified files to carry prominent notices - stating that you changed the files and the date of any change. - - b) You must cause any work that you distribute or publish, that in - whole or in part contains or is derived from the Program or any - part thereof, to be licensed as a whole at no charge to all third - parties under the terms of this License. - - c) If the modified program normally reads commands interactively - when run, you must cause it, when started running for such - interactive use in the most ordinary way, to print or display an - announcement including an appropriate copyright notice and a - notice that there is no warranty (or else, saying that you provide - a warranty) and that users may redistribute the program under - these conditions, and telling the user how to view a copy of this - License. (Exception: if the Program itself is interactive but - does not normally print such an announcement, your work based on - the Program is not required to print an announcement.) - -These requirements apply to the modified work as a whole. If -identifiable sections of that work are not derived from the Program, -and can be reasonably considered independent and separate works in -themselves, then this License, and its terms, do not apply to those -sections when you distribute them as separate works. But when you -distribute the same sections as part of a whole which is a work based -on the Program, the distribution of the whole must be on the terms of -this License, whose permissions for other licensees extend to the -entire whole, and thus to each and every part regardless of who wrote it. - -Thus, it is not the intent of this section to claim rights or contest -your rights to work written entirely by you; rather, the intent is to -exercise the right to control the distribution of derivative or -collective works based on the Program. - -In addition, mere aggregation of another work not based on the Program -with the Program (or with a work based on the Program) on a volume of -a storage or distribution medium does not bring the other work under -the scope of this License. - - 3. You may copy and distribute the Program (or a work based on it, -under Section 2) in object code or executable form under the terms of -Sections 1 and 2 above provided that you also do one of the following: - - a) Accompany it with the complete corresponding machine-readable - source code, which must be distributed under the terms of Sections - 1 and 2 above on a medium customarily used for software interchange; or, - - b) Accompany it with a written offer, valid for at least three - years, to give any third party, for a charge no more than your - cost of physically performing source distribution, a complete - machine-readable copy of the corresponding source code, to be - distributed under the terms of Sections 1 and 2 above on a medium - customarily used for software interchange; or, - - c) Accompany it with the information you received as to the offer - to distribute corresponding source code. (This alternative is - allowed only for noncommercial distribution and only if you - received the program in object code or executable form with such - an offer, in accord with Subsection b above.) - -The source code for a work means the preferred form of the work for -making modifications to it. For an executable work, complete source -code means all the source code for all modules it contains, plus any -associated interface definition files, plus the scripts used to -control compilation and installation of the executable. However, as a -special exception, the source code distributed need not include -anything that is normally distributed (in either source or binary -form) with the major components (compiler, kernel, and so on) of the -operating system on which the executable runs, unless that component -itself accompanies the executable. - -If distribution of executable or object code is made by offering -access to copy from a designated place, then offering equivalent -access to copy the source code from the same place counts as -distribution of the source code, even though third parties are not -compelled to copy the source along with the object code. - - 4. You may not copy, modify, sublicense, or distribute the Program -except as expressly provided under this License. Any attempt -otherwise to copy, modify, sublicense or distribute the Program is -void, and will automatically terminate your rights under this License. -However, parties who have received copies, or rights, from you under -this License will not have their licenses terminated so long as such -parties remain in full compliance. - - 5. You are not required to accept this License, since you have not -signed it. However, nothing else grants you permission to modify or -distribute the Program or its derivative works. These actions are -prohibited by law if you do not accept this License. Therefore, by -modifying or distributing the Program (or any work based on the -Program), you indicate your acceptance of this License to do so, and -all its terms and conditions for copying, distributing or modifying -the Program or works based on it. - - 6. Each time you redistribute the Program (or any work based on the -Program), the recipient automatically receives a license from the -original licensor to copy, distribute or modify the Program subject to -these terms and conditions. You may not impose any further -restrictions on the recipients' exercise of the rights granted herein. -You are not responsible for enforcing compliance by third parties to -this License. - - 7. If, as a consequence of a court judgment or allegation of patent -infringement or for any other reason (not limited to patent issues), -conditions are imposed on you (whether by court order, agreement or -otherwise) that contradict the conditions of this License, they do not -excuse you from the conditions of this License. If you cannot -distribute so as to satisfy simultaneously your obligations under this -License and any other pertinent obligations, then as a consequence you -may not distribute the Program at all. For example, if a patent -license would not permit royalty-free redistribution of the Program by -all those who receive copies directly or indirectly through you, then -the only way you could satisfy both it and this License would be to -refrain entirely from distribution of the Program. - -If any portion of this section is held invalid or unenforceable under -any particular circumstance, the balance of the section is intended to -apply and the section as a whole is intended to apply in other -circumstances. - -It is not the purpose of this section to induce you to infringe any -patents or other property right claims or to contest validity of any -such claims; this section has the sole purpose of protecting the -integrity of the free software distribution system, which is -implemented by public license practices. Many people have made -generous contributions to the wide range of software distributed -through that system in reliance on consistent application of that -system; it is up to the author/donor to decide if he or she is willing -to distribute software through any other system and a licensee cannot -impose that choice. - -This section is intended to make thoroughly clear what is believed to -be a consequence of the rest of this License. - - 8. If the distribution and/or use of the Program is restricted in -certain countries either by patents or by copyrighted interfaces, the -original copyright holder who places the Program under this License -may add an explicit geographical distribution limitation excluding -those countries, so that distribution is permitted only in or among -countries not thus excluded. In such case, this License incorporates -the limitation as if written in the body of this License. - - 9. The Free Software Foundation may publish revised and/or new versions -of the General Public License from time to time. Such new versions will -be similar in spirit to the present version, but may differ in detail to -address new problems or concerns. - -Each version is given a distinguishing version number. If the Program -specifies a version number of this License which applies to it and "any -later version", you have the option of following the terms and conditions -either of that version or of any later version published by the Free -Software Foundation. If the Program does not specify a version number of -this License, you may choose any version ever published by the Free Software -Foundation. - - 10. If you wish to incorporate parts of the Program into other free -programs whose distribution conditions are different, write to the author -to ask for permission. For software which is copyrighted by the Free -Software Foundation, write to the Free Software Foundation; we sometimes -make exceptions for this. Our decision will be guided by the two goals -of preserving the free status of all derivatives of our free software and -of promoting the sharing and reuse of software generally. - - NO WARRANTY - - 11. BECAUSE THE PROGRAM IS LICENSED FREE OF CHARGE, THERE IS NO WARRANTY -FOR THE PROGRAM, TO THE EXTENT PERMITTED BY APPLICABLE LAW. EXCEPT WHEN -OTHERWISE STATED IN WRITING THE COPYRIGHT HOLDERS AND/OR OTHER PARTIES -PROVIDE THE PROGRAM "AS IS" WITHOUT WARRANTY OF ANY KIND, EITHER EXPRESSED -OR IMPLIED, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF -MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. THE ENTIRE RISK AS -TO THE QUALITY AND PERFORMANCE OF THE PROGRAM IS WITH YOU. SHOULD THE -PROGRAM PROVE DEFECTIVE, YOU ASSUME THE COST OF ALL NECESSARY SERVICING, -REPAIR OR CORRECTION. - - 12. IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR AGREED TO IN WRITING -WILL ANY COPYRIGHT HOLDER, OR ANY OTHER PARTY WHO MAY MODIFY AND/OR -REDISTRIBUTE THE PROGRAM AS PERMITTED ABOVE, BE LIABLE TO YOU FOR DAMAGES, -INCLUDING ANY GENERAL, SPECIAL, INCIDENTAL OR CONSEQUENTIAL DAMAGES ARISING -OUT OF THE USE OR INABILITY TO USE THE PROGRAM (INCLUDING BUT NOT LIMITED -TO LOSS OF DATA OR DATA BEING RENDERED INACCURATE OR LOSSES SUSTAINED BY -YOU OR THIRD PARTIES OR A FAILURE OF THE PROGRAM TO OPERATE WITH ANY OTHER -PROGRAMS), EVEN IF SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE -POSSIBILITY OF SUCH DAMAGES. - - END OF TERMS AND CONDITIONS - - How to Apply These Terms to Your New Programs - - If you develop a new program, and you want it to be of the greatest -possible use to the public, the best way to achieve this is to make it -free software which everyone can redistribute and change under these terms. - - To do so, attach the following notices to the program. It is safest -to attach them to the start of each source file to most effectively -convey the exclusion of warranty; and each file should have at least -the "copyright" line and a pointer to where the full notice is found. - - - Copyright (C) - - This program is free software; you can redistribute it and/or modify - it under the terms of the GNU General Public License as published by - the Free Software Foundation; either version 2 of the License, or - (at your option) any later version. - - This program is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the - GNU General Public License for more details. - - You should have received a copy of the GNU General Public License along - with this program; if not, write to the Free Software Foundation, Inc., - 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA. - -Also add information on how to contact you by electronic and paper mail. - -If the program is interactive, make it output a short notice like this -when it starts in an interactive mode: - - Gnomovision version 69, Copyright (C) year name of author - Gnomovision comes with ABSOLUTELY NO WARRANTY; for details type `show w'. - This is free software, and you are welcome to redistribute it - under certain conditions; type `show c' for details. - -The hypothetical commands `show w' and `show c' should show the appropriate -parts of the General Public License. Of course, the commands you use may -be called something other than `show w' and `show c'; they could even be -mouse-clicks or menu items--whatever suits your program. - -You should also get your employer (if you work as a programmer) or your -school, if any, to sign a "copyright disclaimer" for the program, if -necessary. Here is a sample; alter the names: - - Yoyodyne, Inc., hereby disclaims all copyright interest in the program - `Gnomovision' (which makes passes at compilers) written by James Hacker. - - , 1 April 1989 - Ty Coon, President of Vice - -This General Public License does not permit incorporating your program into -proprietary programs. If your program is a subroutine library, you may -consider it more useful to permit linking proprietary applications with the -library. If this is what you want to do, use the GNU Lesser General -Public License instead of this License. - -*************************************************************************** - -%%The following software may be included in this product: -pstack (part of GNU Binutils) - -Use of any of this software is governed by the terms of the license below: - -pstack is comprised of various .c and .h files; all begin like this: - -/* bucomm.h -- binutils common include file. - Copyright (C) 1992, 93, 94, 95, 96, 1997 Free Software Foundation, Inc. - -This file is part of GNU Binutils. - -This program is free software; you can redistribute it and/or modify -it under the terms of the GNU General Public License as published by -the Free Software Foundation; either version 2 of the License, or -(at your option) any later version. - -This program is distributed in the hope that it will be useful, -but WITHOUT ANY WARRANTY; without even the implied warranty of -MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the -GNU General Public License for more details. - -You should have received a copy of the GNU General Public License -along with this program; if not, write to the Free Software -Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA -02111-1307, USA. */ - -*************************************************************************** - -%%The following software may be included in this product: -libiberty.h (part of pstack GNU Binutils) - -Use of any of this software is governed by the terms of the license below: - -See -http://www.koders.com/c/fid99F596804BBE22C076522B848D5575F142079064.aspx - -/* Function declarations for libiberty. - Written by Cygnus Support, 1994. - - The libiberty library provides a number of functions which are - missing on some operating systems. We do not declare those here, - to avoid conflicts with the system header files on operating - systems that do support those functions. In this file we only - declare those functions which are specific to libiberty. */ - -*************************************************************************** - -%%The following software may be included in this product: -ieee.h (part of pstack GNU Binutils) - -Use of any of this software is governed by the terms of the license below: - -See -http://src.opensolaris.org/source/xref//sfw/usr/src/cmd/gdb/gdb-6.3/include/ieee.h - - -/* IEEE Standard 695-1980 "Universal Format for Object Modules" - header file - Contributed by Cygnus Support. */ - -*************************************************************************** - -%%The following software may be included in this product: -pstack.c (part of pstack GNU Binutils) - -Use of any of this software is governed by the terms of the license below: - -/* - pstack.c -- asynchronous stack trace of a running process - Copyright (c) 1999 Ross Thompson - Author: Ross Thompson - Critical bug fix: Tim Waugh -*/ - -/* - This file is free software; you can redistribute it and/or modify - it under the terms of the GNU General Public License as published by - the Free Software Foundation; either version 2 of the License, or - (at your option) any later version. - - This program is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the - GNU General Public License for more details. - - You should have received a copy of the GNU General Public License - along with this program; if not, write to the Free Software - Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA. -*/ - -********************************************************************** From 99bf8c19916640d3a309f240d97c7b919d5432e1 Mon Sep 17 00:00:00 2001 From: Nirbhay Choubey Date: Thu, 17 Mar 2011 16:28:16 +0530 Subject: [PATCH 13/91] Minor fix in mysqldump test. --- mysql-test/r/mysqldump.result | 1 + mysql-test/t/mysqldump.test | 2 ++ 2 files changed, 3 insertions(+) diff --git a/mysql-test/r/mysqldump.result b/mysql-test/r/mysqldump.result index fb70e0f1731..a337c0384f6 100644 --- a/mysql-test/r/mysqldump.result +++ b/mysql-test/r/mysqldump.result @@ -4626,6 +4626,7 @@ DELIMITER ; /*!50003 SET collation_connection = @saved_col_connection */ ; ALTER DATABASE `test-database` CHARACTER SET utf8 COLLATE utf8_unicode_ci ; DROP DATABASE `test-database`; +USE `test`; # # End of 5.1 tests # diff --git a/mysql-test/t/mysqldump.test b/mysql-test/t/mysqldump.test index 0b533284ffa..8ecf8187ff9 100644 --- a/mysql-test/t/mysqldump.test +++ b/mysql-test/t/mysqldump.test @@ -2193,6 +2193,8 @@ ALTER DATABASE `test-database` CHARACTER SET utf8 COLLATE utf8_unicode_ci ; --exec $MYSQL_DUMP --quote-names --compact test-database DROP DATABASE `test-database`; +# Switching back to test database. +USE `test`; --echo # --echo # End of 5.1 tests From 8eae8e8d62f43af78f1fdd78bae50d71a4c6d10e Mon Sep 17 00:00:00 2001 From: Vinay Fisrekar Date: Fri, 18 Mar 2011 16:35:57 +0530 Subject: [PATCH 14/91] Bug#11766500 - 59624: FUNCS_1 SUITE TESTS FAILING WITH RESULT DIFFERENCE WHEN RUN USING EMBEDDED MODE Updating result files --- .../funcs_1/r/is_columns_is_embedded.result | 68 +++++++++---------- .../r/is_columns_myisam_embedded.result | 12 ++-- .../r/is_columns_mysql_embedded.result | 16 ++--- 3 files changed, 48 insertions(+), 48 deletions(-) diff --git a/mysql-test/suite/funcs_1/r/is_columns_is_embedded.result b/mysql-test/suite/funcs_1/r/is_columns_is_embedded.result index 59ad695c413..e64dc27078c 100644 --- a/mysql-test/suite/funcs_1/r/is_columns_is_embedded.result +++ b/mysql-test/suite/funcs_1/r/is_columns_is_embedded.result @@ -15,8 +15,8 @@ NULL information_schema COLLATIONS IS_DEFAULT 4 NO varchar 3 9 NULL NULL utf8 u NULL information_schema COLLATIONS SORTLEN 6 0 NO bigint NULL NULL 19 0 NULL NULL bigint(3) NULL information_schema COLLATION_CHARACTER_SET_APPLICABILITY CHARACTER_SET_NAME 2 NO varchar 32 96 NULL NULL utf8 utf8_general_ci varchar(32) NULL information_schema COLLATION_CHARACTER_SET_APPLICABILITY COLLATION_NAME 1 NO varchar 32 96 NULL NULL utf8 utf8_general_ci varchar(32) -NULL information_schema COLUMNS CHARACTER_MAXIMUM_LENGTH 9 NULL YES bigint NULL NULL 19 0 NULL NULL bigint(21) unsigned -NULL information_schema COLUMNS CHARACTER_OCTET_LENGTH 10 NULL YES bigint NULL NULL 19 0 NULL NULL bigint(21) unsigned +NULL information_schema COLUMNS CHARACTER_MAXIMUM_LENGTH 9 NULL YES bigint NULL NULL 20 0 NULL NULL bigint(21) unsigned +NULL information_schema COLUMNS CHARACTER_OCTET_LENGTH 10 NULL YES bigint NULL NULL 20 0 NULL NULL bigint(21) unsigned NULL information_schema COLUMNS CHARACTER_SET_NAME 13 NULL YES varchar 32 96 NULL NULL utf8 utf8_general_ci varchar(32) NULL information_schema COLUMNS COLLATION_NAME 14 NULL YES varchar 32 96 NULL NULL utf8 utf8_general_ci varchar(32) NULL information_schema COLUMNS COLUMN_COMMENT 19 NO varchar 255 765 NULL NULL utf8 utf8_general_ci varchar(255) @@ -27,9 +27,9 @@ NULL information_schema COLUMNS COLUMN_TYPE 15 NULL NO longtext 4294967295 42949 NULL information_schema COLUMNS DATA_TYPE 8 NO varchar 64 192 NULL NULL utf8 utf8_general_ci varchar(64) NULL information_schema COLUMNS EXTRA 17 NO varchar 27 81 NULL NULL utf8 utf8_general_ci varchar(27) NULL information_schema COLUMNS IS_NULLABLE 7 NO varchar 3 9 NULL NULL utf8 utf8_general_ci varchar(3) -NULL information_schema COLUMNS NUMERIC_PRECISION 11 NULL YES bigint NULL NULL 19 0 NULL NULL bigint(21) unsigned -NULL information_schema COLUMNS NUMERIC_SCALE 12 NULL YES bigint NULL NULL 19 0 NULL NULL bigint(21) unsigned -NULL information_schema COLUMNS ORDINAL_POSITION 5 0 NO bigint NULL NULL 19 0 NULL NULL bigint(21) unsigned +NULL information_schema COLUMNS NUMERIC_PRECISION 11 NULL YES bigint NULL NULL 20 0 NULL NULL bigint(21) unsigned +NULL information_schema COLUMNS NUMERIC_SCALE 12 NULL YES bigint NULL NULL 20 0 NULL NULL bigint(21) unsigned +NULL information_schema COLUMNS ORDINAL_POSITION 5 0 NO bigint NULL NULL 20 0 NULL NULL bigint(21) unsigned NULL information_schema COLUMNS PRIVILEGES 18 NO varchar 80 240 NULL NULL utf8 utf8_general_ci varchar(80) NULL information_schema COLUMNS TABLE_CATALOG 1 NULL YES varchar 512 1536 NULL NULL utf8 utf8_general_ci varchar(512) NULL information_schema COLUMNS TABLE_NAME 3 NO varchar 64 192 NULL NULL utf8 utf8_general_ci varchar(64) @@ -71,14 +71,14 @@ NULL information_schema EVENTS SQL_MODE 12 NO varchar 8192 24576 NULL NULL utf8 NULL information_schema EVENTS STARTS 13 NULL YES datetime NULL NULL NULL NULL NULL NULL datetime NULL information_schema EVENTS STATUS 15 NO varchar 18 54 NULL NULL utf8 utf8_general_ci varchar(18) NULL information_schema EVENTS TIME_ZONE 5 NO varchar 64 192 NULL NULL utf8 utf8_general_ci varchar(64) -NULL information_schema FILES AUTOEXTEND_SIZE 19 NULL YES bigint NULL NULL 19 0 NULL NULL bigint(21) unsigned -NULL information_schema FILES AVG_ROW_LENGTH 28 NULL YES bigint NULL NULL 19 0 NULL NULL bigint(21) unsigned -NULL information_schema FILES CHECKSUM 36 NULL YES bigint NULL NULL 19 0 NULL NULL bigint(21) unsigned +NULL information_schema FILES AUTOEXTEND_SIZE 19 NULL YES bigint NULL NULL 20 0 NULL NULL bigint(21) unsigned +NULL information_schema FILES AVG_ROW_LENGTH 28 NULL YES bigint NULL NULL 20 0 NULL NULL bigint(21) unsigned +NULL information_schema FILES CHECKSUM 36 NULL YES bigint NULL NULL 20 0 NULL NULL bigint(21) unsigned NULL information_schema FILES CHECK_TIME 35 NULL YES datetime NULL NULL NULL NULL NULL NULL datetime NULL information_schema FILES CREATE_TIME 33 NULL YES datetime NULL NULL NULL NULL NULL NULL datetime NULL information_schema FILES CREATION_TIME 20 NULL YES datetime NULL NULL NULL NULL NULL NULL datetime -NULL information_schema FILES DATA_FREE 32 NULL YES bigint NULL NULL 19 0 NULL NULL bigint(21) unsigned -NULL information_schema FILES DATA_LENGTH 29 NULL YES bigint NULL NULL 19 0 NULL NULL bigint(21) unsigned +NULL information_schema FILES DATA_FREE 32 NULL YES bigint NULL NULL 20 0 NULL NULL bigint(21) unsigned +NULL information_schema FILES DATA_LENGTH 29 NULL YES bigint NULL NULL 20 0 NULL NULL bigint(21) unsigned NULL information_schema FILES DELETED_ROWS 12 NULL YES bigint NULL NULL 19 0 NULL NULL bigint(4) NULL information_schema FILES ENGINE 10 NO varchar 64 192 NULL NULL utf8 utf8_general_ci varchar(64) NULL information_schema FILES EXTENT_SIZE 16 0 NO bigint NULL NULL 19 0 NULL NULL bigint(4) @@ -88,27 +88,27 @@ NULL information_schema FILES FILE_NAME 2 NULL YES varchar 64 192 NULL NULL utf8 NULL information_schema FILES FILE_TYPE 3 NO varchar 20 60 NULL NULL utf8 utf8_general_ci varchar(20) NULL information_schema FILES FREE_EXTENTS 14 NULL YES bigint NULL NULL 19 0 NULL NULL bigint(4) NULL information_schema FILES FULLTEXT_KEYS 11 NULL YES varchar 64 192 NULL NULL utf8 utf8_general_ci varchar(64) -NULL information_schema FILES INDEX_LENGTH 31 NULL YES bigint NULL NULL 19 0 NULL NULL bigint(21) unsigned -NULL information_schema FILES INITIAL_SIZE 17 NULL YES bigint NULL NULL 19 0 NULL NULL bigint(21) unsigned +NULL information_schema FILES INDEX_LENGTH 31 NULL YES bigint NULL NULL 20 0 NULL NULL bigint(21) unsigned +NULL information_schema FILES INITIAL_SIZE 17 NULL YES bigint NULL NULL 20 0 NULL NULL bigint(21) unsigned NULL information_schema FILES LAST_ACCESS_TIME 22 NULL YES datetime NULL NULL NULL NULL NULL NULL datetime NULL information_schema FILES LAST_UPDATE_TIME 21 NULL YES datetime NULL NULL NULL NULL NULL NULL datetime NULL information_schema FILES LOGFILE_GROUP_NAME 8 NULL YES varchar 64 192 NULL NULL utf8 utf8_general_ci varchar(64) NULL information_schema FILES LOGFILE_GROUP_NUMBER 9 NULL YES bigint NULL NULL 19 0 NULL NULL bigint(4) -NULL information_schema FILES MAXIMUM_SIZE 18 NULL YES bigint NULL NULL 19 0 NULL NULL bigint(21) unsigned -NULL information_schema FILES MAX_DATA_LENGTH 30 NULL YES bigint NULL NULL 19 0 NULL NULL bigint(21) unsigned +NULL information_schema FILES MAXIMUM_SIZE 18 NULL YES bigint NULL NULL 20 0 NULL NULL bigint(21) unsigned +NULL information_schema FILES MAX_DATA_LENGTH 30 NULL YES bigint NULL NULL 20 0 NULL NULL bigint(21) unsigned NULL information_schema FILES RECOVER_TIME 23 NULL YES bigint NULL NULL 19 0 NULL NULL bigint(4) NULL information_schema FILES ROW_FORMAT 26 NULL YES varchar 10 30 NULL NULL utf8 utf8_general_ci varchar(10) NULL information_schema FILES STATUS 37 NO varchar 20 60 NULL NULL utf8 utf8_general_ci varchar(20) NULL information_schema FILES TABLESPACE_NAME 4 NULL YES varchar 64 192 NULL NULL utf8 utf8_general_ci varchar(64) NULL information_schema FILES TABLE_CATALOG 5 NULL YES varchar 64 192 NULL NULL utf8 utf8_general_ci varchar(64) NULL information_schema FILES TABLE_NAME 7 NULL YES varchar 64 192 NULL NULL utf8 utf8_general_ci varchar(64) -NULL information_schema FILES TABLE_ROWS 27 NULL YES bigint NULL NULL 19 0 NULL NULL bigint(21) unsigned +NULL information_schema FILES TABLE_ROWS 27 NULL YES bigint NULL NULL 20 0 NULL NULL bigint(21) unsigned NULL information_schema FILES TABLE_SCHEMA 6 NULL YES varchar 64 192 NULL NULL utf8 utf8_general_ci varchar(64) NULL information_schema FILES TOTAL_EXTENTS 15 NULL YES bigint NULL NULL 19 0 NULL NULL bigint(4) NULL information_schema FILES TRANSACTION_COUNTER 24 NULL YES bigint NULL NULL 19 0 NULL NULL bigint(4) NULL information_schema FILES UPDATE_COUNT 13 NULL YES bigint NULL NULL 19 0 NULL NULL bigint(4) NULL information_schema FILES UPDATE_TIME 34 NULL YES datetime NULL NULL NULL NULL NULL NULL datetime -NULL information_schema FILES VERSION 25 NULL YES bigint NULL NULL 19 0 NULL NULL bigint(21) unsigned +NULL information_schema FILES VERSION 25 NULL YES bigint NULL NULL 20 0 NULL NULL bigint(21) unsigned NULL information_schema GLOBAL_STATUS VARIABLE_NAME 1 NO varchar 64 192 NULL NULL utf8 utf8_general_ci varchar(64) NULL information_schema GLOBAL_STATUS VARIABLE_VALUE 2 NULL YES varchar 1024 3072 NULL NULL utf8 utf8_general_ci varchar(1024) NULL information_schema GLOBAL_VARIABLES VARIABLE_NAME 1 NO varchar 64 192 NULL NULL utf8 utf8_general_ci varchar(64) @@ -125,29 +125,29 @@ NULL information_schema KEY_COLUMN_USAGE REFERENCED_TABLE_SCHEMA 10 NULL YES var NULL information_schema KEY_COLUMN_USAGE TABLE_CATALOG 4 NULL YES varchar 512 1536 NULL NULL utf8 utf8_general_ci varchar(512) NULL information_schema KEY_COLUMN_USAGE TABLE_NAME 6 NO varchar 64 192 NULL NULL utf8 utf8_general_ci varchar(64) NULL information_schema KEY_COLUMN_USAGE TABLE_SCHEMA 5 NO varchar 64 192 NULL NULL utf8 utf8_general_ci varchar(64) -NULL information_schema PARTITIONS AVG_ROW_LENGTH 14 0 NO bigint NULL NULL 19 0 NULL NULL bigint(21) unsigned -NULL information_schema PARTITIONS CHECKSUM 22 NULL YES bigint NULL NULL 19 0 NULL NULL bigint(21) unsigned +NULL information_schema PARTITIONS AVG_ROW_LENGTH 14 0 NO bigint NULL NULL 20 0 NULL NULL bigint(21) unsigned +NULL information_schema PARTITIONS CHECKSUM 22 NULL YES bigint NULL NULL 20 0 NULL NULL bigint(21) unsigned NULL information_schema PARTITIONS CHECK_TIME 21 NULL YES datetime NULL NULL NULL NULL NULL NULL datetime NULL information_schema PARTITIONS CREATE_TIME 19 NULL YES datetime NULL NULL NULL NULL NULL NULL datetime -NULL information_schema PARTITIONS DATA_FREE 18 0 NO bigint NULL NULL 19 0 NULL NULL bigint(21) unsigned -NULL information_schema PARTITIONS DATA_LENGTH 15 0 NO bigint NULL NULL 19 0 NULL NULL bigint(21) unsigned -NULL information_schema PARTITIONS INDEX_LENGTH 17 0 NO bigint NULL NULL 19 0 NULL NULL bigint(21) unsigned -NULL information_schema PARTITIONS MAX_DATA_LENGTH 16 NULL YES bigint NULL NULL 19 0 NULL NULL bigint(21) unsigned +NULL information_schema PARTITIONS DATA_FREE 18 0 NO bigint NULL NULL 20 0 NULL NULL bigint(21) unsigned +NULL information_schema PARTITIONS DATA_LENGTH 15 0 NO bigint NULL NULL 20 0 NULL NULL bigint(21) unsigned +NULL information_schema PARTITIONS INDEX_LENGTH 17 0 NO bigint NULL NULL 20 0 NULL NULL bigint(21) unsigned +NULL information_schema PARTITIONS MAX_DATA_LENGTH 16 NULL YES bigint NULL NULL 20 0 NULL NULL bigint(21) unsigned NULL information_schema PARTITIONS NODEGROUP 24 NO varchar 12 36 NULL NULL utf8 utf8_general_ci varchar(12) NULL information_schema PARTITIONS PARTITION_COMMENT 23 NO varchar 80 240 NULL NULL utf8 utf8_general_ci varchar(80) NULL information_schema PARTITIONS PARTITION_DESCRIPTION 12 NULL YES longtext 4294967295 4294967295 NULL NULL utf8 utf8_general_ci longtext NULL information_schema PARTITIONS PARTITION_EXPRESSION 10 NULL YES longtext 4294967295 4294967295 NULL NULL utf8 utf8_general_ci longtext NULL information_schema PARTITIONS PARTITION_METHOD 8 NULL YES varchar 12 36 NULL NULL utf8 utf8_general_ci varchar(12) NULL information_schema PARTITIONS PARTITION_NAME 4 NULL YES varchar 64 192 NULL NULL utf8 utf8_general_ci varchar(64) -NULL information_schema PARTITIONS PARTITION_ORDINAL_POSITION 6 NULL YES bigint NULL NULL 19 0 NULL NULL bigint(21) unsigned +NULL information_schema PARTITIONS PARTITION_ORDINAL_POSITION 6 NULL YES bigint NULL NULL 20 0 NULL NULL bigint(21) unsigned NULL information_schema PARTITIONS SUBPARTITION_EXPRESSION 11 NULL YES longtext 4294967295 4294967295 NULL NULL utf8 utf8_general_ci longtext NULL information_schema PARTITIONS SUBPARTITION_METHOD 9 NULL YES varchar 12 36 NULL NULL utf8 utf8_general_ci varchar(12) NULL information_schema PARTITIONS SUBPARTITION_NAME 5 NULL YES varchar 64 192 NULL NULL utf8 utf8_general_ci varchar(64) -NULL information_schema PARTITIONS SUBPARTITION_ORDINAL_POSITION 7 NULL YES bigint NULL NULL 19 0 NULL NULL bigint(21) unsigned +NULL information_schema PARTITIONS SUBPARTITION_ORDINAL_POSITION 7 NULL YES bigint NULL NULL 20 0 NULL NULL bigint(21) unsigned NULL information_schema PARTITIONS TABLESPACE_NAME 25 NULL YES varchar 64 192 NULL NULL utf8 utf8_general_ci varchar(64) NULL information_schema PARTITIONS TABLE_CATALOG 1 NULL YES varchar 512 1536 NULL NULL utf8 utf8_general_ci varchar(512) NULL information_schema PARTITIONS TABLE_NAME 3 NO varchar 64 192 NULL NULL utf8 utf8_general_ci varchar(64) -NULL information_schema PARTITIONS TABLE_ROWS 13 0 NO bigint NULL NULL 19 0 NULL NULL bigint(21) unsigned +NULL information_schema PARTITIONS TABLE_ROWS 13 0 NO bigint NULL NULL 20 0 NULL NULL bigint(21) unsigned NULL information_schema PARTITIONS TABLE_SCHEMA 2 NO varchar 64 192 NULL NULL utf8 utf8_general_ci varchar(64) NULL information_schema PARTITIONS UPDATE_TIME 20 NULL YES datetime NULL NULL NULL NULL NULL NULL datetime NULL information_schema PLUGINS PLUGIN_AUTHOR 8 NULL YES varchar 64 192 NULL NULL utf8 utf8_general_ci varchar(64) @@ -231,27 +231,27 @@ NULL information_schema STATISTICS SUB_PART 11 NULL YES bigint NULL NULL 19 0 NU NULL information_schema STATISTICS TABLE_CATALOG 1 NULL YES varchar 512 1536 NULL NULL utf8 utf8_general_ci varchar(512) NULL information_schema STATISTICS TABLE_NAME 3 NO varchar 64 192 NULL NULL utf8 utf8_general_ci varchar(64) NULL information_schema STATISTICS TABLE_SCHEMA 2 NO varchar 64 192 NULL NULL utf8 utf8_general_ci varchar(64) -NULL information_schema TABLES AUTO_INCREMENT 14 NULL YES bigint NULL NULL 19 0 NULL NULL bigint(21) unsigned -NULL information_schema TABLES AVG_ROW_LENGTH 9 NULL YES bigint NULL NULL 19 0 NULL NULL bigint(21) unsigned -NULL information_schema TABLES CHECKSUM 19 NULL YES bigint NULL NULL 19 0 NULL NULL bigint(21) unsigned +NULL information_schema TABLES AUTO_INCREMENT 14 NULL YES bigint NULL NULL 20 0 NULL NULL bigint(21) unsigned +NULL information_schema TABLES AVG_ROW_LENGTH 9 NULL YES bigint NULL NULL 20 0 NULL NULL bigint(21) unsigned +NULL information_schema TABLES CHECKSUM 19 NULL YES bigint NULL NULL 20 0 NULL NULL bigint(21) unsigned NULL information_schema TABLES CHECK_TIME 17 NULL YES datetime NULL NULL NULL NULL NULL NULL datetime NULL information_schema TABLES CREATE_OPTIONS 20 NULL YES varchar 255 765 NULL NULL utf8 utf8_general_ci varchar(255) NULL information_schema TABLES CREATE_TIME 15 NULL YES datetime NULL NULL NULL NULL NULL NULL datetime -NULL information_schema TABLES DATA_FREE 13 NULL YES bigint NULL NULL 19 0 NULL NULL bigint(21) unsigned -NULL information_schema TABLES DATA_LENGTH 10 NULL YES bigint NULL NULL 19 0 NULL NULL bigint(21) unsigned +NULL information_schema TABLES DATA_FREE 13 NULL YES bigint NULL NULL 20 0 NULL NULL bigint(21) unsigned +NULL information_schema TABLES DATA_LENGTH 10 NULL YES bigint NULL NULL 20 0 NULL NULL bigint(21) unsigned NULL information_schema TABLES ENGINE 5 NULL YES varchar 64 192 NULL NULL utf8 utf8_general_ci varchar(64) -NULL information_schema TABLES INDEX_LENGTH 12 NULL YES bigint NULL NULL 19 0 NULL NULL bigint(21) unsigned -NULL information_schema TABLES MAX_DATA_LENGTH 11 NULL YES bigint NULL NULL 19 0 NULL NULL bigint(21) unsigned +NULL information_schema TABLES INDEX_LENGTH 12 NULL YES bigint NULL NULL 20 0 NULL NULL bigint(21) unsigned +NULL information_schema TABLES MAX_DATA_LENGTH 11 NULL YES bigint NULL NULL 20 0 NULL NULL bigint(21) unsigned NULL information_schema TABLES ROW_FORMAT 7 NULL YES varchar 10 30 NULL NULL utf8 utf8_general_ci varchar(10) NULL information_schema TABLES TABLE_CATALOG 1 NULL YES varchar 512 1536 NULL NULL utf8 utf8_general_ci varchar(512) NULL information_schema TABLES TABLE_COLLATION 18 NULL YES varchar 32 96 NULL NULL utf8 utf8_general_ci varchar(32) NULL information_schema TABLES TABLE_COMMENT 21 NO varchar 80 240 NULL NULL utf8 utf8_general_ci varchar(80) NULL information_schema TABLES TABLE_NAME 3 NO varchar 64 192 NULL NULL utf8 utf8_general_ci varchar(64) -NULL information_schema TABLES TABLE_ROWS 8 NULL YES bigint NULL NULL 19 0 NULL NULL bigint(21) unsigned +NULL information_schema TABLES TABLE_ROWS 8 NULL YES bigint NULL NULL 20 0 NULL NULL bigint(21) unsigned NULL information_schema TABLES TABLE_SCHEMA 2 NO varchar 64 192 NULL NULL utf8 utf8_general_ci varchar(64) NULL information_schema TABLES TABLE_TYPE 4 NO varchar 64 192 NULL NULL utf8 utf8_general_ci varchar(64) NULL information_schema TABLES UPDATE_TIME 16 NULL YES datetime NULL NULL NULL NULL NULL NULL datetime -NULL information_schema TABLES VERSION 6 NULL YES bigint NULL NULL 19 0 NULL NULL bigint(21) unsigned +NULL information_schema TABLES VERSION 6 NULL YES bigint NULL NULL 20 0 NULL NULL bigint(21) unsigned NULL information_schema TABLE_CONSTRAINTS CONSTRAINT_CATALOG 1 NULL YES varchar 512 1536 NULL NULL utf8 utf8_general_ci varchar(512) NULL information_schema TABLE_CONSTRAINTS CONSTRAINT_NAME 3 NO varchar 64 192 NULL NULL utf8 utf8_general_ci varchar(64) NULL information_schema TABLE_CONSTRAINTS CONSTRAINT_SCHEMA 2 NO varchar 64 192 NULL NULL utf8 utf8_general_ci varchar(64) diff --git a/mysql-test/suite/funcs_1/r/is_columns_myisam_embedded.result b/mysql-test/suite/funcs_1/r/is_columns_myisam_embedded.result index 2721dcf3c6e..739f62e371a 100644 --- a/mysql-test/suite/funcs_1/r/is_columns_myisam_embedded.result +++ b/mysql-test/suite/funcs_1/r/is_columns_myisam_embedded.result @@ -479,9 +479,9 @@ NULL test tb1 f27 27 NULL YES int NULL NULL 10 0 NULL NULL int(10) unsigned zero NULL test tb1 f28 28 NULL YES int NULL NULL 10 0 NULL NULL int(10) unsigned zerofill NULL test tb1 f29 29 NULL YES bigint NULL NULL 19 0 NULL NULL bigint(20) NULL test tb1 f3 3 NULL YES char 1 1 NULL NULL latin1 latin1_swedish_ci char(1) -NULL test tb1 f30 30 NULL YES bigint NULL NULL 19 0 NULL NULL bigint(20) unsigned -NULL test tb1 f31 31 NULL YES bigint NULL NULL 19 0 NULL NULL bigint(20) unsigned zerofill -NULL test tb1 f32 32 NULL YES bigint NULL NULL 19 0 NULL NULL bigint(20) unsigned zerofill +NULL test tb1 f30 30 NULL YES bigint NULL NULL 20 0 NULL NULL bigint(20) unsigned +NULL test tb1 f31 31 NULL YES bigint NULL NULL 20 0 NULL NULL bigint(20) unsigned zerofill +NULL test tb1 f32 32 NULL YES bigint NULL NULL 20 0 NULL NULL bigint(20) unsigned zerofill NULL test tb1 f33 33 10 NO decimal NULL NULL 10 0 NULL NULL decimal(10,0) NULL test tb1 f34 34 10 NO decimal NULL NULL 10 0 NULL NULL decimal(10,0) unsigned NULL test tb1 f35 35 0000000010 NO decimal NULL NULL 10 0 NULL NULL decimal(10,0) unsigned zerofill @@ -602,9 +602,9 @@ NULL test tb3 f143 26 99999 NO int NULL NULL 10 0 NULL NULL int(10) unsigned NULL test tb3 f144 27 0000099999 NO int NULL NULL 10 0 NULL NULL int(10) unsigned zerofill NULL test tb3 f145 28 0000099999 NO int NULL NULL 10 0 NULL NULL int(10) unsigned zerofill NULL test tb3 f146 29 999999 NO bigint NULL NULL 19 0 NULL NULL bigint(20) -NULL test tb3 f147 30 999999 NO bigint NULL NULL 19 0 NULL NULL bigint(20) unsigned -NULL test tb3 f148 31 00000000000000999999 NO bigint NULL NULL 19 0 NULL NULL bigint(20) unsigned zerofill -NULL test tb3 f149 32 00000000000000999999 NO bigint NULL NULL 19 0 NULL NULL bigint(20) unsigned zerofill +NULL test tb3 f147 30 999999 NO bigint NULL NULL 20 0 NULL NULL bigint(20) unsigned +NULL test tb3 f148 31 00000000000000999999 NO bigint NULL NULL 20 0 NULL NULL bigint(20) unsigned zerofill +NULL test tb3 f149 32 00000000000000999999 NO bigint NULL NULL 20 0 NULL NULL bigint(20) unsigned zerofill NULL test tb3 f150 33 1000 NO decimal NULL NULL 10 0 NULL NULL decimal(10,0) NULL test tb3 f151 34 999 NO decimal NULL NULL 10 0 NULL NULL decimal(10,0) unsigned NULL test tb3 f152 35 0000001000 NO decimal NULL NULL 10 0 NULL NULL decimal(10,0) unsigned zerofill diff --git a/mysql-test/suite/funcs_1/r/is_columns_mysql_embedded.result b/mysql-test/suite/funcs_1/r/is_columns_mysql_embedded.result index 9c9d3cd26de..983f9dd833e 100644 --- a/mysql-test/suite/funcs_1/r/is_columns_mysql_embedded.result +++ b/mysql-test/suite/funcs_1/r/is_columns_mysql_embedded.result @@ -97,13 +97,13 @@ NULL mysql host Select_priv 3 N NO enum 1 3 NULL NULL utf8 utf8_general_ci enum( NULL mysql host Show_view_priv 16 N NO enum 1 3 NULL NULL utf8 utf8_general_ci enum('N','Y') NULL mysql host Trigger_priv 20 N NO enum 1 3 NULL NULL utf8 utf8_general_ci enum('N','Y') NULL mysql host Update_priv 5 N NO enum 1 3 NULL NULL utf8 utf8_general_ci enum('N','Y') -NULL mysql ndb_binlog_index deletes 6 NULL NO bigint NULL NULL 19 0 NULL NULL bigint(20) unsigned -NULL mysql ndb_binlog_index epoch 3 NULL NO bigint NULL NULL 19 0 NULL NULL bigint(20) unsigned PRI +NULL mysql ndb_binlog_index deletes 6 NULL NO bigint NULL NULL 20 0 NULL NULL bigint(20) unsigned +NULL mysql ndb_binlog_index epoch 3 NULL NO bigint NULL NULL 20 0 NULL NULL bigint(20) unsigned PRI NULL mysql ndb_binlog_index File 2 NULL NO varchar 255 255 NULL NULL latin1 latin1_swedish_ci varchar(255) -NULL mysql ndb_binlog_index inserts 4 NULL NO bigint NULL NULL 19 0 NULL NULL bigint(20) unsigned -NULL mysql ndb_binlog_index Position 1 NULL NO bigint NULL NULL 19 0 NULL NULL bigint(20) unsigned -NULL mysql ndb_binlog_index schemaops 7 NULL NO bigint NULL NULL 19 0 NULL NULL bigint(20) unsigned -NULL mysql ndb_binlog_index updates 5 NULL NO bigint NULL NULL 19 0 NULL NULL bigint(20) unsigned +NULL mysql ndb_binlog_index inserts 4 NULL NO bigint NULL NULL 20 0 NULL NULL bigint(20) unsigned +NULL mysql ndb_binlog_index Position 1 NULL NO bigint NULL NULL 20 0 NULL NULL bigint(20) unsigned +NULL mysql ndb_binlog_index schemaops 7 NULL NO bigint NULL NULL 20 0 NULL NULL bigint(20) unsigned +NULL mysql ndb_binlog_index updates 5 NULL NO bigint NULL NULL 20 0 NULL NULL bigint(20) unsigned NULL mysql plugin dl 2 NO char 128 384 NULL NULL utf8 utf8_bin char(128) NULL mysql plugin name 1 NO char 64 192 NULL NULL utf8 utf8_bin char(64) PRI NULL mysql proc body 11 NULL NO longblob 4294967295 4294967295 NULL NULL NULL NULL longblob @@ -130,7 +130,7 @@ NULL mysql procs_priv Db 2 NO char 64 192 NULL NULL utf8 utf8_bin char(64) PRI NULL mysql procs_priv Grantor 6 NO char 77 231 NULL NULL utf8 utf8_bin char(77) MUL NULL mysql procs_priv Host 1 NO char 60 180 NULL NULL utf8 utf8_bin char(60) PRI NULL mysql procs_priv Proc_priv 7 NO set 27 81 NULL NULL utf8 utf8_general_ci set('Execute','Alter Routine','Grant') -NULL mysql procs_priv Routine_name 4 NO char 64 192 NULL NULL utf8 utf8_bin char(64) PRI +NULL mysql procs_priv Routine_name 4 NO char 64 192 NULL NULL utf8 utf8_general_ci char(64) PRI NULL mysql procs_priv Routine_type 5 NULL NO enum 9 27 NULL NULL utf8 utf8_bin enum('FUNCTION','PROCEDURE') PRI NULL mysql procs_priv Timestamp 8 CURRENT_TIMESTAMP NO timestamp NULL NULL NULL NULL NULL NULL timestamp on update CURRENT_TIMESTAMP NULL mysql procs_priv User 3 NO char 16 48 NULL NULL utf8 utf8_bin char(16) PRI @@ -411,7 +411,7 @@ NULL mysql proc modified timestamp NULL NULL NULL NULL timestamp 3.0000 mysql procs_priv Host char 60 180 utf8 utf8_bin char(60) 3.0000 mysql procs_priv Db char 64 192 utf8 utf8_bin char(64) 3.0000 mysql procs_priv User char 16 48 utf8 utf8_bin char(16) -3.0000 mysql procs_priv Routine_name char 64 192 utf8 utf8_bin char(64) +3.0000 mysql procs_priv Routine_name char 64 192 utf8 utf8_general_ci char(64) 3.0000 mysql procs_priv Routine_type enum 9 27 utf8 utf8_bin enum('FUNCTION','PROCEDURE') 3.0000 mysql procs_priv Grantor char 77 231 utf8 utf8_bin char(77) 3.0000 mysql procs_priv Proc_priv set 27 81 utf8 utf8_general_ci set('Execute','Alter Routine','Grant') From c85237485a4cfe5ff87d16007503882afe77ea5d Mon Sep 17 00:00:00 2001 From: Bjorn Munch Date: Fri, 18 Mar 2011 12:13:54 +0100 Subject: [PATCH 15/91] Bug #11885854 MYSQLTEST: PS-PROTOCOL IMPLIED BY CURSOR-PROTOCOL LOST AFTER ENABLE_PS_PROTOCOL The condition cursor-protocol => ps-protocol was done at "current setting" level" Moved it to "set by command line" level --- client/mysqltest.cc | 8 +++++--- 1 file changed, 5 insertions(+), 3 deletions(-) diff --git a/client/mysqltest.cc b/client/mysqltest.cc index a94dba90979..52c76b8c68e 100644 --- a/client/mysqltest.cc +++ b/client/mysqltest.cc @@ -8032,13 +8032,15 @@ int main(int argc, char **argv) cur_file->lineno= 1; } init_re(); + + /* Cursor protcol implies ps protocol */ + if (cursor_protocol) + ps_protocol= 1; + ps_protocol_enabled= ps_protocol; sp_protocol_enabled= sp_protocol; view_protocol_enabled= view_protocol; cursor_protocol_enabled= cursor_protocol; - /* Cursor protcol implies ps protocol */ - if (cursor_protocol_enabled) - ps_protocol_enabled= 1; st_connection *con= connections; if (!( mysql_init(&con->mysql))) From 1077c85fe3450b2a3ae73f7f01cdaf097417f998 Mon Sep 17 00:00:00 2001 From: Ramil Kalimullin Date: Mon, 21 Mar 2011 09:21:14 +0300 Subject: [PATCH 16/91] Fix for bug#51875/#11759554 backported from mysql-5.1. --- mysql-test/r/gis.result | 7 +++++++ mysql-test/t/gis.test | 10 ++++++++++ sql/spatial.cc | 6 ++++-- 3 files changed, 21 insertions(+), 2 deletions(-) diff --git a/mysql-test/r/gis.result b/mysql-test/r/gis.result index 158fdb69c10..a3b4e8a1783 100644 --- a/mysql-test/r/gis.result +++ b/mysql-test/r/gis.result @@ -996,4 +996,11 @@ ERROR 42000: You have an error in your SQL syntax; check the manual that corresp ALTER TABLE t2 ADD SPATIAL INDEX USING BTREE (col1); ERROR 42000: You have an error in your SQL syntax; check the manual that corresponds to your MySQL server version for the right syntax to use near 'USING BTREE (col1)' at line 1 DROP TABLE t2; +# +# BUG#51875: crash when loading data into geometry function polyfromwkb +# +SET @a=0x00000000030000000100000000000000000000000000144000000000000014400000000000001840000000000000184000000000000014400000000000001440; +SET @a=POLYFROMWKB(@a); +SET @a=0x00000000030000000000000000000000000000000000144000000000000014400000000000001840000000000000184000000000000014400000000000001440; +SET @a=POLYFROMWKB(@a); End of 5.0 tests diff --git a/mysql-test/t/gis.test b/mysql-test/t/gis.test index d2bfe7d90d4..8abd2fc2da9 100644 --- a/mysql-test/t/gis.test +++ b/mysql-test/t/gis.test @@ -685,4 +685,14 @@ ALTER TABLE t2 ADD SPATIAL INDEX USING BTREE (col1); DROP TABLE t2; + +--echo # +--echo # BUG#51875: crash when loading data into geometry function polyfromwkb +--echo # +SET @a=0x00000000030000000100000000000000000000000000144000000000000014400000000000001840000000000000184000000000000014400000000000001440; +SET @a=POLYFROMWKB(@a); +SET @a=0x00000000030000000000000000000000000000000000144000000000000014400000000000001840000000000000184000000000000014400000000000001440; +SET @a=POLYFROMWKB(@a); + + --echo End of 5.0 tests diff --git a/sql/spatial.cc b/sql/spatial.cc index 6e1da589527..b0963206271 100644 --- a/sql/spatial.cc +++ b/sql/spatial.cc @@ -519,7 +519,7 @@ uint Gis_line_string::init_from_wkb(const char *wkb, uint len, n_points= wkb_get_uint(wkb, bo); proper_length= 4 + n_points * POINT_DATA_SIZE; - if (len < proper_length || res->reserve(proper_length)) + if (!n_points || len < proper_length || res->reserve(proper_length)) return 0; res->q_append(n_points); @@ -737,7 +737,9 @@ uint Gis_polygon::init_from_wkb(const char *wkb, uint len, wkbByteOrder bo, if (len < 4) return 0; - n_linear_rings= wkb_get_uint(wkb, bo); + if (!(n_linear_rings= wkb_get_uint(wkb, bo))) + return 0; + if (res->reserve(4, 512)) return 0; wkb+= 4; From c8b724b2aa6dd0ccc5af1a2b7eb5b92271556ccb Mon Sep 17 00:00:00 2001 From: Mayank Prasad Date: Mon, 21 Mar 2011 21:32:47 +0530 Subject: [PATCH 17/91] Bug #11751148 : show events shows events in other schema Issue: ------ Due to prefix match, database like 'k' was matching with 'ka' and events of 'ka' we getting displayed for 'show event' of 'k'. Resolution: ----------- Scan for listing of events in a schema is made to be done on exact match of database (schema) name instead of just prefix. mysql-test/r/events_bugs.result: modified expected file with the expected results. mysql-test/t/events_bugs.test: added a test case to reproduce the scenario. sql/event_db_repository.cc: Scan for schema name is made to be done on exact db name match. --- mysql-test/r/events_bugs.result | 9 +++++++++ mysql-test/t/events_bugs.test | 15 +++++++++++++++ sql/event_db_repository.cc | 2 +- 3 files changed, 25 insertions(+), 1 deletion(-) diff --git a/mysql-test/r/events_bugs.result b/mysql-test/r/events_bugs.result index 50bfa97c59f..ab1e9884efd 100644 --- a/mysql-test/r/events_bugs.result +++ b/mysql-test/r/events_bugs.result @@ -747,6 +747,15 @@ event_name originator ev1 4294967295 DROP EVENT ev1; SET GLOBAL server_id = @old_server_id; +CREATE DATABASE event_test1; +USE event_test1; +CREATE EVENT ev1 ON SCHEDULE EVERY 1 DAY DO SELECT 1; +CREATE DATABASE event_test2; +USE event_test2; +SHOW EVENTS; +Db Name Definer Time zone Type Execute at Interval value Interval field Starts Ends Status Originator character_set_client collation_connection Database Collation +DROP DATABASE event_test1; +DROP DATABASE event_test2; DROP DATABASE events_test; SET GLOBAL event_scheduler= 'ON'; SET @@global.concurrent_insert= @concurrent_insert; diff --git a/mysql-test/t/events_bugs.test b/mysql-test/t/events_bugs.test index 81397b333f9..83e37cdccdb 100644 --- a/mysql-test/t/events_bugs.test +++ b/mysql-test/t/events_bugs.test @@ -1221,6 +1221,21 @@ SELECT event_name, originator FROM INFORMATION_SCHEMA.EVENTS; DROP EVENT ev1; SET GLOBAL server_id = @old_server_id; +# +# Bug#11751148: show events shows events in other schema +# + +CREATE DATABASE event_test1; +USE event_test1; +CREATE EVENT ev1 ON SCHEDULE EVERY 1 DAY DO SELECT 1; +CREATE DATABASE event_test2; +USE event_test2; +# Following show events should not show ev1 +SHOW EVENTS; +DROP DATABASE event_test1; +DROP DATABASE event_test2; + + ########################################################################### # # End of tests diff --git a/sql/event_db_repository.cc b/sql/event_db_repository.cc index 753e9d21b65..7473cf47188 100644 --- a/sql/event_db_repository.cc +++ b/sql/event_db_repository.cc @@ -424,7 +424,7 @@ Event_db_repository::index_read_for_db_for_i_s(THD *thd, TABLE *schema_table, key_copy(key_buf, event_table->record[0], key_info, key_len); if (!(ret= event_table->file->index_read_map(event_table->record[0], key_buf, (key_part_map)1, - HA_READ_PREFIX))) + HA_READ_KEY_EXACT))) { DBUG_PRINT("info",("Found rows. Let's retrieve them. ret=%d", ret)); do From 590fa98628600cf65d2241aafc14a0f4a0444aef Mon Sep 17 00:00:00 2001 From: MySQL Build Team Date: Mon, 21 Mar 2011 20:23:39 +0100 Subject: [PATCH 18/91] fixing 38697/11749301 --- CMakeLists.txt | 1 + 1 file changed, 1 insertion(+) diff --git a/CMakeLists.txt b/CMakeLists.txt index 8276a3506af..8aed0eaa021 100755 --- a/CMakeLists.txt +++ b/CMakeLists.txt @@ -59,6 +59,7 @@ ADD_DEFINITIONS(-D__NT__) IF(CYBOZU) ADD_DEFINITIONS(-DCYBOZU) + ADD_DEFINITIONS(-DHAVE_UTF8_GENERAL_CS) ENDIF(CYBOZU) IF(EXTRA_DEBUG) From 5e62a9db2e2cc27ebd21bef5557a3b0e78d67692 Mon Sep 17 00:00:00 2001 From: Georgi Kodinov Date: Mon, 21 Mar 2011 17:54:40 +0200 Subject: [PATCH 19/91] Bug #11763135: 55812: MYSQL AB SHOULD NOT BE AUTHOR, EVEN IN EXAMPLE Fixed the author and the copyright. --- plugin/fulltext/plugin_example.c | 4 ++-- 1 file changed, 2 insertions(+), 2 deletions(-) diff --git a/plugin/fulltext/plugin_example.c b/plugin/fulltext/plugin_example.c index 70022da2cc4..c51fbc04ecd 100644 --- a/plugin/fulltext/plugin_example.c +++ b/plugin/fulltext/plugin_example.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2006 MySQL AB +/* Copyright (c) 2006, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by @@ -259,7 +259,7 @@ mysql_declare_plugin(ftexample) MYSQL_FTPARSER_PLUGIN, /* type */ &simple_parser_descriptor, /* descriptor */ "simple_parser", /* name */ - "MySQL AB", /* author */ + "Oracle Corp", /* author */ "Simple Full-Text Parser", /* description */ PLUGIN_LICENSE_GPL, simple_parser_plugin_init, /* init function (when loaded) */ From 55e42237121f02823aabb2804f8204b984877579 Mon Sep 17 00:00:00 2001 From: Magne Mahre Date: Tue, 22 Mar 2011 13:50:14 +0100 Subject: [PATCH 20/91] Bug#11896296 REMOVE LGPL LICENSED FILES IN MYSQL 5.0 The LGPL license is used in some legacy code, and to adhere to current licensing polity, we remove those files that are no longer used, and reorganize the remaining LGPL code so it will be GPL licensed from now on. Note: This patch only removed LGPL licensed files in MySQL 5.0, and is the first of a set of patches to remove LGPL from all trees. (See Bug# 11840513 for details) include/my_compare.h: Mostly code moved in from my_handler include/my_global.h: AIX-only code. Function used to be in my_port.c Inlining instead. libmysql/Makefile.shared: my_gethostbyname and my_port is removed myisam/mi_check.c: ha_find_null is moved from my_handler and made static. --- VC++Files/client/mysqlclient.dsp | 4 - VC++Files/client/mysqlclient.vcproj | 3 - VC++Files/client/mysqlclient_ia64.dsp | 4 - VC++Files/libmysql/libmysql.dsp | 4 - VC++Files/libmysql/libmysql.vcproj | 3 - VC++Files/libmysql/libmysql_ia64.dsp | 4 - VC++Files/mysys/mysys.dsp | 6 +- VC++Files/mysys/mysys.vcproj | 5 +- VC++Files/mysys/mysys_ia64.dsp | 8 +- include/Makefile.am | 2 +- include/heap.h | 4 +- include/{my_handler.h => my_compare.h} | 27 +++--- include/my_global.h | 4 +- include/myisam.h | 4 +- libmysql/CMakeLists.txt | 2 +- libmysql/Makefile.shared | 2 +- myisam/ft_stopwords.c | 4 +- myisam/mi_check.c | 89 ++++++++++++++++++- myisam/mi_range.c | 4 +- mysys/CMakeLists.txt | 4 +- mysys/Makefile.am | 6 +- mysys/{my_handler.c => my_compare.c} | 117 +++---------------------- mysys/my_gethostbyname.c | 111 ----------------------- mysys/my_net.c | 90 ++++++++++++++++++- mysys/my_port.c | 40 --------- mysys/raid2.c | 31 ------- 26 files changed, 225 insertions(+), 357 deletions(-) rename include/{my_handler.h => my_compare.h} (80%) rename mysys/{my_handler.c => my_compare.c} (83%) delete mode 100644 mysys/my_gethostbyname.c delete mode 100644 mysys/my_port.c delete mode 100644 mysys/raid2.c diff --git a/VC++Files/client/mysqlclient.dsp b/VC++Files/client/mysqlclient.dsp index c14fc31ab8d..6890513feb0 100644 --- a/VC++Files/client/mysqlclient.dsp +++ b/VC++Files/client/mysqlclient.dsp @@ -371,10 +371,6 @@ SOURCE=..\mysys\my_fstream.c # End Source File # Begin Source File -SOURCE=..\mysys\my_gethostbyname.c -# End Source File -# Begin Source File - SOURCE=..\mysys\my_getopt.c # End Source File # Begin Source File diff --git a/VC++Files/client/mysqlclient.vcproj b/VC++Files/client/mysqlclient.vcproj index a3fb0aa9a47..610e8bc952c 100644 --- a/VC++Files/client/mysqlclient.vcproj +++ b/VC++Files/client/mysqlclient.vcproj @@ -351,9 +351,6 @@ - - diff --git a/VC++Files/client/mysqlclient_ia64.dsp b/VC++Files/client/mysqlclient_ia64.dsp index 1aa6836ca58..3bbe56072b8 100644 --- a/VC++Files/client/mysqlclient_ia64.dsp +++ b/VC++Files/client/mysqlclient_ia64.dsp @@ -356,10 +356,6 @@ SOURCE=..\mysys\my_fstream.c # End Source File # Begin Source File -SOURCE=..\mysys\my_gethostbyname.c -# End Source File -# Begin Source File - SOURCE=..\mysys\my_getopt.c # End Source File # Begin Source File diff --git a/VC++Files/libmysql/libmysql.dsp b/VC++Files/libmysql/libmysql.dsp index e17bee12d1b..69fe7b18d3e 100644 --- a/VC++Files/libmysql/libmysql.dsp +++ b/VC++Files/libmysql/libmysql.dsp @@ -343,10 +343,6 @@ SOURCE=..\mysys\my_fstream.c # End Source File # Begin Source File -SOURCE=..\mysys\my_gethostbyname.c -# End Source File -# Begin Source File - SOURCE=..\mysys\my_getopt.c # End Source File # Begin Source File diff --git a/VC++Files/libmysql/libmysql.vcproj b/VC++Files/libmysql/libmysql.vcproj index c85cc960f32..6662c99dcb3 100644 --- a/VC++Files/libmysql/libmysql.vcproj +++ b/VC++Files/libmysql/libmysql.vcproj @@ -329,9 +329,6 @@ - - diff --git a/VC++Files/libmysql/libmysql_ia64.dsp b/VC++Files/libmysql/libmysql_ia64.dsp index dc8778cfe23..9555723f840 100644 --- a/VC++Files/libmysql/libmysql_ia64.dsp +++ b/VC++Files/libmysql/libmysql_ia64.dsp @@ -334,10 +334,6 @@ SOURCE=..\mysys\my_fstream.c # End Source File # Begin Source File -SOURCE=..\mysys\my_gethostbyname.c -# End Source File -# Begin Source File - SOURCE=..\mysys\my_getopt.c # End Source File # Begin Source File diff --git a/VC++Files/mysys/mysys.dsp b/VC++Files/mysys/mysys.dsp index a920a0bd967..d9411c2e91a 100644 --- a/VC++Files/mysys/mysys.dsp +++ b/VC++Files/mysys/mysys.dsp @@ -405,10 +405,6 @@ SOURCE=.\my_fstream.c # End Source File # Begin Source File -SOURCE=.\my_gethostbyname.c -# End Source File -# Begin Source File - SOURCE=.\my_gethwaddr.c # End Source File # Begin Source File @@ -425,7 +421,7 @@ SOURCE=.\my_getwd.c # End Source File # Begin Source File -SOURCE=.\my_handler.c +SOURCE=.\my_compare.c # End Source File # Begin Source File diff --git a/VC++Files/mysys/mysys.vcproj b/VC++Files/mysys/mysys.vcproj index 53b5394b27d..26e761b72ca 100644 --- a/VC++Files/mysys/mysys.vcproj +++ b/VC++Files/mysys/mysys.vcproj @@ -476,9 +476,6 @@ - - @@ -492,7 +489,7 @@ RelativePath="my_getwd.c"> + RelativePath="my_compare.c"> diff --git a/VC++Files/mysys/mysys_ia64.dsp b/VC++Files/mysys/mysys_ia64.dsp index 4e4f71d89ba..708de63aff7 100644 --- a/VC++Files/mysys/mysys_ia64.dsp +++ b/VC++Files/mysys/mysys_ia64.dsp @@ -402,11 +402,11 @@ SOURCE=.\my_fstream.c # End Source File # Begin Source File -SOURCE=.\my_gethostbyname.c +SOURCE=.\my_gethwaddr.c # End Source File # Begin Source File -SOURCE=.\my_gethwaddr.c +SOURCE=.\my_compare.c # End Source File # Begin Source File @@ -422,10 +422,6 @@ SOURCE=.\my_getwd.c # End Source File # Begin Source File -SOURCE=.\my_handler.c -# End Source File -# Begin Source File - SOURCE=.\my_init.c # End Source File # Begin Source File diff --git a/include/Makefile.am b/include/Makefile.am index 06d7efe754b..704a770d7db 100644 --- a/include/Makefile.am +++ b/include/Makefile.am @@ -33,7 +33,7 @@ noinst_HEADERS = config-win.h config-netware.h \ my_nosys.h my_alarm.h queues.h rijndael.h sha1.h \ my_aes.h my_tree.h hash.h thr_alarm.h \ thr_lock.h t_ctype.h violite.h my_md5.h base64.h \ - mysql_version.h.in my_handler.h my_time.h \ + mysql_version.h.in my_compare.h my_time.h \ my_user.h my_libwrap.h # Remove built files and the symlinked directories diff --git a/include/heap.h b/include/heap.h index 1a02fef5483..9d67c94e003 100644 --- a/include/heap.h +++ b/include/heap.h @@ -1,4 +1,4 @@ -/* Copyright (C) 2000,2004 MySQL AB +/* Copyright (c) 2000, 2011 Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by @@ -30,7 +30,7 @@ extern "C" { #include #endif -#include "my_handler.h" +#include "my_compare.h" #include "my_tree.h" /* defines used by heap-funktions */ diff --git a/include/my_handler.h b/include/my_compare.h similarity index 80% rename from include/my_handler.h rename to include/my_compare.h index 20cc90e4a8f..55cd68bbc0d 100644 --- a/include/my_handler.h +++ b/include/my_compare.h @@ -1,22 +1,20 @@ -/* Copyright (C) 2002-2006 MySQL AB +/* Copyright (c) 2011, Oracle and/or its affiliates. All rights reserved. - This program is free software; you can redistribute it and/or - modify it under the terms of the GNU Library General Public - License as published by the Free Software Foundation; version 2 - of the License. + This program is free software; you can redistribute it and/or modify + it under the terms of the GNU General Public License as published by + the Free Software Foundation; version 2 of the License. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Library General Public License for more details. + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the + GNU General Public License for more details. - You should have received a copy of the GNU Library General Public - License along with this library; if not, write to the Free - Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, - MA 02111-1307, USA */ + You should have received a copy of the GNU General Public License + along with this program; if not, write to the Free Software + Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA */ -#ifndef _my_handler_h -#define _my_handler_h +#ifndef _my_compare_h +#define _my_compare_h #include "my_base.h" #include "m_ctype.h" @@ -87,6 +85,5 @@ extern int ha_key_cmp(register HA_KEYSEG *keyseg, register uchar *a, register uchar *b, uint key_length, uint nextflag, uint *diff_pos); -extern HA_KEYSEG *ha_find_null(HA_KEYSEG *keyseg, uchar *a); -#endif /* _my_handler_h */ +#endif /* _my_compare_h */ diff --git a/include/my_global.h b/include/my_global.h index 595c7cd793b..83a28705581 100644 --- a/include/my_global.h +++ b/include/my_global.h @@ -1,4 +1,4 @@ -/* Copyright (C) 2000-2003 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by @@ -255,7 +255,7 @@ C_MODE_END #define ulonglong2double(A) my_ulonglong2double(A) #define my_off_t2double(A) my_ulonglong2double(A) C_MODE_START -double my_ulonglong2double(unsigned long long A); +inline double my_ulonglong2double(unsigned long long A) { return (double) A; } C_MODE_END #endif /* _AIX */ diff --git a/include/myisam.h b/include/myisam.h index acc2d689b75..4c2358a3513 100644 --- a/include/myisam.h +++ b/include/myisam.h @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (C) 2000, 2011 Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by @@ -30,7 +30,7 @@ extern "C" { #ifndef _keycache_h #include "keycache.h" #endif -#include "my_handler.h" +#include "my_compare.h" /* There is a hard limit for the maximum number of keys as there are only diff --git a/libmysql/CMakeLists.txt b/libmysql/CMakeLists.txt index cd90b2b1257..f7f0ac22de2 100755 --- a/libmysql/CMakeLists.txt +++ b/libmysql/CMakeLists.txt @@ -81,7 +81,7 @@ SET(CLIENT_SOURCES ../mysys/array.c ../strings/bchange.c ../strings/bmove.c ../mysys/mf_wcomp.c ../mysys/mulalloc.c ../mysys/my_access.c ../mysys/my_alloc.c ../mysys/my_chsize.c ../mysys/my_compress.c ../mysys/my_create.c ../mysys/my_delete.c ../mysys/my_div.c ../mysys/my_error.c ../mysys/my_file.c - ../mysys/my_fopen.c ../mysys/my_fstream.c ../mysys/my_gethostbyname.c + ../mysys/my_fopen.c ../mysys/my_fstream.c ../mysys/my_getopt.c ../mysys/my_getwd.c ../mysys/my_init.c ../mysys/my_lib.c ../mysys/my_malloc.c ../mysys/my_messnc.c ../mysys/my_net.c ../mysys/my_once.c ../mysys/my_open.c ../mysys/my_pread.c ../mysys/my_pthread.c ../mysys/my_read.c diff --git a/libmysql/Makefile.shared b/libmysql/Makefile.shared index 83ae79ebee2..f9be2b1f761 100644 --- a/libmysql/Makefile.shared +++ b/libmysql/Makefile.shared @@ -66,7 +66,7 @@ mysysobjects1 = my_init.lo my_static.lo my_malloc.lo my_realloc.lo \ charset.lo charset-def.lo hash.lo mf_iocache.lo \ mf_iocache2.lo my_seek.lo my_sleep.lo \ my_pread.lo mf_cache.lo md5.lo sha1.lo \ - my_getopt.lo my_gethostbyname.lo my_port.lo \ + my_getopt.lo \ my_rename.lo my_chsize.lo sqlobjects = net.lo sql_cmn_objects = pack.lo client.lo my_time.lo diff --git a/myisam/ft_stopwords.c b/myisam/ft_stopwords.c index 1b7933e85ca..72cbf6cc18a 100644 --- a/myisam/ft_stopwords.c +++ b/myisam/ft_stopwords.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000-2005 MySQL AB +/* Copyright (C) 2000-2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by @@ -16,7 +16,7 @@ /* Written by Sergei A. Golubchik, who has a shared copyright to this code */ #include "ftdefs.h" -#include "my_handler.h" +#include "my_compare.h" typedef struct st_ft_stopwords { diff --git a/myisam/mi_check.c b/myisam/mi_check.c index 80a90977609..e95862bb47b 100644 --- a/myisam/mi_check.c +++ b/myisam/mi_check.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000-2006 MySQL AB +/* Copyright (c) 2000, 2011 Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by @@ -85,6 +85,7 @@ static SORT_KEY_BLOCKS *alloc_key_blocks(MI_CHECK *param, uint blocks, uint buffer_length); static ha_checksum mi_byte_checksum(const byte *buf, uint length); static void set_data_file_type(SORT_INFO *sort_info, MYISAM_SHARE *share); +static HA_KEYSEG *ha_find_null(HA_KEYSEG *keyseg, uchar *a); void myisamchk_init(MI_CHECK *param) { @@ -4691,3 +4692,89 @@ set_data_file_type(SORT_INFO *sort_info, MYISAM_SHARE *share) share->delete_record=tmp.delete_record; } } + +/* + Find the first NULL value in index-suffix values tuple + + SYNOPSIS + ha_find_null() + keyseg Array of keyparts for key suffix + a Key suffix value tuple + + DESCRIPTION + Find the first NULL value in index-suffix values tuple. + TODO Consider optimizing this fuction or its use so we don't search for + NULL values in completely NOT NULL index suffixes. + + RETURN + First key part that has NULL as value in values tuple, or the last key part + (with keyseg->type==HA_TYPE_END) if values tuple doesn't contain NULLs. +*/ + +static HA_KEYSEG *ha_find_null(HA_KEYSEG *keyseg, uchar *a) +{ + for (; (enum ha_base_keytype) keyseg->type != HA_KEYTYPE_END; keyseg++) + { + uchar *end; + if (keyseg->null_bit) + { + if (!*a++) + return keyseg; + } + end= a+ keyseg->length; + + switch ((enum ha_base_keytype) keyseg->type) { + case HA_KEYTYPE_TEXT: + case HA_KEYTYPE_BINARY: + case HA_KEYTYPE_BIT: + if (keyseg->flag & HA_SPACE_PACK) + { + int a_length; + get_key_length(a_length, a); + a += a_length; + break; + } + else + a= end; + break; + case HA_KEYTYPE_VARTEXT1: + case HA_KEYTYPE_VARTEXT2: + case HA_KEYTYPE_VARBINARY1: + case HA_KEYTYPE_VARBINARY2: + { + int a_length; + get_key_length(a_length, a); + a+= a_length; + break; + } + case HA_KEYTYPE_NUM: + if (keyseg->flag & HA_SPACE_PACK) + { + int alength= *a++; + end= a+alength; + } + a= end; + break; + case HA_KEYTYPE_INT8: + case HA_KEYTYPE_SHORT_INT: + case HA_KEYTYPE_USHORT_INT: + case HA_KEYTYPE_LONG_INT: + case HA_KEYTYPE_ULONG_INT: + case HA_KEYTYPE_INT24: + case HA_KEYTYPE_UINT24: +#ifdef HAVE_LONG_LONG + case HA_KEYTYPE_LONGLONG: + case HA_KEYTYPE_ULONGLONG: +#endif + case HA_KEYTYPE_FLOAT: + case HA_KEYTYPE_DOUBLE: + a= end; + break; + case HA_KEYTYPE_END: /* purecov: inspected */ + /* keep compiler happy */ + DBUG_ASSERT(0); + break; + } + } + return keyseg; +} diff --git a/myisam/mi_range.c b/myisam/mi_range.c index 2f6d9600fac..6ddc637454f 100644 --- a/myisam/mi_range.c +++ b/myisam/mi_range.c @@ -145,8 +145,8 @@ static ha_rows _mi_record_pos(MI_INFO *info, const byte *key, uint key_len, key_len=USE_WHOLE_KEY; /* - my_handler.c:mi_compare_text() has a flag 'skip_end_space'. - This is set in my_handler.c:ha_key_cmp() in dependence on the + my_compare.c:mi_compare_text() has a flag 'skip_end_space'. + This is set in my_compare.c:ha_key_cmp() in dependence on the compare flags 'nextflag' and the column type. TEXT columns are of type HA_KEYTYPE_VARTEXT. In this case the diff --git a/mysys/CMakeLists.txt b/mysys/CMakeLists.txt index cd3e7afd6a5..2e94e6da088 100755 --- a/mysys/CMakeLists.txt +++ b/mysys/CMakeLists.txt @@ -30,8 +30,8 @@ ADD_LIBRARY(mysys array.c charset-def.c charset.c checksum.c default.c default_m mf_tempfile.c mf_unixpath.c mf_wcomp.c mf_wfile.c mulalloc.c my_access.c my_aes.c my_alarm.c my_alloc.c my_append.c my_bit.c my_bitmap.c my_chsize.c my_clock.c my_compress.c my_conio.c my_copy.c my_crc32.c my_create.c my_delete.c - my_div.c my_error.c my_file.c my_fopen.c my_fstream.c my_gethostbyname.c - my_gethwaddr.c my_getopt.c my_getsystime.c my_getwd.c my_handler.c my_init.c + my_div.c my_error.c my_file.c my_fopen.c my_fstream.c my_compare.c + my_gethwaddr.c my_getopt.c my_getsystime.c my_getwd.c my_init.c my_lib.c my_lock.c my_lockmem.c my_lread.c my_lwrite.c my_malloc.c my_messnc.c my_mkdir.c my_mmap.c my_net.c my_once.c my_open.c my_pread.c my_pthread.c my_quick.c my_read.c my_realloc.c my_redel.c my_rename.c my_seek.c my_sleep.c diff --git a/mysys/Makefile.am b/mysys/Makefile.am index 77af5a47e99..bcb41b57261 100644 --- a/mysys/Makefile.am +++ b/mysys/Makefile.am @@ -47,10 +47,10 @@ libmysys_a_SOURCES = my_init.c my_getwd.c mf_getdate.c my_mmap.c \ my_sync.c my_getopt.c my_mkdir.c \ default_modify.c default.c \ my_compress.c checksum.c raid.cc \ - my_net.c my_port.c my_sleep.c \ + my_net.c my_compare.c my_sleep.c \ charset.c charset-def.c my_bitmap.c my_bit.c md5.c \ - my_gethostbyname.c rijndael.c my_aes.c sha1.c \ - my_handler.c my_netware.c my_largepage.c \ + rijndael.c my_aes.c sha1.c \ + my_netware.c my_largepage.c \ my_memmem.c \ my_windac.c my_access.c base64.c my_libwrap.c EXTRA_DIST = thr_alarm.c thr_lock.c my_pthread.c my_thr_init.c \ diff --git a/mysys/my_handler.c b/mysys/my_compare.c similarity index 83% rename from mysys/my_handler.c rename to mysys/my_compare.c index 1c3bb20426e..c7037befd93 100644 --- a/mysys/my_handler.c +++ b/mysys/my_compare.c @@ -1,22 +1,20 @@ -/* Copyright (C) 2002-2006 MySQL AB - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Library General Public - License as published by the Free Software Foundation; version 2 - of the License. - - This library is distributed in the hope that it will be useful, +/* Copyright (c) 2011 Oracle and/or its affiliates. All rights reserved. + + This program is free software; you can redistribute it and/or modify + it under the terms of the GNU General Public License as published by + the Free Software Foundation; version 2 of the License. + + This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Library General Public License for more details. + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the + GNU General Public License for more details. - You should have received a copy of the GNU Library General Public - License along with this library; if not, write to the Free - Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, - MA 02111-1307, USA */ + You should have received a copy of the GNU General Public License + along with this program; if not, write to the Free Software + Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA */ + +#include "my_compare.h" -#include -#include "my_handler.h" int mi_compare_text(CHARSET_INFO *charset_info, uchar *a, uint a_length, uchar *b, uint b_length, my_bool part_key, @@ -470,90 +468,3 @@ end: } return 0; } /* ha_key_cmp */ - - -/* - Find the first NULL value in index-suffix values tuple - - SYNOPSIS - ha_find_null() - keyseg Array of keyparts for key suffix - a Key suffix value tuple - - DESCRIPTION - Find the first NULL value in index-suffix values tuple. - TODO Consider optimizing this fuction or its use so we don't search for - NULL values in completely NOT NULL index suffixes. - - RETURN - First key part that has NULL as value in values tuple, or the last key part - (with keyseg->type==HA_TYPE_END) if values tuple doesn't contain NULLs. -*/ - -HA_KEYSEG *ha_find_null(HA_KEYSEG *keyseg, uchar *a) -{ - for (; (enum ha_base_keytype) keyseg->type != HA_KEYTYPE_END; keyseg++) - { - uchar *end; - if (keyseg->null_bit) - { - if (!*a++) - return keyseg; - } - end= a+ keyseg->length; - - switch ((enum ha_base_keytype) keyseg->type) { - case HA_KEYTYPE_TEXT: - case HA_KEYTYPE_BINARY: - case HA_KEYTYPE_BIT: - if (keyseg->flag & HA_SPACE_PACK) - { - int a_length; - get_key_length(a_length, a); - a += a_length; - break; - } - else - a= end; - break; - case HA_KEYTYPE_VARTEXT1: - case HA_KEYTYPE_VARTEXT2: - case HA_KEYTYPE_VARBINARY1: - case HA_KEYTYPE_VARBINARY2: - { - int a_length; - get_key_length(a_length, a); - a+= a_length; - break; - } - case HA_KEYTYPE_NUM: - if (keyseg->flag & HA_SPACE_PACK) - { - int alength= *a++; - end= a+alength; - } - a= end; - break; - case HA_KEYTYPE_INT8: - case HA_KEYTYPE_SHORT_INT: - case HA_KEYTYPE_USHORT_INT: - case HA_KEYTYPE_LONG_INT: - case HA_KEYTYPE_ULONG_INT: - case HA_KEYTYPE_INT24: - case HA_KEYTYPE_UINT24: -#ifdef HAVE_LONG_LONG - case HA_KEYTYPE_LONGLONG: - case HA_KEYTYPE_ULONGLONG: -#endif - case HA_KEYTYPE_FLOAT: - case HA_KEYTYPE_DOUBLE: - a= end; - break; - case HA_KEYTYPE_END: /* purecov: inspected */ - /* keep compiler happy */ - DBUG_ASSERT(0); - break; - } - } - return keyseg; -} diff --git a/mysys/my_gethostbyname.c b/mysys/my_gethostbyname.c deleted file mode 100644 index 434a00bab11..00000000000 --- a/mysys/my_gethostbyname.c +++ /dev/null @@ -1,111 +0,0 @@ -/* Copyright (C) 2002, 2004 MySQL AB - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Library General Public - License as published by the Free Software Foundation; version 2 - of the License. - - This library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Library General Public License for more details. - - You should have received a copy of the GNU Library General Public - License along with this library; if not, write to the Free - Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, - MA 02111-1307, USA */ - -/* Thread safe version of gethostbyname_r() */ - -#include "mysys_priv.h" -#if !defined(MSDOS) && !defined(__WIN__) -#include -#endif -#include - -/* This file is not needed if my_gethostbyname_r is a macro */ -#if !defined(my_gethostbyname_r) - -/* - Emulate SOLARIS style calls, not because it's better, but just to make the - usage of getbostbyname_r simpler. -*/ - -#if defined(HAVE_GETHOSTBYNAME_R) - -#if defined(HAVE_GETHOSTBYNAME_R_GLIBC2_STYLE) - -struct hostent *my_gethostbyname_r(const char *name, - struct hostent *result, char *buffer, - int buflen, int *h_errnop) -{ - struct hostent *hp; - DBUG_ASSERT((size_t) buflen >= sizeof(*result)); - if (gethostbyname_r(name,result, buffer, (size_t) buflen, &hp, h_errnop)) - return 0; - return hp; -} - -#elif defined(HAVE_GETHOSTBYNAME_R_RETURN_INT) - -struct hostent *my_gethostbyname_r(const char *name, - struct hostent *result, char *buffer, - int buflen, int *h_errnop) -{ - if (gethostbyname_r(name,result,(struct hostent_data *) buffer) == -1) - { - *h_errnop= errno; - return 0; - } - return result; -} - -#else - -/* gethostbyname_r with similar interface as gethostbyname() */ - -struct hostent *my_gethostbyname_r(const char *name, - struct hostent *result, char *buffer, - int buflen, int *h_errnop) -{ - struct hostent *hp; - DBUG_ASSERT(buflen >= sizeof(struct hostent_data)); - hp= gethostbyname_r(name,result,(struct hostent_data *) buffer); - *h_errnop= errno; - return hp; -} -#endif /* GLIBC2_STYLE_GETHOSTBYNAME_R */ - -#else /* !HAVE_GETHOSTBYNAME_R */ - -#ifdef THREAD -extern pthread_mutex_t LOCK_gethostbyname_r; -#endif - -/* - No gethostbyname_r() function exists. - In this case we have to keep a mutex over the call to ensure that no - other thread is going to reuse the internal memory. - - The user is responsible to call my_gethostbyname_r_free() when he - is finished with the structure. -*/ - -struct hostent *my_gethostbyname_r(const char *name, - struct hostent *result, char *buffer, - int buflen, int *h_errnop) -{ - struct hostent *hp; - pthread_mutex_lock(&LOCK_gethostbyname_r); - hp= gethostbyname(name); - *h_errnop= h_errno; - return hp; -} - -void my_gethostbyname_r_free() -{ - pthread_mutex_unlock(&LOCK_gethostbyname_r); -} - -#endif /* !HAVE_GETHOSTBYNAME_R */ -#endif /* !my_gethostbyname_r */ diff --git a/mysys/my_net.c b/mysys/my_net.c index 136d987f500..dd0af60355f 100644 --- a/mysys/my_net.c +++ b/mysys/my_net.c @@ -1,4 +1,4 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by @@ -40,3 +40,91 @@ void my_inet_ntoa(struct in_addr in, char *buf) strmov(buf,ptr); pthread_mutex_unlock(&THR_LOCK_net); } + + +/* This file is not needed if my_gethostbyname_r is a macro */ +#if !defined(my_gethostbyname_r) + +/* + Emulate SOLARIS style calls, not because it's better, but just to make the + usage of getbostbyname_r simpler. +*/ + +#if defined(HAVE_GETHOSTBYNAME_R) + +#if defined(HAVE_GETHOSTBYNAME_R_GLIBC2_STYLE) + +struct hostent *my_gethostbyname_r(const char *name, + struct hostent *result, char *buffer, + int buflen, int *h_errnop) +{ + struct hostent *hp; + DBUG_ASSERT((size_t) buflen >= sizeof(*result)); + if (gethostbyname_r(name,result, buffer, (size_t) buflen, &hp, h_errnop)) + return 0; + return hp; +} + +#elif defined(HAVE_GETHOSTBYNAME_R_RETURN_INT) + +struct hostent *my_gethostbyname_r(const char *name, + struct hostent *result, char *buffer, + int buflen, int *h_errnop) +{ + if (gethostbyname_r(name,result,(struct hostent_data *) buffer) == -1) + { + *h_errnop= errno; + return 0; + } + return result; +} + +#else + +/* gethostbyname_r with similar interface as gethostbyname() */ + +struct hostent *my_gethostbyname_r(const char *name, + struct hostent *result, char *buffer, + int buflen, int *h_errnop) +{ + struct hostent *hp; + DBUG_ASSERT(buflen >= sizeof(struct hostent_data)); + hp= gethostbyname_r(name,result,(struct hostent_data *) buffer); + *h_errnop= errno; + return hp; +} +#endif /* GLIBC2_STYLE_GETHOSTBYNAME_R */ + +#else /* !HAVE_GETHOSTBYNAME_R */ + +#ifdef THREAD +extern pthread_mutex_t LOCK_gethostbyname_r; +#endif + +/* + No gethostbyname_r() function exists. + In this case we have to keep a mutex over the call to ensure that no + other thread is going to reuse the internal memory. + + The user is responsible to call my_gethostbyname_r_free() when he + is finished with the structure. +*/ + +struct hostent *my_gethostbyname_r(const char *name, + struct hostent *result, char *buffer, + int buflen, int *h_errnop) +{ + struct hostent *hp; + pthread_mutex_lock(&LOCK_gethostbyname_r); + hp= gethostbyname(name); + *h_errnop= h_errno; + return hp; +} + +void my_gethostbyname_r_free() +{ + pthread_mutex_unlock(&LOCK_gethostbyname_r); +} + +#endif /* !HAVE_GETHOSTBYNAME_R */ +#endif /* !my_gethostbyname_r */ diff --git a/mysys/my_port.c b/mysys/my_port.c deleted file mode 100644 index 9ad333421ca..00000000000 --- a/mysys/my_port.c +++ /dev/null @@ -1,40 +0,0 @@ -/* Copyright (C) 2002 MySQL AB - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Library General Public - License as published by the Free Software Foundation; version 2 - of the License. - - This library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Library General Public License for more details. - - You should have received a copy of the GNU Library General Public - License along with this library; if not, write to the Free - Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, - MA 02111-1307, USA */ - -/* - Small functions to make code portable -*/ - -#include "mysys_priv.h" - -#ifdef _AIX - -/* - On AIX, at least with gcc 3.1, the expression - '(double) (ulonglong) var' doesn't always work for big unsigned - integers like '18446744073709551615'. The end result is that the - high bit is simply dropped. (probably bug in gcc optimizations) - Handling the conversion in a sub function seems to work. -*/ - - - -double my_ulonglong2double(unsigned long long nr) -{ - return (double) nr; -} -#endif /* _AIX */ diff --git a/mysys/raid2.c b/mysys/raid2.c deleted file mode 100644 index 4feace7410f..00000000000 --- a/mysys/raid2.c +++ /dev/null @@ -1,31 +0,0 @@ -/* Copyright (C) 2002 MySQL AB - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Library General Public - License as published by the Free Software Foundation; version 2 - of the License. - - This library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Library General Public License for more details. - - You should have received a copy of the GNU Library General Public - License along with this library; if not, write to the Free - Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, - MA 02111-1307, USA */ - -/* - RAID support for MySQL. For full comments, check raid.cc - This is in a separate file to not cause problems on OS that can't - put C++ files in archives. -*/ - -#include "mysys_priv.h" - -const char *raid_type_string[]={"none","striped"}; - -const char *my_raid_type(int raid_type) -{ - return raid_type_string[raid_type]; -} From 326b97cf8ef6a7b598c26d03803d4e8bede2543e Mon Sep 17 00:00:00 2001 From: Magne Mahre Date: Tue, 22 Mar 2011 16:27:32 +0100 Subject: [PATCH 21/91] Post-push fix for Bug 11896296 Didn't build on Solaris. --- mysys/my_net.c | 1 + 1 file changed, 1 insertion(+) diff --git a/mysys/my_net.c b/mysys/my_net.c index dd0af60355f..adabae4b99a 100644 --- a/mysys/my_net.c +++ b/mysys/my_net.c @@ -31,6 +31,7 @@ #include #endif #endif /* !defined(MSDOS) && !defined(__WIN__) */ +#include "my_net.h" void my_inet_ntoa(struct in_addr in, char *buf) { From b489c89f739850ab448182390982b88b536667f2 Mon Sep 17 00:00:00 2001 From: Luis Soares Date: Thu, 24 Mar 2011 10:52:40 +0000 Subject: [PATCH 22/91] BUG#11766865: 60091: RBR + NO PK + UPDATE NULL VALUE --> SLAVE BREAK WITH ERROR HA_ERR_END_OF_ The slave was not able to find the correct row in the innodb table, because the row fetched from the innodb table would not match the before image. This happened because the (don't care) bytes in the NULLed fields would change once the row was stored in the storage engine (from zero to the default value). This would make bulk memory comparison (using memcmp) to fail. We fix this by taking a preventing measure and avoiding memcmp for tables that contain nullable fields. Therefore, we protect the slave search routine from engines that return arbitrary values for don't care bytes (in the nulled fields). Instead, the slave thread will only check null_bits and those fields that are not set to NULL when comparing the before image against the storage engine row. mysql-test/extra/rpl_tests/rpl_record_compare.test: Added test case to the include file so that this is tested with more than one engine. mysql-test/suite/rpl/r/rpl_row_rec_comp_innodb.result: Result update. mysql-test/suite/rpl/r/rpl_row_rec_comp_myisam.result: Result update. mysql-test/suite/rpl/t/rpl_row_rec_comp_myisam.test: Moved the include file last, so that the result from BUG#11766865 is not intermixed with the result for BUG#11760454. sql/log_event.cc: Skips memory comparison if the table has nullable columns and compares only non-nulled fields in the field comparison loop. --- .../extra/rpl_tests/rpl_record_compare.test | 20 ++++++++++++ .../rpl/r/rpl_row_rec_comp_innodb.result | 6 ++++ .../rpl/r/rpl_row_rec_comp_myisam.result | 20 +++++++----- .../suite/rpl/t/rpl_row_rec_comp_myisam.test | 6 ++-- sql/log_event.cc | 31 ++++++++++++++++--- 5 files changed, 69 insertions(+), 14 deletions(-) diff --git a/mysql-test/extra/rpl_tests/rpl_record_compare.test b/mysql-test/extra/rpl_tests/rpl_record_compare.test index f29e4fb791a..210aee025d0 100644 --- a/mysql-test/extra/rpl_tests/rpl_record_compare.test +++ b/mysql-test/extra/rpl_tests/rpl_record_compare.test @@ -62,4 +62,24 @@ UPDATE t1 SET c1= 0; DROP TABLE t1; -- sync_slave_with_master +# +# BUG#11766865: 60091: RBR + NO PK + UPDATE NULL VALUE --> SLAVE BREAK WITH ERROR HA_ERR_END_OF_ +# +--connection master +--source include/rpl_reset.inc +--connection master + +--eval CREATE TABLE t1 (c1 int(11) NOT NULL, c2 int(11) NOT NULL, c3 int(11) DEFAULT '-1') ENGINE=$engine DEFAULT CHARSET=latin1 + +INSERT INTO t1 VALUES (1,2,NULL); +UPDATE t1 SET c1=1, c2=2, c3=-1 WHERE c1=1 AND c2=2 AND ISNULL(c3); + +--sync_slave_with_master + +--let $diff_tables=master:test.t1, slave:test.t1 +--source include/diff_tables.inc + +--connection master +DROP TABLE t1; +--sync_slave_with_master diff --git a/mysql-test/suite/rpl/r/rpl_row_rec_comp_innodb.result b/mysql-test/suite/rpl/r/rpl_row_rec_comp_innodb.result index d9ebb52493b..523564a222e 100644 --- a/mysql-test/suite/rpl/r/rpl_row_rec_comp_innodb.result +++ b/mysql-test/suite/rpl/r/rpl_row_rec_comp_innodb.result @@ -25,4 +25,10 @@ INSERT INTO t1(c1) VALUES (NULL); UPDATE t1 SET c1= 0; include/diff_tables.inc [master:t1, slave:t1] DROP TABLE t1; +include/rpl_reset.inc +CREATE TABLE t1 (c1 int(11) NOT NULL, c2 int(11) NOT NULL, c3 int(11) DEFAULT '-1') ENGINE=InnoDB DEFAULT CHARSET=latin1; +INSERT INTO t1 VALUES (1,2,NULL); +UPDATE t1 SET c1=1, c2=2, c3=-1 WHERE c1=1 AND c2=2 AND ISNULL(c3); +include/diff_tables.inc [master:test.t1, slave:test.t1] +DROP TABLE t1; include/rpl_end.inc diff --git a/mysql-test/suite/rpl/r/rpl_row_rec_comp_myisam.result b/mysql-test/suite/rpl/r/rpl_row_rec_comp_myisam.result index e9ffcc927be..4dc7c0bc7a3 100644 --- a/mysql-test/suite/rpl/r/rpl_row_rec_comp_myisam.result +++ b/mysql-test/suite/rpl/r/rpl_row_rec_comp_myisam.result @@ -1,5 +1,14 @@ include/master-slave.inc [connection master] +## coverage purposes - Field_bits +## 1 X bit + 2 Null bits + 5 bits => last_null_bit_pos==0 +include/rpl_reset.inc +CREATE TABLE t1 (c1 bigint(20) DEFAULT 0, c2 bit(5)) ENGINE=MyISAM DEFAULT CHARSET=latin1; +INSERT INTO t1(c1,c2) VALUES (10, b'1'); +INSERT INTO t1(c1,c2) VALUES (NULL, b'1'); +UPDATE t1 SET c1= 0; +include/diff_tables.inc [master:t1, slave:t1] +DROP TABLE t1; ## case #1 - last_null_bit_pos==0 in record_compare without X bit include/rpl_reset.inc CREATE TABLE t1 (c1 bigint(20) DEFAULT 0, c2 bigint(20) DEFAULT 0, c3 bigint(20) DEFAULT 0, c4 varchar(1) DEFAULT '', c5 bigint(20) DEFAULT 0, c6 bigint(20) DEFAULT 0, c7 bigint(20) DEFAULT 0, c8 bigint(20) DEFAULT 0) ENGINE=MyISAM DEFAULT CHARSET=latin1; @@ -25,13 +34,10 @@ INSERT INTO t1(c1) VALUES (NULL); UPDATE t1 SET c1= 0; include/diff_tables.inc [master:t1, slave:t1] DROP TABLE t1; -## coverage purposes - Field_bits -## 1 X bit + 2 Null bits + 5 bits => last_null_bit_pos==0 include/rpl_reset.inc -CREATE TABLE t1 (c1 bigint(20) DEFAULT 0, c2 bit(5)) ENGINE=MyISAM DEFAULT CHARSET=latin1; -INSERT INTO t1(c1,c2) VALUES (10, b'1'); -INSERT INTO t1(c1,c2) VALUES (NULL, b'1'); -UPDATE t1 SET c1= 0; -include/diff_tables.inc [master:t1, slave:t1] +CREATE TABLE t1 (c1 int(11) NOT NULL, c2 int(11) NOT NULL, c3 int(11) DEFAULT '-1') ENGINE=MyISAM DEFAULT CHARSET=latin1; +INSERT INTO t1 VALUES (1,2,NULL); +UPDATE t1 SET c1=1, c2=2, c3=-1 WHERE c1=1 AND c2=2 AND ISNULL(c3); +include/diff_tables.inc [master:test.t1, slave:test.t1] DROP TABLE t1; include/rpl_end.inc diff --git a/mysql-test/suite/rpl/t/rpl_row_rec_comp_myisam.test b/mysql-test/suite/rpl/t/rpl_row_rec_comp_myisam.test index e40cd615ca6..f96603f69ed 100644 --- a/mysql-test/suite/rpl/t/rpl_row_rec_comp_myisam.test +++ b/mysql-test/suite/rpl/t/rpl_row_rec_comp_myisam.test @@ -1,12 +1,11 @@ -- source include/have_binlog_format_row.inc -- source include/master-slave.inc +-- let $engine= MyISAM # # BUG#52868 Wrong handling of NULL value during update, replication out of sync # --- let $engine= MyISAM --- source extra/rpl_tests/rpl_record_compare.test -- echo ## coverage purposes - Field_bits -- echo ## 1 X bit + 2 Null bits + 5 bits => last_null_bit_pos==0 @@ -28,4 +27,7 @@ UPDATE t1 SET c1= 0; -- connection master DROP TABLE t1; -- sync_slave_with_master + +-- source extra/rpl_tests/rpl_record_compare.test + --source include/rpl_end.inc diff --git a/sql/log_event.cc b/sql/log_event.cc index 0b938df1987..19f82b69048 100644 --- a/sql/log_event.cc +++ b/sql/log_event.cc @@ -8888,7 +8888,19 @@ static bool record_compare(TABLE *table) } } - if (table->s->blob_fields + table->s->varchar_fields == 0) + /** + Compare full record only if: + - there are no blob fields (otherwise we would also need + to compare blobs contents as well); + - there are no varchar fields (otherwise we would also need + to compare varchar contents as well); + - there are no null fields, otherwise NULLed fields + contents (i.e., the don't care bytes) may show arbitrary + values, depending on how each engine handles internally. + */ + if ((table->s->blob_fields + + table->s->varchar_fields + + table->s->null_fields) == 0) { result= cmp_record(table,record[1]); goto record_compare_exit; @@ -8903,13 +8915,22 @@ static bool record_compare(TABLE *table) goto record_compare_exit; } - /* Compare updated fields */ + /* Compare fields */ for (Field **ptr=table->field ; *ptr ; ptr++) { - if ((*ptr)->cmp_binary_offset(table->s->rec_buff_length)) + + /** + We only compare field contents that are not null. + NULL fields (i.e., their null bits) were compared + earlier. + */ + if (!(*(ptr))->is_null()) { - result= TRUE; - goto record_compare_exit; + if ((*ptr)->cmp_binary_offset(table->s->rec_buff_length)) + { + result= TRUE; + goto record_compare_exit; + } } } From dcf6b68d08acfbfdc3183b0a13f041af51573eb1 Mon Sep 17 00:00:00 2001 From: Georgi Kodinov Date: Fri, 25 Mar 2011 12:57:27 +0200 Subject: [PATCH 23/91] Bug #11766769: 59959: SMALL VALUES OF --MAX-ALLOWED-PACKET ARE NOT BEING HONORED max_allowed_packet works in conjunction with net_buffer_length. max_allowed_packet is an upper bound of net_buffer_length. So it doesn't make sense to set the upper limit lower than the value. Added a warning (using ER_UNKNOWN_ERRROR and a specific message) when this is done (in the log at startup and when setting either max_allowed_packet or the net_buffer_length variables) Added a test case. Fixed several tests that broke the above rule. --- mysql-test/r/packet.result | 1 + mysql-test/r/variables.result | 27 +++++++++++++ mysql-test/suite/rpl/r/rpl_packet.result | 2 + .../suite/rpl/t/rpl_loaddata_map-master.opt | 2 +- .../suite/rpl/t/rpl_loaddata_map-slave.opt | 2 +- mysql-test/t/variables.test | 26 +++++++++++++ sql/mysqld.cc | 8 ++++ sql/set_var.cc | 38 ++++++++++++++++++- 8 files changed, 102 insertions(+), 4 deletions(-) diff --git a/mysql-test/r/packet.result b/mysql-test/r/packet.result index ecbb47d4ee0..d673ab42691 100644 --- a/mysql-test/r/packet.result +++ b/mysql-test/r/packet.result @@ -3,6 +3,7 @@ set @net_buffer_length=@@global.net_buffer_length; set global max_allowed_packet=100; Warnings: Warning 1292 Truncated incorrect max_allowed_packet value: '100' +Warning 1105 The value of 'max_allowed_packet' should be no less than the value of 'net_buffer_length' set global net_buffer_length=100; Warnings: Warning 1292 Truncated incorrect net_buffer_length value: '100' diff --git a/mysql-test/r/variables.result b/mysql-test/r/variables.result index f4e2a8c08fc..af3b76b09f3 100644 --- a/mysql-test/r/variables.result +++ b/mysql-test/r/variables.result @@ -280,6 +280,7 @@ NET_BUFFER_LENGTH 1024 set global net_buffer_length=2000000000; Warnings: Warning 1292 Truncated incorrect net_buffer_length value: '2000000000' +Warning 1105 The value of 'max_allowed_packet' should be no less than the value of 'net_buffer_length' show global variables like 'net_buffer_length'; Variable_name Value net_buffer_length 1048576 @@ -502,6 +503,7 @@ set low_priority_updates=1; set global max_allowed_packet=100; Warnings: Warning 1292 Truncated incorrect max_allowed_packet value: '100' +Warning 1105 The value of 'max_allowed_packet' should be no less than the value of 'net_buffer_length' set global max_binlog_cache_size=100; Warnings: Warning 1292 Truncated incorrect max_binlog_cache_size value: '100' @@ -1059,6 +1061,8 @@ set global max_write_lock_count =default; set global myisam_data_pointer_size =@my_myisam_data_pointer_size; set global myisam_max_sort_file_size =@my_myisam_max_sort_file_size; set global net_buffer_length =@my_net_buffer_length; +Warnings: +Warning 1105 The value of 'max_allowed_packet' should be no less than the value of 'net_buffer_length' set global net_write_timeout =@my_net_write_timeout; set global net_read_timeout =@my_net_read_timeout; set global query_cache_limit =@my_query_cache_limit; @@ -1547,4 +1551,27 @@ SET @@global.max_binlog_cache_size=DEFAULT; SET @@global.max_join_size=DEFAULT; SET @@global.key_buffer_size=@kbs; SET @@global.key_cache_block_size=@kcbs; +# +# Bug #11766769 : 59959: SMALL VALUES OF --MAX-ALLOWED-PACKET +# ARE NOT BEING HONORED +# +CREATE TABLE t1 (a MEDIUMTEXT); +SET GLOBAL max_allowed_packet=2048; +Warnings: +Warning 1105 The value of 'max_allowed_packet' should be no less than the value of 'net_buffer_length' +SET GLOBAL net_buffer_length=4096; +Warnings: +Warning 1105 The value of 'max_allowed_packet' should be no less than the value of 'net_buffer_length' +SHOW SESSION VARIABLES LIKE 'max_allowed_packet'; +Variable_name Value +max_allowed_packet 2048 +SHOW SESSION VARIABLES LIKE 'net_buffer_length'; +Variable_name Value +net_buffer_length 4096 +ERROR 08S01: Got a packet bigger than 'max_allowed_packet' bytes +SELECT LENGTH(a) FROM t1; +LENGTH(a) +SET GLOBAL max_allowed_packet=default; +SET GLOBAL net_buffer_length=default; +DROP TABLE t1; End of 5.1 tests diff --git a/mysql-test/suite/rpl/r/rpl_packet.result b/mysql-test/suite/rpl/r/rpl_packet.result index 9239a718504..7a7f8141ac8 100644 --- a/mysql-test/suite/rpl/r/rpl_packet.result +++ b/mysql-test/suite/rpl/r/rpl_packet.result @@ -49,6 +49,8 @@ SET @max_allowed_packet_2= @@session.max_allowed_packet; ==== clean up ==== DROP TABLE t1; SET @@global.max_allowed_packet= 1024; +Warnings: +Warning 1105 The value of 'max_allowed_packet' should be no less than the value of 'net_buffer_length' SET @@global.net_buffer_length= 1024; DROP TABLE t1; RESET SLAVE; diff --git a/mysql-test/suite/rpl/t/rpl_loaddata_map-master.opt b/mysql-test/suite/rpl/t/rpl_loaddata_map-master.opt index 831680eb5ef..5fdeb855110 100644 --- a/mysql-test/suite/rpl/t/rpl_loaddata_map-master.opt +++ b/mysql-test/suite/rpl/t/rpl_loaddata_map-master.opt @@ -1 +1 @@ ---read_buffer_size=12K --max_allowed_packet=8K +--read_buffer_size=12K --max_allowed_packet=8K --net-buffer-length=8K diff --git a/mysql-test/suite/rpl/t/rpl_loaddata_map-slave.opt b/mysql-test/suite/rpl/t/rpl_loaddata_map-slave.opt index 95f55bcf7d8..7d404fae240 100644 --- a/mysql-test/suite/rpl/t/rpl_loaddata_map-slave.opt +++ b/mysql-test/suite/rpl/t/rpl_loaddata_map-slave.opt @@ -1 +1 @@ ---max_allowed_packet=8K +--max_allowed_packet=8K --net-buffer-length=8K diff --git a/mysql-test/t/variables.test b/mysql-test/t/variables.test index c61e2aa3708..383bdfc79a9 100644 --- a/mysql-test/t/variables.test +++ b/mysql-test/t/variables.test @@ -1304,4 +1304,30 @@ SET @@global.max_join_size=DEFAULT; SET @@global.key_buffer_size=@kbs; SET @@global.key_cache_block_size=@kcbs; + +--echo # +--echo # Bug #11766769 : 59959: SMALL VALUES OF --MAX-ALLOWED-PACKET +--echo # ARE NOT BEING HONORED +--echo # + +CREATE TABLE t1 (a MEDIUMTEXT); + +SET GLOBAL max_allowed_packet=2048; +SET GLOBAL net_buffer_length=4096; +CONNECT (con1,localhost,root,,test); +SHOW SESSION VARIABLES LIKE 'max_allowed_packet'; +SHOW SESSION VARIABLES LIKE 'net_buffer_length'; +--disable_query_log +--error ER_NET_PACKET_TOO_LARGE +INSERT INTO t1 VALUES ('123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890'); +--enable_query_log +SELECT LENGTH(a) FROM t1; + +CONNECTION default; +DISCONNECT con1; +SET GLOBAL max_allowed_packet=default; +SET GLOBAL net_buffer_length=default; +DROP TABLE t1; + + --echo End of 5.1 tests diff --git a/sql/mysqld.cc b/sql/mysqld.cc index 46376a08ec9..54850f36d10 100644 --- a/sql/mysqld.cc +++ b/sql/mysqld.cc @@ -8795,6 +8795,14 @@ static int get_options(int *argc,char **argv) opt_log_slow_slave_statements) && !opt_slow_log) sql_print_warning("options --log-slow-admin-statements, --log-queries-not-using-indexes and --log-slow-slave-statements have no effect if --log_slow_queries is not set"); + if (global_system_variables.net_buffer_length > + global_system_variables.max_allowed_packet) + { + sql_print_warning("net_buffer_length (%lu) is set to be larger " + "than max_allowed_packet (%lu). Please rectify.", + global_system_variables.net_buffer_length, + global_system_variables.max_allowed_packet); + } #if defined(HAVE_BROKEN_REALPATH) my_use_symdir=0; diff --git a/sql/set_var.cc b/sql/set_var.cc index 333fb90c795..76957e32536 100644 --- a/sql/set_var.cc +++ b/sql/set_var.cc @@ -147,6 +147,8 @@ static void sys_default_general_log_path(THD *thd, enum_var_type type); static bool sys_update_slow_log_path(THD *thd, set_var * var); static void sys_default_slow_log_path(THD *thd, enum_var_type type); static uchar *get_myisam_mmap_size(THD *thd); +static int check_max_allowed_packet(THD *thd, set_var *var); +static int check_net_buffer_length(THD *thd, set_var *var); /* Variable definition list @@ -360,7 +362,8 @@ static sys_var_const sys_lower_case_table_names(&vars, (uchar*) &lower_case_table_names); static sys_var_thd_ulong_session_readonly sys_max_allowed_packet(&vars, "max_allowed_packet", - &SV::max_allowed_packet); + &SV::max_allowed_packet, + check_max_allowed_packet); static sys_var_ulonglong_ptr sys_max_binlog_cache_size(&vars, "max_binlog_cache_size", &max_binlog_cache_size); static sys_var_long_ptr sys_max_binlog_size(&vars, "max_binlog_size", @@ -450,7 +453,8 @@ static sys_var_const sys_named_pipe(&vars, "named_pipe", /* purecov: end */ #endif static sys_var_thd_ulong_session_readonly sys_net_buffer_length(&vars, "net_buffer_length", - &SV::net_buffer_length); + &SV::net_buffer_length, + check_net_buffer_length); static sys_var_thd_ulong sys_net_read_timeout(&vars, "net_read_timeout", &SV::net_read_timeout, 0, fix_net_read_timeout); @@ -4312,6 +4316,36 @@ uchar *sys_var_event_scheduler::value_ptr(THD *thd, enum_var_type type, } #endif + +int +check_max_allowed_packet(THD *thd, set_var *var) +{ + longlong val= var->value->val_int(); + if (val < (longlong) global_system_variables.net_buffer_length) + { + push_warning(thd, MYSQL_ERROR::WARN_LEVEL_WARN, + ER_UNKNOWN_ERROR, + "The value of 'max_allowed_packet' should be no less than " + "the value of 'net_buffer_length'"); + } + return 0; +} + + +int +check_net_buffer_length(THD *thd, set_var *var) +{ + longlong val= var->value->val_int(); + if (val > (longlong) global_system_variables.max_allowed_packet) + { + push_warning(thd, MYSQL_ERROR::WARN_LEVEL_WARN, + ER_UNKNOWN_ERROR, + "The value of 'max_allowed_packet' should be no less than " + "the value of 'net_buffer_length'"); + } + return 0; +} + /**************************************************************************** Used templates ****************************************************************************/ From e0887df8e1127c0f1410b9d4ad61647cb5f93be2 Mon Sep 17 00:00:00 2001 From: Mattias Jonsson Date: Fri, 25 Mar 2011 12:36:02 +0100 Subject: [PATCH 24/91] Bug#11766249 bug#59316: PARTITIONING AND INDEX_MERGE MEMORY LEAK When executing row-ordered-retrieval index merge, the handler was cloned, but it used the wrong memory root, so instead of allocating memory on the thread/query's mem_root, it used the table's mem_root, resulting in non released memory in the table object, and was not freed until the table was closed. Solution was to ensure that memory used during cloning of a handler was allocated from the correct memory root. This was implemented by fixing handler::clone() to also take a name argument, so it can be used with partitioning. And in ha_partition only allocate the ha_partition's ref, and call the original ha_partition partitions clone() and set at cloned partitions. Fix of .bzrignore on Windows with VS 2010 --- .bzrignore | 12 ++ sql/ha_partition.cc | 230 ++++++++++++++++++++++-------- sql/ha_partition.h | 20 ++- sql/handler.cc | 6 +- sql/handler.h | 2 +- sql/opt_range.cc | 2 +- storage/heap/ha_heap.cc | 4 +- storage/heap/ha_heap.h | 2 +- storage/myisam/ha_myisam.cc | 5 +- storage/myisam/ha_myisam.h | 2 +- storage/myisammrg/ha_myisammrg.cc | 9 +- storage/myisammrg/ha_myisammrg.h | 2 +- 12 files changed, 214 insertions(+), 82 deletions(-) diff --git a/.bzrignore b/.bzrignore index 3d27c001e2b..9287e9499e3 100644 --- a/.bzrignore +++ b/.bzrignore @@ -37,7 +37,13 @@ *.user *.vcproj *.vcproj.cmake +*.vcxproj +*.vcxproj.filters */*.dir/* +*.dir +Debug +MySql.sdf +Win32 */*_pure_*warnings */.deps */.libs/* @@ -46,6 +52,7 @@ */minsizerel/* */release/* */relwithdebinfo/* +RelWithDebInfo *~ .*.swp ./CMakeCache.txt @@ -607,6 +614,7 @@ include/mysql_h.ic include/mysql_version.h include/mysqld_ername.h include/mysqld_error.h +include/mysqld_error.h.rule include/openssl include/readline include/readline/*.h @@ -1879,7 +1887,9 @@ scripts/mysql_find_rows scripts/mysql_fix_extensions scripts/mysql_fix_privilege_tables scripts/mysql_fix_privilege_tables.sql +scripts/mysql_fix_privilege_tables.sql.rule scripts/mysql_fix_privilege_tables_sql.c +scripts/mysql_fix_privilege_tables_sql.c.rule scripts/mysql_install_db scripts/mysql_secure_installation scripts/mysql_setpermission @@ -2116,6 +2126,7 @@ sql/handlerton.cc sql/html sql/latex sql/lex_hash.h +sql/lex_hash.h.rule sql/link_sources sql/max/* sql/message.h @@ -2147,6 +2158,7 @@ sql/sql_builtin.cc sql/sql_select.cc.orig sql/sql_yacc.cc sql/sql_yacc.h +sql/sql_yacc.h.rule sql/sql_yacc.output sql/sql_yacc.yy.orig sql/test_time diff --git a/sql/ha_partition.cc b/sql/ha_partition.cc index 7bcbd241541..946ecc652ef 100644 --- a/sql/ha_partition.cc +++ b/sql/ha_partition.cc @@ -163,10 +163,14 @@ const uint ha_partition::NO_CURRENT_PART_ID= 0xFFFFFFFF; */ ha_partition::ha_partition(handlerton *hton, TABLE_SHARE *share) - :handler(hton, share), m_part_info(NULL), m_create_handler(FALSE), - m_is_sub_partitioned(0) + :handler(hton, share) { DBUG_ENTER("ha_partition::ha_partition(table)"); + m_part_info= NULL; + m_create_handler= FALSE; + m_is_sub_partitioned= 0; + m_is_clone_of= NULL; + m_clone_mem_root= NULL; init_handler_variables(); DBUG_VOID_RETURN; } @@ -184,15 +188,46 @@ ha_partition::ha_partition(handlerton *hton, TABLE_SHARE *share) */ ha_partition::ha_partition(handlerton *hton, partition_info *part_info) - :handler(hton, NULL), m_part_info(part_info), m_create_handler(TRUE), - m_is_sub_partitioned(m_part_info->is_sub_partitioned()) + :handler(hton, NULL) { DBUG_ENTER("ha_partition::ha_partition(part_info)"); + DBUG_ASSERT(part_info); + m_part_info= part_info; + m_create_handler= TRUE; + m_is_sub_partitioned= m_part_info->is_sub_partitioned(); init_handler_variables(); - DBUG_ASSERT(m_part_info); DBUG_VOID_RETURN; } +/** + ha_partition constructor method used by ha_partition::clone() + + @param hton Handlerton (partition_hton) + @param share Table share object + @param part_info_arg partition_info to use + @param clone_arg ha_partition to clone + @param clme_mem_root_arg MEM_ROOT to use + + @return New partition handler +*/ + +ha_partition::ha_partition(handlerton *hton, TABLE_SHARE *share, + partition_info *part_info_arg, + ha_partition *clone_arg, + MEM_ROOT *clone_mem_root_arg) + :handler(hton, share) +{ + DBUG_ENTER("ha_partition::ha_partition(clone)"); + m_part_info= part_info_arg; + m_create_handler= TRUE; + m_is_sub_partitioned= m_part_info->is_sub_partitioned(); + m_is_clone_of= clone_arg; + m_clone_mem_root= clone_mem_root_arg; + init_handler_variables(); + m_tot_parts= clone_arg->m_tot_parts; + DBUG_ASSERT(m_tot_parts); + DBUG_VOID_RETURN; +} /* Initialize handler object @@ -244,7 +279,6 @@ void ha_partition::init_handler_variables() m_rec0= 0; m_curr_key_info[0]= NULL; m_curr_key_info[1]= NULL; - is_clone= FALSE, m_part_func_monotonicity_info= NON_MONOTONIC; auto_increment_lock= FALSE; auto_increment_safe_stmt_log_lock= FALSE; @@ -359,7 +393,8 @@ bool ha_partition::initialize_partition(MEM_ROOT *mem_root) */ DBUG_RETURN(0); } - else if (get_from_handler_file(table_share->normalized_path.str, mem_root)) + else if (get_from_handler_file(table_share->normalized_path.str, + mem_root, false)) { my_message(ER_UNKNOWN_ERROR, "Failed to read from the .par file", MYF(0)); DBUG_RETURN(1); @@ -1848,7 +1883,7 @@ uint ha_partition::del_ren_cre_table(const char *from, DBUG_RETURN(TRUE); } - if (get_from_handler_file(from, ha_thd()->mem_root)) + if (get_from_handler_file(from, ha_thd()->mem_root, false)) DBUG_RETURN(TRUE); DBUG_ASSERT(m_file_buffer); DBUG_PRINT("enter", ("from: (%s) to: (%s)", from, to)); @@ -2368,7 +2403,8 @@ error_end: partitions. */ -bool ha_partition::get_from_handler_file(const char *name, MEM_ROOT *mem_root) +bool ha_partition::get_from_handler_file(const char *name, MEM_ROOT *mem_root, + bool clone) { char buff[FN_REFLEN], *address_tot_name_len; File file; @@ -2403,15 +2439,18 @@ bool ha_partition::get_from_handler_file(const char *name, MEM_ROOT *mem_root) m_tot_parts= uint4korr((file_buffer) + 8); DBUG_PRINT("info", ("No of parts = %u", m_tot_parts)); tot_partition_words= (m_tot_parts + 3) / 4; - engine_array= (handlerton **) my_alloca(m_tot_parts * sizeof(handlerton*)); - for (i= 0; i < m_tot_parts; i++) + if (!clone) { - engine_array[i]= ha_resolve_by_legacy_type(ha_thd(), - (enum legacy_db_type) - *(uchar *) ((file_buffer) + - 12 + i)); - if (!engine_array[i]) - goto err3; + engine_array= (handlerton **) my_alloca(m_tot_parts * sizeof(handlerton*)); + for (i= 0; i < m_tot_parts; i++) + { + engine_array[i]= ha_resolve_by_legacy_type(ha_thd(), + (enum legacy_db_type) + *(uchar *) ((file_buffer) + + 12 + i)); + if (!engine_array[i]) + goto err3; + } } address_tot_name_len= file_buffer + 12 + 4 * tot_partition_words; tot_name_words= (uint4korr(address_tot_name_len) + 3) / 4; @@ -2422,16 +2461,19 @@ bool ha_partition::get_from_handler_file(const char *name, MEM_ROOT *mem_root) m_file_buffer= file_buffer; // Will be freed in clear_handler_file() m_name_buffer_ptr= name_buffer_ptr; - if (!(m_engine_array= (plugin_ref*) - my_malloc(m_tot_parts * sizeof(plugin_ref), MYF(MY_WME)))) - goto err3; + if (!clone) + { + if (!(m_engine_array= (plugin_ref*) + my_malloc(m_tot_parts * sizeof(plugin_ref), MYF(MY_WME)))) + goto err3; - for (i= 0; i < m_tot_parts; i++) - m_engine_array[i]= ha_lock_engine(NULL, engine_array[i]); + for (i= 0; i < m_tot_parts; i++) + m_engine_array[i]= ha_lock_engine(NULL, engine_array[i]); - my_afree((gptr) engine_array); + my_afree((gptr) engine_array); + } - if (!m_file && create_handlers(mem_root)) + if (!clone && !m_file && create_handlers(mem_root)) { clear_handler_file(); DBUG_RETURN(TRUE); @@ -2439,7 +2481,8 @@ bool ha_partition::get_from_handler_file(const char *name, MEM_ROOT *mem_root) DBUG_RETURN(FALSE); err3: - my_afree((gptr) engine_array); + if (!clone) + my_afree((gptr) engine_array); err2: my_free(file_buffer, MYF(0)); err1: @@ -2491,13 +2534,13 @@ void ha_data_partition_destroy(void *ha_data) int ha_partition::open(const char *name, int mode, uint test_if_locked) { - char *name_buffer_ptr= m_name_buffer_ptr; + char *name_buffer_ptr; int error; uint alloc_len; handler **file; char name_buff[FN_REFLEN]; bool is_not_tmp_table= (table_share->tmp_table == NO_TMP_TABLE); - ulonglong check_table_flags= 0; + ulonglong check_table_flags; DBUG_ENTER("ha_partition::open"); DBUG_ASSERT(table->s == table_share); @@ -2505,8 +2548,9 @@ int ha_partition::open(const char *name, int mode, uint test_if_locked) m_mode= mode; m_open_test_lock= test_if_locked; m_part_field_array= m_part_info->full_part_field_array; - if (get_from_handler_file(name, &table->mem_root)) + if (get_from_handler_file(name, &table->mem_root, test(m_is_clone_of))) DBUG_RETURN(1); + name_buffer_ptr= m_name_buffer_ptr; m_start_key.length= 0; m_rec0= table->record[0]; m_rec_length= table_share->reclength; @@ -2542,8 +2586,9 @@ int ha_partition::open(const char *name, int mode, uint test_if_locked) DBUG_RETURN(1); bitmap_clear_all(&m_bulk_insert_started); /* Initialize the bitmap we use to determine what partitions are used */ - if (!is_clone) + if (!m_is_clone_of) { + DBUG_ASSERT(!m_clone_mem_root); if (bitmap_init(&(m_part_info->used_partitions), NULL, m_tot_parts, TRUE)) { bitmap_free(&m_bulk_insert_started); @@ -2552,32 +2597,70 @@ int ha_partition::open(const char *name, int mode, uint test_if_locked) bitmap_set_all(&(m_part_info->used_partitions)); } + if (m_is_clone_of) + { + uint i; + DBUG_ASSERT(m_clone_mem_root); + /* Allocate an array of handler pointers for the partitions handlers. */ + alloc_len= (m_tot_parts + 1) * sizeof(handler*); + if (!(m_file= (handler **) alloc_root(m_clone_mem_root, alloc_len))) + goto err_alloc; + memset(m_file, 0, alloc_len); + /* + Populate them by cloning the original partitions. This also opens them. + Note that file->ref is allocated too. + */ + file= m_is_clone_of->m_file; + for (i= 0; i < m_tot_parts; i++) + { + create_partition_name(name_buff, name, name_buffer_ptr, NORMAL_PART_NAME, + FALSE); + if (!(m_file[i]= file[i]->clone((const char*) name_buff, + m_clone_mem_root))) + { + error= HA_ERR_INITIALIZATION; + file= &m_file[i]; + goto err_handler; + } + name_buffer_ptr+= strlen(name_buffer_ptr) + 1; + } + } + else + { + file= m_file; + do + { + create_partition_name(name_buff, name, name_buffer_ptr, NORMAL_PART_NAME, + FALSE); + if ((error= (*file)->ha_open(table, (const char*) name_buff, mode, + test_if_locked))) + goto err_handler; + m_no_locks+= (*file)->lock_count(); + name_buffer_ptr+= strlen(name_buffer_ptr) + 1; + } while (*(++file)); + } + file= m_file; + ref_length= (*file)->ref_length; + check_table_flags= (((*file)->ha_table_flags() & + ~(PARTITION_DISABLED_TABLE_FLAGS)) | + (PARTITION_ENABLED_TABLE_FLAGS)); + file++; do { - create_partition_name(name_buff, name, name_buffer_ptr, NORMAL_PART_NAME, - FALSE); - if ((error= (*file)->ha_open(table, (const char*) name_buff, mode, - test_if_locked))) - goto err_handler; - m_no_locks+= (*file)->lock_count(); - name_buffer_ptr+= strlen(name_buffer_ptr) + 1; + DBUG_ASSERT(ref_length >= (*file)->ref_length); set_if_bigger(ref_length, ((*file)->ref_length)); /* Verify that all partitions have the same set of table flags. Mask all flags that partitioning enables/disables. */ - if (!check_table_flags) - { - check_table_flags= (((*file)->ha_table_flags() & - ~(PARTITION_DISABLED_TABLE_FLAGS)) | - (PARTITION_ENABLED_TABLE_FLAGS)); - } - else if (check_table_flags != (((*file)->ha_table_flags() & - ~(PARTITION_DISABLED_TABLE_FLAGS)) | - (PARTITION_ENABLED_TABLE_FLAGS))) + if (check_table_flags != (((*file)->ha_table_flags() & + ~(PARTITION_DISABLED_TABLE_FLAGS)) | + (PARTITION_ENABLED_TABLE_FLAGS))) { error= HA_ERR_INITIALIZATION; + /* set file to last handler, so all of them is closed */ + file = &m_file[m_tot_parts - 1]; goto err_handler; } } while (*(++file)); @@ -2589,6 +2672,7 @@ int ha_partition::open(const char *name, int mode, uint test_if_locked) */ ref_length+= PARTITION_BYTES_IN_POS; m_ref_length= ref_length; + /* Release buffer read from .par file. It will not be reused again after being opened once. @@ -2646,25 +2730,55 @@ err_handler: DEBUG_SYNC(ha_thd(), "partition_open_error"); while (file-- != m_file) (*file)->close(); +err_alloc: bitmap_free(&m_bulk_insert_started); - if (!is_clone) + if (!m_is_clone_of) bitmap_free(&(m_part_info->used_partitions)); DBUG_RETURN(error); } -handler *ha_partition::clone(MEM_ROOT *mem_root) + +/** + Clone the open and locked partitioning handler. + + @param mem_root MEM_ROOT to use. + + @return Pointer to the successfully created clone or NULL + + @details + This function creates a new ha_partition handler as a clone/copy. The + original (this) must already be opened and locked. The clone will use + the originals m_part_info. + It also allocates memory to ref + ref_dup. + In ha_partition::open() it will clone its original handlers partitions + which will allocate then om the correct MEM_ROOT and also open them. +*/ + +handler *ha_partition::clone(const char *name, MEM_ROOT *mem_root) { - handler *new_handler= get_new_handler(table->s, mem_root, - table->s->db_type()); - ((ha_partition*)new_handler)->m_part_info= m_part_info; - ((ha_partition*)new_handler)->is_clone= TRUE; - if (new_handler && !new_handler->ha_open(table, - table->s->normalized_path.str, - table->db_stat, - HA_OPEN_IGNORE_IF_LOCKED)) - return new_handler; - return NULL; + ha_partition *new_handler; + + DBUG_ENTER("ha_partition::clone"); + new_handler= new (mem_root) ha_partition(ht, table_share, m_part_info, + this, mem_root); + if (!new_handler) + DBUG_RETURN(NULL); + + /* + Allocate new_handler->ref here because otherwise ha_open will allocate it + on this->table->mem_root and we will not be able to reclaim that memory + when the clone handler object is destroyed. + */ + new_handler->ref= (uchar*) alloc_root(mem_root, ALIGN_SIZE(m_ref_length)*2); + if (!new_handler->ref) + DBUG_RETURN(NULL); + + if (new_handler->ha_open(table, name, + table->db_stat, HA_OPEN_IGNORE_IF_LOCKED)) + DBUG_RETURN(NULL); + + DBUG_RETURN((handler*) new_handler); } @@ -2695,7 +2809,7 @@ int ha_partition::close(void) DBUG_ASSERT(table->s == table_share); delete_queue(&m_queue); bitmap_free(&m_bulk_insert_started); - if (!is_clone) + if (!m_is_clone_of) bitmap_free(&(m_part_info->used_partitions)); file= m_file; diff --git a/sql/ha_partition.h b/sql/ha_partition.h index 76b91e160ca..a38d56af8ff 100644 --- a/sql/ha_partition.h +++ b/sql/ha_partition.h @@ -133,6 +133,13 @@ private: bool m_is_sub_partitioned; // Is subpartitioned bool m_ordered_scan_ongoing; + /* + If set, this object was created with ha_partition::clone and doesn't + "own" the m_part_info structure. + */ + ha_partition *m_is_clone_of; + MEM_ROOT *m_clone_mem_root; + /* We keep track if all underlying handlers are MyISAM since MyISAM has a great number of extra flags not needed by other handlers. @@ -169,11 +176,6 @@ private: PARTITION_SHARE *share; /* Shared lock info */ #endif - /* - TRUE <=> this object was created with ha_partition::clone and doesn't - "own" the m_part_info structure. - */ - bool is_clone; bool auto_increment_lock; /**< lock reading/updating auto_inc */ /** Flag to keep the auto_increment lock through out the statement. @@ -186,7 +188,7 @@ private: /** used for prediction of start_bulk_insert rows */ enum_monotonicity_info m_part_func_monotonicity_info; public: - handler *clone(MEM_ROOT *mem_root); + handler *clone(const char *name, MEM_ROOT *mem_root); virtual void set_part_info(partition_info *part_info) { m_part_info= part_info; @@ -205,6 +207,10 @@ public: */ ha_partition(handlerton *hton, TABLE_SHARE * table); ha_partition(handlerton *hton, partition_info * part_info); + ha_partition(handlerton *hton, TABLE_SHARE *share, + partition_info *part_info_arg, + ha_partition *clone_arg, + MEM_ROOT *clone_mem_root_arg); ~ha_partition(); /* A partition handler has no characteristics in itself. It only inherits @@ -275,7 +281,7 @@ private: And one method to read it in. */ bool create_handler_file(const char *name); - bool get_from_handler_file(const char *name, MEM_ROOT *mem_root); + bool get_from_handler_file(const char *name, MEM_ROOT *mem_root, bool clone); bool new_handlers_from_part_info(MEM_ROOT *mem_root); bool create_handlers(MEM_ROOT *mem_root); void clear_handler_file(); diff --git a/sql/handler.cc b/sql/handler.cc index 5968a78b587..8adb8e061a3 100644 --- a/sql/handler.cc +++ b/sql/handler.cc @@ -2037,9 +2037,9 @@ int ha_delete_table(THD *thd, handlerton *table_type, const char *path, /**************************************************************************** ** General handler functions ****************************************************************************/ -handler *handler::clone(MEM_ROOT *mem_root) +handler *handler::clone(const char *name, MEM_ROOT *mem_root) { - handler *new_handler= get_new_handler(table->s, mem_root, table->s->db_type()); + handler *new_handler= get_new_handler(table->s, mem_root, ht); /* Allocate handler->ref here because otherwise ha_open will allocate it on this->table->mem_root and we will not be able to reclaim that memory @@ -2048,7 +2048,7 @@ handler *handler::clone(MEM_ROOT *mem_root) if (!(new_handler->ref= (uchar*) alloc_root(mem_root, ALIGN_SIZE(ref_length)*2))) return NULL; if (new_handler && !new_handler->ha_open(table, - table->s->normalized_path.str, + name, table->db_stat, HA_OPEN_IGNORE_IF_LOCKED)) return new_handler; diff --git a/sql/handler.h b/sql/handler.h index dabc179079a..3de901dec62 100644 --- a/sql/handler.h +++ b/sql/handler.h @@ -1166,7 +1166,7 @@ public: DBUG_ASSERT(locked == FALSE); /* TODO: DBUG_ASSERT(inited == NONE); */ } - virtual handler *clone(MEM_ROOT *mem_root); + virtual handler *clone(const char *name, MEM_ROOT *mem_root); /** This is called after create to allow us to set up cached variables */ void init() { diff --git a/sql/opt_range.cc b/sql/opt_range.cc index 9edd4f58f04..fd71166dc23 100644 --- a/sql/opt_range.cc +++ b/sql/opt_range.cc @@ -1335,7 +1335,7 @@ int QUICK_RANGE_SELECT::init_ror_merged_scan(bool reuse_handler) } thd= head->in_use; - if (!(file= head->file->clone(thd->mem_root))) + if (!(file= head->file->clone(head->s->normalized_path.str, thd->mem_root))) { /* Manually set the error flag. Note: there seems to be quite a few diff --git a/storage/heap/ha_heap.cc b/storage/heap/ha_heap.cc index fb7c13e4e41..9f29dee2030 100644 --- a/storage/heap/ha_heap.cc +++ b/storage/heap/ha_heap.cc @@ -142,11 +142,11 @@ int ha_heap::close(void) DESCRIPTION Do same as default implementation but use file->s->name instead of table->s->path. This is needed by Windows where the clone() call sees - '/'-delimited path in table->s->path, while ha_peap::open() was called + '/'-delimited path in table->s->path, while ha_heap::open() was called with '\'-delimited path. */ -handler *ha_heap::clone(MEM_ROOT *mem_root) +handler *ha_heap::clone(const char *name, MEM_ROOT *mem_root) { handler *new_handler= get_new_handler(table->s, mem_root, table->s->db_type()); if (new_handler && !new_handler->ha_open(table, file->s->name, table->db_stat, diff --git a/storage/heap/ha_heap.h b/storage/heap/ha_heap.h index 22722129f4c..69751101645 100644 --- a/storage/heap/ha_heap.h +++ b/storage/heap/ha_heap.h @@ -34,7 +34,7 @@ class ha_heap: public handler public: ha_heap(handlerton *hton, TABLE_SHARE *table); ~ha_heap() {} - handler *clone(MEM_ROOT *mem_root); + handler *clone(const char *name, MEM_ROOT *mem_root); const char *table_type() const { return (table->in_use->variables.sql_mode & MODE_MYSQL323) ? diff --git a/storage/myisam/ha_myisam.cc b/storage/myisam/ha_myisam.cc index 2650cc850a8..e5b657a4630 100644 --- a/storage/myisam/ha_myisam.cc +++ b/storage/myisam/ha_myisam.cc @@ -552,9 +552,10 @@ ha_myisam::ha_myisam(handlerton *hton, TABLE_SHARE *table_arg) can_enable_indexes(1) {} -handler *ha_myisam::clone(MEM_ROOT *mem_root) +handler *ha_myisam::clone(const char *name, MEM_ROOT *mem_root) { - ha_myisam *new_handler= static_cast (handler::clone(mem_root)); + ha_myisam *new_handler= static_cast (handler::clone(name, + mem_root)); if (new_handler) new_handler->file->state= file->state; return new_handler; diff --git a/storage/myisam/ha_myisam.h b/storage/myisam/ha_myisam.h index 55a5eac92de..54801bfd0b8 100644 --- a/storage/myisam/ha_myisam.h +++ b/storage/myisam/ha_myisam.h @@ -44,7 +44,7 @@ class ha_myisam: public handler public: ha_myisam(handlerton *hton, TABLE_SHARE *table_arg); ~ha_myisam() {} - handler *clone(MEM_ROOT *mem_root); + handler *clone(const char *name, MEM_ROOT *mem_root); const char *table_type() const { return "MyISAM"; } const char *index_type(uint key_number); const char **bas_ext() const; diff --git a/storage/myisammrg/ha_myisammrg.cc b/storage/myisammrg/ha_myisammrg.cc index 4c8d45d1fe1..3beabd83512 100644 --- a/storage/myisammrg/ha_myisammrg.cc +++ b/storage/myisammrg/ha_myisammrg.cc @@ -459,8 +459,7 @@ int ha_myisammrg::open(const char *name, int mode __attribute__((unused)), problem because all locking is handled by the original MERGE table from which this is cloned of. */ - if (!(file= myrg_open(table->s->normalized_path.str, table->db_stat, - HA_OPEN_IGNORE_IF_LOCKED))) + if (!(file= myrg_open(name, table->db_stat, HA_OPEN_IGNORE_IF_LOCKED))) { DBUG_PRINT("error", ("my_errno %d", my_errno)); DBUG_RETURN(my_errno ? my_errno : -1); @@ -484,7 +483,7 @@ int ha_myisammrg::open(const char *name, int mode __attribute__((unused)), @return A cloned handler instance. */ -handler *ha_myisammrg::clone(MEM_ROOT *mem_root) +handler *ha_myisammrg::clone(const char *name, MEM_ROOT *mem_root) { MYRG_TABLE *u_table,*newu_table; ha_myisammrg *new_handler= @@ -505,8 +504,8 @@ handler *ha_myisammrg::clone(MEM_ROOT *mem_root) return NULL; } - if (new_handler->ha_open(table, table->s->normalized_path.str, table->db_stat, - HA_OPEN_IGNORE_IF_LOCKED)) + if (new_handler->ha_open(table, name, table->db_stat, + HA_OPEN_IGNORE_IF_LOCKED)) { delete new_handler; return NULL; diff --git a/storage/myisammrg/ha_myisammrg.h b/storage/myisammrg/ha_myisammrg.h index 790aa15e90a..a1272c633a1 100644 --- a/storage/myisammrg/ha_myisammrg.h +++ b/storage/myisammrg/ha_myisammrg.h @@ -62,7 +62,7 @@ class ha_myisammrg: public handler int open(const char *name, int mode, uint test_if_locked); int attach_children(void); int detach_children(void); - virtual handler *clone(MEM_ROOT *mem_root); + virtual handler *clone(const char *name, MEM_ROOT *mem_root); int close(void); int write_row(uchar * buf); int update_row(const uchar * old_data, uchar * new_data); From f1b638d33cdf95b70fa925cce304864c96fdf7ee Mon Sep 17 00:00:00 2001 From: Sven Sandberg Date: Fri, 25 Mar 2011 15:16:13 +0100 Subject: [PATCH 25/91] BUG#11766427, BUG#59539: Filter by server id in mysqlbinlog fails Problem: mysqlbinlog --server-id may filter out Format_description_log_events. If mysqlbinlog does not process the Format_description_log_event, then mysqlbinlog cannot read the rest of the binary log correctly. This can have the effect that mysqlbinlog crashes, generates an error, or generates output that causes mysqld to crash, generate an error, or corrupt data. Fix: Never filter out Format_description_log_events. Also, never filter out Rotate_log_events. client/mysqlbinlog.cc: Process Format_description_log_events even when the server_id does not match the number given by --server-id. mysql-test/t/mysqlbinlog.test: Add test case. --- client/mysqlbinlog.cc | 14 +++++++++++--- mysql-test/r/mysqlbinlog.result | 12 ++++++++++++ mysql-test/t/mysqlbinlog.test | 20 ++++++++++++++++++++ 3 files changed, 43 insertions(+), 3 deletions(-) diff --git a/client/mysqlbinlog.cc b/client/mysqlbinlog.cc index dec3f142798..30a8bddc17c 100644 --- a/client/mysqlbinlog.cc +++ b/client/mysqlbinlog.cc @@ -705,10 +705,18 @@ Exit_status process_event(PRINT_EVENT_INFO *print_event_info, Log_event *ev, */ start_datetime= 0; offset= 0; // print everything and protect against cycling rec_count + /* + Skip events according to the --server-id flag. However, don't + skip format_description or rotate events, because they they + are really "global" events that are relevant for the entire + binlog, even if they have a server_id. Also, we have to read + the format_description event so that we can parse subsequent + events. + */ + if (ev_type != ROTATE_EVENT && + server_id && (server_id != ev->server_id)) + goto end; } - if (server_id && (server_id != ev->server_id)) - /* skip just this event, continue processing the log. */ - goto end; if (((my_time_t)(ev->when) >= stop_datetime) || (pos >= stop_position_mot)) { diff --git a/mysql-test/r/mysqlbinlog.result b/mysql-test/r/mysqlbinlog.result index 1f2e1ed67e0..45068ddfaec 100644 --- a/mysql-test/r/mysqlbinlog.result +++ b/mysql-test/r/mysqlbinlog.result @@ -658,3 +658,15 @@ master-bin.000002 # Query # # CREATE DATABASE test1 master-bin.000002 # Query # # use `test1`; CREATE TABLE t1(id int) master-bin.000002 # Query # # use `test1`; DROP TABLE t1 master-bin.000002 # Query # # DROP DATABASE test1 +RESET MASTER; +USE test; +CREATE TABLE t1 (a INT); +SET GLOBAL SERVER_ID = 2; +DROP TABLE t1; +FLUSH LOGS; +SHOW TABLES IN test; +Tables_in_test +t1 +SHOW TABLES IN test; +Tables_in_test +SET GLOBAL SERVER_ID = 1; diff --git a/mysql-test/t/mysqlbinlog.test b/mysql-test/t/mysqlbinlog.test index d5dd3052269..98ee18b554e 100644 --- a/mysql-test/t/mysqlbinlog.test +++ b/mysql-test/t/mysqlbinlog.test @@ -501,3 +501,23 @@ exec $MYSQL_BINLOG $MYSQLD_DATADIR/$master_binlog | $MYSQL test 2>&1; let $binlog_file= query_get_value(SHOW MASTER STATUS, File, 1); source include/show_binlog_events.inc; +# +# BUG#11766427 BUG#59530: Filter by server id in mysqlbinlog fails +# This test checks that the format description log event is not +# filtered out by the --server-id option. +# +RESET MASTER; +USE test; +CREATE TABLE t1 (a INT); +--let $old_server_id= `SELECT @@GLOBAL.SERVER_ID` +SET GLOBAL SERVER_ID = 2; +DROP TABLE t1; +--let $master_binlog= query_get_value(SHOW MASTER STATUS, File, 1) +FLUSH LOGS; +# The following should only create t1, not drop it. +--exec $MYSQL_BINLOG --server-id=1 $MYSQLD_DATADIR/$master_binlog | $MYSQL +SHOW TABLES IN test; +# The following should only drop t1, not create it. +--exec $MYSQL_BINLOG --server-id=2 $MYSQLD_DATADIR/$master_binlog | $MYSQL +SHOW TABLES IN test; +eval SET GLOBAL SERVER_ID = $old_server_id; From d499851be03a2a20f7cb230d9b2d69e169aa81c8 Mon Sep 17 00:00:00 2001 From: Sergey Glukhov Date: Mon, 28 Mar 2011 11:53:18 +0400 Subject: [PATCH 26/91] Bug#11766112 59151:UNINITIALIZED VALUES IN EXTRACT_DATE_TIME WITH STR_TO_DATE(SPACE(..) ... Valgrind warining happens due to missing 'end of the string' check. The fix is to check if we reached the end of the string. mysql-test/r/func_time.result: test case mysql-test/t/func_time.test: test case sql/item_timefunc.cc: check if we reached the end of the string after leading spaces skipping. --- mysql-test/r/func_time.result | 6 ++++++ mysql-test/t/func_time.test | 6 ++++++ sql/item_timefunc.cc | 4 ++-- 3 files changed, 14 insertions(+), 2 deletions(-) diff --git a/mysql-test/r/func_time.result b/mysql-test/r/func_time.result index 0d4ce9414e5..f63860039d7 100644 --- a/mysql-test/r/func_time.result +++ b/mysql-test/r/func_time.result @@ -1375,4 +1375,10 @@ Warning 1292 Truncated incorrect time value: '' Warning 1292 Truncated incorrect time value: '' Warning 1292 Truncated incorrect time value: '' DROP TABLE t1; +# +# Bug#11766112 59151:UNINITIALIZED VALUES IN EXTRACT_DATE_TIME WITH STR_TO_DATE(SPACE(..) ... +# +SELECT STR_TO_DATE(SPACE(2),'1'); +STR_TO_DATE(SPACE(2),'1') +0000-00-00 End of 5.1 tests diff --git a/mysql-test/t/func_time.test b/mysql-test/t/func_time.test index f32110ef87c..c48351d33f2 100644 --- a/mysql-test/t/func_time.test +++ b/mysql-test/t/func_time.test @@ -881,4 +881,10 @@ INSERT INTO t1 VALUES (''),(''); SELECT COUNT(*) FROM t1 GROUP BY TIME_TO_SEC(a); DROP TABLE t1; +--echo # +--echo # Bug#11766112 59151:UNINITIALIZED VALUES IN EXTRACT_DATE_TIME WITH STR_TO_DATE(SPACE(..) ... +--echo # + +SELECT STR_TO_DATE(SPACE(2),'1'); + --echo End of 5.1 tests diff --git a/sql/item_timefunc.cc b/sql/item_timefunc.cc index 6335199b8de..71b2baf4fee 100644 --- a/sql/item_timefunc.cc +++ b/sql/item_timefunc.cc @@ -294,8 +294,8 @@ static bool extract_date_time(DATE_TIME_FORMAT *format, for (; ptr != end && val != val_end; ptr++) { /* Skip pre-space between each argument */ - while (val != val_end && my_isspace(cs, *val)) - val++; + if ((val+= cs->cset->scan(cs, val, val_end, MY_SEQ_SPACES)) >= val_end) + break; if (*ptr == '%' && ptr+1 != end) { From ff23f5360ee328bd6adb14436e68e080cfe1d110 Mon Sep 17 00:00:00 2001 From: Sergey Glukhov Date: Mon, 28 Mar 2011 12:28:30 +0400 Subject: [PATCH 27/91] Bug#11766424 59527: DECIMAL_BIN_SIZE: ASSERTION `SCALE >= 0 && PRECISION > 0 && SCALE <= PRE Assertion happens due to missing initialization of unsigned_flag for Item_func_set_user_var object. It leads to incorrect calculation of decimal field size. The fix is to add initialization of unsigned_flag. mysql-test/r/variables.result: test case mysql-test/t/variables.test: test case sql/item_func.cc: add initialization of unsigned_flag. --- mysql-test/r/variables.result | 16 ++++++++++++++++ mysql-test/t/variables.test | 13 +++++++++++++ sql/item_func.cc | 1 + 3 files changed, 30 insertions(+) diff --git a/mysql-test/r/variables.result b/mysql-test/r/variables.result index af3b76b09f3..f92e1dec4c9 100644 --- a/mysql-test/r/variables.result +++ b/mysql-test/r/variables.result @@ -1547,6 +1547,22 @@ Warning 1292 Truncated incorrect key_cache_block_size value: '0' select @@max_long_data_size; @@max_long_data_size 1048576 +# +# Bug#11766424 59527: DECIMAL_BIN_SIZE: ASSERTION `SCALE >= 0 && PRECISION > 0 && SCALE <= PRE +# +CREATE TABLE t1(f1 DECIMAL(1,1) UNSIGNED); +INSERT INTO t1 VALUES (0.2),(0.1); +SELECT 1 FROM t1 GROUP BY @a:= (SELECT ROUND(f1) FROM t1 WHERE @a=f1); +1 +1 +DROP TABLE t1; +CREATE TABLE t1 AS SELECT @a:= CAST(1 AS UNSIGNED) AS a; +SHOW CREATE TABLE t1; +Table Create Table +t1 CREATE TABLE `t1` ( + `a` int(1) unsigned NOT NULL DEFAULT '0' +) ENGINE=MyISAM DEFAULT CHARSET=latin1 +DROP TABLE t1; SET @@global.max_binlog_cache_size=DEFAULT; SET @@global.max_join_size=DEFAULT; SET @@global.key_buffer_size=@kbs; diff --git a/mysql-test/t/variables.test b/mysql-test/t/variables.test index 383bdfc79a9..8f111e7cf3b 100644 --- a/mysql-test/t/variables.test +++ b/mysql-test/t/variables.test @@ -1298,6 +1298,19 @@ SET @@global.key_cache_block_size=0; # select @@max_long_data_size; +--echo # +--echo # Bug#11766424 59527: DECIMAL_BIN_SIZE: ASSERTION `SCALE >= 0 && PRECISION > 0 && SCALE <= PRE +--echo # + +CREATE TABLE t1(f1 DECIMAL(1,1) UNSIGNED); +INSERT INTO t1 VALUES (0.2),(0.1); +SELECT 1 FROM t1 GROUP BY @a:= (SELECT ROUND(f1) FROM t1 WHERE @a=f1); +DROP TABLE t1; + +CREATE TABLE t1 AS SELECT @a:= CAST(1 AS UNSIGNED) AS a; +SHOW CREATE TABLE t1; +DROP TABLE t1; + # cleanup SET @@global.max_binlog_cache_size=DEFAULT; SET @@global.max_join_size=DEFAULT; diff --git a/sql/item_func.cc b/sql/item_func.cc index efae928a8b6..d4fd2c94e1d 100644 --- a/sql/item_func.cc +++ b/sql/item_func.cc @@ -3840,6 +3840,7 @@ Item_func_set_user_var::fix_length_and_dec() maybe_null=args[0]->maybe_null; max_length=args[0]->max_length; decimals=args[0]->decimals; + unsigned_flag= args[0]->unsigned_flag; collation.set(args[0]->collation.collation, DERIVATION_IMPLICIT); } From 08d598fb98e0f7e5c34f47c6510577a375d0fab2 Mon Sep 17 00:00:00 2001 From: Vasil Dimov Date: Mon, 28 Mar 2011 11:34:12 +0300 Subject: [PATCH 28/91] Store the '\0'-terminated query in row->trx_query This problem was introduced in marko.makela@oracle.com-20100514130815-ym7j7cfu88ro6km4 and is probably the reason for the following valgrind warning: from http://bugs.mysql.com/52691 , http://bugs.mysql.com/file.php?id=16880 : Version: '5.6.3-m5-valgrind-max-debug' socket: '/tmp/mysql.sock' port: 3306 Source distribution ==14947== Thread 18: ==14947== Conditional jump or move depends on uninitialised value(s) ==14947== at 0x4A06318: __GI_strlen (mc_replace_strmem.c:284) ==14947== by 0x9F3D7A: fill_innodb_trx_from_cache(trx_i_s_cache_struct*, THD*, TABLE*) (i_s.cc:591) ==14947== by 0x9F4D7D: trx_i_s_common_fill_table(THD*, TABLE_LIST*, Item*) (i_s.cc:1238) ==14947== by 0x7689F3: get_schema_tables_result(JOIN*, enum_schema_table_state) (sql_show.cc:6745) ==14947== by 0x715A75: JOIN::exec() (sql_select.cc:2861) ==14947== by 0x7185BD: mysql_select(THD*, Item***, TABLE_LIST*, unsigned int, List&, Item*, unsigned int, st_order*, st_order*, Item*, st_order*, unsigned long long, select_result*, st_select_lex_unit*, st_select_lex*) (sql_select.cc:3609) ==14947== by 0x70E823: handle_select(THD*, LEX*, select_result*, unsigned long) (sql_select.cc:319) ==14947== by 0x6F2305: execute_sqlcom_select(THD*, TABLE_LIST*) (sql_parse.cc:4557) ==14947== by 0x6EAED4: mysql_execute_command(THD*) (sql_parse.cc:2135) ==14947== by 0x6F44C9: mysql_parse(THD*, char*, unsigned int, Parser_state*) (sql_parse.cc:5597) ==14947== by 0x6E864B: dispatch_command(enum_server_command, THD*, char*, unsigned int) (sql_parse.cc:1093) ==14947== by 0x6E785E: do_command(THD*) (sql_parse.cc:815) ==14947== by 0x6C18DD: do_handle_one_connection(THD*) (sql_connect.cc:771) ==14947== by 0x6C146E: handle_one_connection (sql_connect.cc:707) ==14947== by 0x30E1807760: start_thread (pthread_create.c:301) ==14947== by 0x35EA670F: ??? ==14947== Uninitialised value was created by a heap allocation ==14947== at 0x4A0515D: malloc (vg_replace_malloc.c:195) ==14947== by 0xB4B948: mem_area_alloc (mem0pool.c:385) ==14947== by 0xB4A27C: mem_heap_create_block (mem0mem.c:333) ==14947== by 0xB4A530: mem_heap_add_block (mem0mem.c:446) ==14947== by 0xB0D2A4: mem_heap_alloc (mem0mem.ic:186) ==14947== by 0xB0D9C2: ha_storage_put_memlim (ha0storage.c:118) ==14947== by 0xA479D8: fill_trx_row (trx0i_s.c:521) ==14947== by 0xA490E9: fetch_data_into_cache (trx0i_s.c:1319) ==14947== by 0xA491BA: trx_i_s_possibly_fetch_data_into_cache (trx0i_s.c:1352) ==14947== by 0x9F4CE7: trx_i_s_common_fill_table(THD*, TABLE_LIST*, Item*) (i_s.cc:1221) ==14947== by 0x7689F3: get_schema_tables_result(JOIN*, enum_schema_table_state) (sql_show.cc:6745) ==14947== by 0x715A75: JOIN::exec() (sql_select.cc:2861) ==14947== by 0x7185BD: mysql_select(THD*, Item***, TABLE_LIST*, unsigned int, List&, Item*, unsigned int, st_order*, st_order*, Item*, st_order*, unsigned long long, select_result*, st_select_lex_unit*, st_select_lex*) (sql_select.cc:3609) ==14947== by 0x70E823: handle_select(THD*, LEX*, select_result*, unsigned long) (sql_select.cc:319) ==14947== by 0x6F2305: execute_sqlcom_select(THD*, TABLE_LIST*) (sql_parse.cc:4557) ==14947== by 0x6EAED4: mysql_execute_command(THD*) (sql_parse.cc:2135) ==14947== by 0x6F44C9: mysql_parse(THD*, char*, unsigned int, Parser_state*) (sql_parse.cc:5597) ==14947== by 0x6E864B: dispatch_command(enum_server_command, THD*, char*, unsigned int) (sql_parse.cc:1093) ==14947== by 0x6E785E: do_command(THD*) (sql_parse.cc:815) ==14947== by 0x6C18DD: do_handle_one_connection(THD*) (sql_connect.cc:771) ==14947== by 0x6C146E: handle_one_connection (sql_connect.cc:707) ==14947== by 0x30E1807760: start_thread (pthread_create.c:301) ==14947== by 0x35EA670F: ??? (gdb) bt #0 0x0000000004a06318 in _vgrZU_libcZdsoZa___GI_strlen (str=0x3026bfa0 "insert into `blobtest` set `data`='pkefxxpkalpabzgrczlxefkreqljeqbvzrcnhvhsjsfnvxzjsltfuincffigdkmhvvcmnseluzgbtedrfmxvnrdmzesbinjgwvharkpgjplrlnqudfidbqwgbykupycxzyikzqincnsjrxgncqzlgyqwjdbjulztgsffxpjgymsnntdibvklwqylmwhsmdskmllxuwafabdjnwlyofknwuixiyrgnplmerfdewgizkdhznitesfqepsqbbwkdepkmjoseyxjofmmjaqdipwopfrwidmhqbtovdslvayxcnpewzhppeetblccppniamezibuoinvlxkafpcmozawtplfpepxwlwhymsuraezcwvjqzwogsozodlsfzjiyrcaljjhqwdrcjawvelhefzzaexvcbyorlcyupqwgjuamiqpiputtndjwcsuyzdfhuxswuowhrzdvriwrxqmcqthvzzzvivbabbnhdbtcfdtgssvmirrcddnytnctcvqplwytxxzxelldhwahalzxvgynaiwjyezhxqhlsqudngekocfvlbqprxqhyhwbaomgqiwkpfguohuvlnhtrsszgacxhhzeppyqwfwabiqzgyzkperiidyunrykopysvlcxwhrcboetjltawdjergalsfvaxncmzoznryumrjmncvhvxqvqhhbznnifkguuiffmlrbmgwtzvnuwlaguixqadkupfhasbbxnwkrvsfhrqanfmvjtzfqodtutkjlxfcogtsjywrdgmzgszjtsmimaelsveayqrwviqwwefeziuaqsqpauxpnzhaxjtkdfvvodniwezskbxfxszyniyzkzxngcfwgjlyrlskmrzxqnptwlilsxybuguafxxkvryyjrnkhhcmxuusitaflaiuxjhyfnzkahlgmaszujqmfdhyppdnpweqanmvzgjfyzjolbmprhnuuxextcaxzicfvsuochprmlf"...) at mc_replace_strmem.c:284 #1 0x00000000009f3d7b in fill_innodb_trx_from_cache (cache=0x1462440, thd=0x2a495000, table=0x2a422500) at /home/sbester/build/bzr/mysql-trunk/storage/innobase/handler/i_s.cc:591 #2 0x00000000009f4d7e in trx_i_s_common_fill_table (thd=0x2a495000, tables=0x2a4c3ec0) at /home/sbester/build/bzr/mysql-trunk/storage/innobase/handler/i_s.cc:1238 #3 0x00000000007689f4 in get_schema_tables_result (join=0x30f90c40, executed_place=PROCESSED_BY_JOIN_EXEC) at /home/sbester/build/bzr/mysql-trunk/sql/sql_show.cc:6745 #4 0x0000000000715a76 in JOIN::exec (this=0x30f90c40) at /home/sbester/build/bzr/mysql-trunk/sql/sql_select.cc:2861 #5 0x00000000007185be in mysql_select (thd=0x2a495000, rref_pointer_array=0x2a497590, tables=0x2a4c3ec0, wild_num=1, fields=..., conds=0x0, og_num=0, order=0x0, group=0x0, having=0x0, proc_param=0x0, select_options=2684619520, result=0x30319720, unit=0x2a496d28, select_lex=0x2a497378) at /home/sbester/build/bzr/mysql-trunk/sql/sql_select.cc:3609 #6 0x000000000070e824 in handle_select (thd=0x2a495000, lex=0x2a496c78, result=0x30319720, setup_tables_done_option=0) at /home/sbester/build/bzr/mysql-trunk/sql/sql_select.cc:319 #7 0x00000000006f2306 in execute_sqlcom_select (thd=0x2a495000, all_tables=0x2a4c3ec0) at /home/sbester/build/bzr/mysql-trunk/sql/sql_parse.cc:4557 #8 0x00000000006eaed5 in mysql_execute_command (thd=0x2a495000) at /home/sbester/build/bzr/mysql-trunk/sql/sql_parse.cc:2135 #9 0x00000000006f44ca in mysql_parse (thd=0x2a495000, rawbuf=0x30d80060 "select * from innodb_trx", length=24, parser_state=0x35ea5540) at /home/sbester/build/bzr/mysql-trunk/sql/sql_parse.cc:5597 #10 0x00000000006e864c in dispatch_command (command=COM_QUERY, thd=0x2a495000, packet=0x30bb4e31 "select * from innodb_trx", packet_length=24) at /home/sbester/build/bzr/mysql-trunk/sql/sql_parse.cc:1093 #11 0x00000000006e785f in do_command (thd=0x2a495000) at /home/sbester/build/bzr/mysql-trunk/sql/sql_parse.cc:815 #12 0x00000000006c18de in do_handle_one_connection (thd_arg=0x2a495000) at /home/sbester/build/bzr/mysql-trunk/sql/sql_connect.cc:771 #13 0x00000000006c146f in handle_one_connection (arg=0x2a495000) at /home/sbester/build/bzr/mysql-trunk/sql/sql_connect.cc:707 #14 0x00000030e1807761 in start_thread (arg=0x35ea6710) at pthread_create.c:301 #15 0x00000030e14e14ed in clone () at ../sysdeps/unix/sysv/linux/x86_64/clone.S:115 (gdb) frame 1 #1 0x00000000009f3d7b in fill_innodb_trx_from_cache (cache=0x1462440, thd=0x2a495000, table=0x2a422500) at /home/sbester/build/bzr/mysql-trunk/storage/innobase/handler/i_s.cc:591 591 row->trx_query_cs); (gdb) list 586 if (row->trx_query) { 587 /* store will do appropriate character set 588 conversion check */ 589 fields[IDX_TRX_QUERY]->store( 590 row->trx_query, strlen(row->trx_query), 591 row->trx_query_cs); 592 fields[IDX_TRX_QUERY]->set_notnull(); 593 } else { 594 fields[IDX_TRX_QUERY]->set_null(); 595 } --- storage/innodb_plugin/trx/trx0i_s.c | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) diff --git a/storage/innodb_plugin/trx/trx0i_s.c b/storage/innodb_plugin/trx/trx0i_s.c index 267e91db22e..53f4dcb0bef 100644 --- a/storage/innodb_plugin/trx/trx0i_s.c +++ b/storage/innodb_plugin/trx/trx0i_s.c @@ -508,7 +508,7 @@ fill_trx_row( query[stmt_len] = '\0'; row->trx_query = ha_storage_put_memlim( - cache->storage, stmt, stmt_len + 1, + cache->storage, query, stmt_len + 1, MAX_ALLOWED_FOR_STORAGE(cache)); row->trx_query_cs = innobase_get_charset(trx->mysql_thd); From a88faf2a4af5f60722647a8e01de6aac20305bb7 Mon Sep 17 00:00:00 2001 From: Sergey Glukhov Date: Mon, 28 Mar 2011 12:35:50 +0400 Subject: [PATCH 29/91] Bug#11764994 57900: CREATE TABLE .. SELECT ASSERTS SCALE >= 0 && PRECISION > 0 && SCALE <= PR Assert fails due to overflow which happens in Item_func_int_val::fix_num_length_and_dec() as geometry functions have max_length value equal to max_field_size(4294967295U). The fix is to skip max_length calculation for some boundary cases. mysql-test/r/func_math.result: test case mysql-test/t/func_math.test: test case sql/item_func.cc: skip max_length calculation if argument max_length is near max_field_size. --- mysql-test/r/func_math.result | 7 +++++++ mysql-test/t/func_math.test | 9 +++++++++ sql/item_func.cc | 7 ++++--- 3 files changed, 20 insertions(+), 3 deletions(-) diff --git a/mysql-test/r/func_math.result b/mysql-test/r/func_math.result index 3a626084c9e..ad0b872145b 100644 --- a/mysql-test/r/func_math.result +++ b/mysql-test/r/func_math.result @@ -511,4 +511,11 @@ t1 CREATE TABLE `t1` ( `C` varchar(23) DEFAULT NULL ) ENGINE=MyISAM DEFAULT CHARSET=latin1 DROP TABLE t1; +# +# Bug#11764994 57900: CREATE TABLE .. SELECT ASSERTS SCALE >= 0 && PRECISION > 0 && SCALE <= PR +# +CREATE TABLE t1 SELECT CEIL(LINESTRINGFROMWKB(1) DIV NULL); +DROP TABLE t1; +CREATE TABLE t1 SELECT FLOOR(LINESTRINGFROMWKB(1) DIV NULL); +DROP TABLE t1; End of 5.1 tests diff --git a/mysql-test/t/func_math.test b/mysql-test/t/func_math.test index c8ea11c7490..64b6a3a4ea6 100644 --- a/mysql-test/t/func_math.test +++ b/mysql-test/t/func_math.test @@ -324,4 +324,13 @@ CREATE TABLE t1 SELECT CAST((CASE(('')) WHEN (CONVERT(1, CHAR(1))) THEN (('' / 1 SHOW CREATE TABLE t1; DROP TABLE t1; +--echo # +--echo # Bug#11764994 57900: CREATE TABLE .. SELECT ASSERTS SCALE >= 0 && PRECISION > 0 && SCALE <= PR +--echo # + +CREATE TABLE t1 SELECT CEIL(LINESTRINGFROMWKB(1) DIV NULL); +DROP TABLE t1; +CREATE TABLE t1 SELECT FLOOR(LINESTRINGFROMWKB(1) DIV NULL); +DROP TABLE t1; + --echo End of 5.1 tests diff --git a/sql/item_func.cc b/sql/item_func.cc index d4fd2c94e1d..79fa37bd372 100644 --- a/sql/item_func.cc +++ b/sql/item_func.cc @@ -1803,9 +1803,10 @@ void Item_func_integer::fix_length_and_dec() void Item_func_int_val::fix_num_length_and_dec() { - max_length= args[0]->max_length - (args[0]->decimals ? - args[0]->decimals + 1 : - 0) + 2; + ulonglong tmp_max_length= (ulonglong ) args[0]->max_length - + (args[0]->decimals ? args[0]->decimals + 1 : 0) + 2; + max_length= tmp_max_length > (ulonglong) max_field_size ? + max_field_size : (uint32) tmp_max_length; uint tmp= float_length(decimals); set_if_smaller(max_length,tmp); decimals= 0; From 9ff72a1acfffe95cd5e6d9e06c61c5ee9b0000e0 Mon Sep 17 00:00:00 2001 From: Magne Mahre Date: Mon, 28 Mar 2011 10:47:30 +0200 Subject: [PATCH 30/91] Bug#11900714 REMOVE LGPL LICENSED FILES IN MYSQL 5.1 The LGPL license is used in some legacy code, and to adhere to current licensing polity, we remove those files that are no longer used, and reorganize the remaining LGPL code so it will be GPL licensed from now on. Note: This patch only removed LGPL licensed files in MySQL 5.1, and is the second of a set of patches to remove LGPL from all trees. (See Bug# 11840513 for details) --- extra/perror.c | 31 +++++- include/Makefile.am | 2 +- include/heap.h | 2 +- include/my_compare.h | 89 +++++++++++++++ include/my_global.h | 2 +- include/my_handler.h | 128 ---------------------- include/myisam.h | 24 +++- libmysql/CMakeLists.txt | 2 +- libmysql/Makefile.shared | 2 +- mysys/CMakeLists.txt | 4 +- mysys/Makefile.am | 6 +- mysys/{my_handler.c => my_compare.c} | 157 +++------------------------ mysys/my_gethostbyname.c | 113 ------------------- mysys/my_net.c | 89 +++++++++++++++ mysys/my_port.c | 40 ------- sql/field.h | 2 + sql/handler.h | 1 - storage/myisam/ft_stopwords.c | 2 +- storage/myisam/mi_check.c | 87 +++++++++++++++ storage/myisam/mi_test1.c | 1 + storage/myisam/mi_write.c | 1 + storage/myisam/myisamdef.h | 2 + storage/myisam/sp_test.c | 1 + 23 files changed, 350 insertions(+), 438 deletions(-) create mode 100644 include/my_compare.h delete mode 100644 include/my_handler.h rename mysys/{my_handler.c => my_compare.c} (78%) delete mode 100644 mysys/my_gethostbyname.c delete mode 100644 mysys/my_port.c diff --git a/extra/perror.c b/extra/perror.c index c32ad2bc791..5162f5e03dc 100644 --- a/extra/perror.c +++ b/extra/perror.c @@ -32,7 +32,6 @@ static my_bool verbose, print_all_codes; #include "../include/my_base.h" #include "../mysys/my_handler_errors.h" -#include "../include/my_handler.h" #ifdef WITH_NDBCLUSTER_STORAGE_ENGINE static my_bool ndb_code; @@ -185,6 +184,36 @@ static const char *get_ha_error_msg(int code) } +/* + Register handler error messages for usage with my_error() + + NOTES + This is safe to call multiple times as my_error_register() + will ignore calls to register already registered error numbers. +*/ +void my_handler_error_register(void) +{ + /* + If you got compilation error here about compile_time_assert array, check + that every HA_ERR_xxx constant has a corresponding error message in + handler_error_messages[] list (check mysys/ma_handler_errors.h and + include/my_base.h). + */ + compile_time_assert(HA_ERR_FIRST + array_elements(handler_error_messages) == + HA_ERR_LAST + 1); + my_error_register(handler_error_messages, HA_ERR_FIRST, + HA_ERR_FIRST+ array_elements(handler_error_messages)-1); +} + + +void my_handler_error_unregister(void) +{ + my_error_unregister(HA_ERR_FIRST, + HA_ERR_FIRST+ array_elements(handler_error_messages)-1); +} + + + #if defined(__WIN__) static my_bool print_win_error_msg(DWORD error, my_bool verbose) { diff --git a/include/Makefile.am b/include/Makefile.am index a3dbc386857..2e29806e0df 100644 --- a/include/Makefile.am +++ b/include/Makefile.am @@ -37,7 +37,7 @@ noinst_HEADERS = config-win.h config-netware.h my_bit.h \ my_nosys.h my_alarm.h queues.h rijndael.h sha1.h \ my_aes.h my_tree.h my_trie.h hash.h thr_alarm.h \ thr_lock.h t_ctype.h violite.h my_md5.h base64.h \ - my_handler.h my_time.h my_vle.h my_user.h \ + my_compare.h my_time.h my_vle.h my_user.h \ my_libwrap.h my_stacktrace.h EXTRA_DIST = mysql.h.pp mysql/plugin.h.pp diff --git a/include/heap.h b/include/heap.h index 4a1c7d419ed..126ce4fa12d 100644 --- a/include/heap.h +++ b/include/heap.h @@ -30,7 +30,7 @@ extern "C" { #include #endif -#include "my_handler.h" +#include "my_compare.h" #include "my_tree.h" /* defines used by heap-funktions */ diff --git a/include/my_compare.h b/include/my_compare.h new file mode 100644 index 00000000000..dedae5c8052 --- /dev/null +++ b/include/my_compare.h @@ -0,0 +1,89 @@ +/* Copyright (c) 2011, Oracle and/or its affiliates. All rights reserved. + + This program is free software; you can redistribute it and/or modify + it under the terms of the GNU General Public License as published by + the Free Software Foundation; version 2 of the License. + + This program is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the + GNU General Public License for more details. + + You should have received a copy of the GNU General Public License + along with this program; if not, write to the Free Software + Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA */ + +#ifndef _my_compare_h +#define _my_compare_h + +#include "my_base.h" +#include "m_ctype.h" +#include "myisampack.h" + +typedef struct st_HA_KEYSEG /* Key-portion */ +{ + CHARSET_INFO *charset; + uint32 start; /* Start of key in record */ + uint32 null_pos; /* position to NULL indicator */ + uint16 bit_pos; /* Position to bit part */ + uint16 flag; + uint16 length; /* Keylength */ + uint8 type; /* Type of key (for sort) */ + uint8 language; + uint8 null_bit; /* bitmask to test for NULL */ + uint8 bit_start,bit_end; /* if bit field */ + uint8 bit_length; /* Length of bit part */ +} HA_KEYSEG; + +#define get_key_length(length,key) \ +{ if ((uchar) *(key) != 255) \ + length= (uint) (uchar) *((key)++); \ + else \ + { length=mi_uint2korr((key)+1); (key)+=3; } \ +} + +#define get_key_length_rdonly(length,key) \ +{ if ((uchar) *(key) != 255) \ + length= ((uint) (uchar) *((key))); \ + else \ + { length=mi_uint2korr((key)+1); } \ +} + +#define get_key_pack_length(length,length_pack,key) \ +{ if ((uchar) *(key) != 255) \ + { length= (uint) (uchar) *((key)++); length_pack=1; }\ + else \ + { length=mi_uint2korr((key)+1); (key)+=3; length_pack=3; } \ +} + +#define store_key_length_inc(key,length) \ +{ if ((length) < 255) \ + { *(key)++=(length); } \ + else \ + { *(key)=255; mi_int2store((key)+1,(length)); (key)+=3; } \ +} + +#define get_rec_bits(bit_ptr, bit_ofs, bit_len) \ + (((((uint16) (bit_ptr)[1] << 8) | (uint16) (bit_ptr)[0]) >> (bit_ofs)) & \ + ((1 << (bit_len)) - 1)) + +#define set_rec_bits(bits, bit_ptr, bit_ofs, bit_len) \ +{ \ + (bit_ptr)[0]= ((bit_ptr)[0] & ~(((1 << (bit_len)) - 1) << (bit_ofs))) | \ + ((bits) << (bit_ofs)); \ + if ((bit_ofs) + (bit_len) > 8) \ + (bit_ptr)[1]= ((bit_ptr)[1] & ~((1 << ((bit_len) - 8 + (bit_ofs))) - 1)) | \ + ((bits) >> (8 - (bit_ofs))); \ +} + +#define clr_rec_bits(bit_ptr, bit_ofs, bit_len) \ + set_rec_bits(0, bit_ptr, bit_ofs, bit_len) + +extern int ha_compare_text(CHARSET_INFO *, uchar *, uint, uchar *, uint , + my_bool, my_bool); +extern int ha_key_cmp(register HA_KEYSEG *keyseg, register uchar *a, + register uchar *b, uint key_length, uint nextflag, + uint *diff_pos); + + +#endif /* _my_compare_h */ diff --git a/include/my_global.h b/include/my_global.h index ac5d72249f2..005180dae3b 100644 --- a/include/my_global.h +++ b/include/my_global.h @@ -359,7 +359,7 @@ C_MODE_END #define ulonglong2double(A) my_ulonglong2double(A) #define my_off_t2double(A) my_ulonglong2double(A) C_MODE_START -double my_ulonglong2double(unsigned long long A); +inline double my_ulonglong2double(unsigned long long A) { return (double) A; } C_MODE_END #endif /* _AIX */ diff --git a/include/my_handler.h b/include/my_handler.h deleted file mode 100644 index 7dfdb345a89..00000000000 --- a/include/my_handler.h +++ /dev/null @@ -1,128 +0,0 @@ -/* Copyright (C) 2002-2006 MySQL AB - - This program is free software; you can redistribute it and/or - modify it under the terms of the GNU Library General Public - License as published by the Free Software Foundation; version 2 - of the License. - - This program is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Library General Public License for more details. - - You should have received a copy of the GNU Library General Public - License along with this library; if not, write to the Free - Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, - MA 02111-1307, USA */ - -#ifndef _my_handler_h -#define _my_handler_h - -#include "myisampack.h" -#ifdef __cplusplus -extern "C" { -#endif - -/* - There is a hard limit for the maximum number of keys as there are only - 8 bits in the index file header for the number of keys in a table. - This means that 0..255 keys can exist for a table. The idea of - HA_MAX_POSSIBLE_KEY is to ensure that one can use myisamchk & tools on - a MyISAM table for which one has more keys than MyISAM is normally - compiled for. If you don't have this, you will get a core dump when - running myisamchk compiled for 128 keys on a table with 255 keys. -*/ - -#define HA_MAX_POSSIBLE_KEY 255 /* For myisamchk */ -/* - The following defines can be increased if necessary. - But beware the dependency of MI_MAX_POSSIBLE_KEY_BUFF and HA_MAX_KEY_LENGTH. -*/ - -#define HA_MAX_KEY_LENGTH 1000 /* Max length in bytes */ -#define HA_MAX_KEY_SEG 16 /* Max segments for key */ - -#define HA_MAX_POSSIBLE_KEY_BUFF (HA_MAX_KEY_LENGTH + 24+ 6+6) -#define HA_MAX_KEY_BUFF (HA_MAX_KEY_LENGTH+HA_MAX_KEY_SEG*6+8+8) - -typedef struct st_HA_KEYSEG /* Key-portion */ -{ - CHARSET_INFO *charset; - uint32 start; /* Start of key in record */ - uint32 null_pos; /* position to NULL indicator */ - uint16 bit_pos; /* Position to bit part */ - uint16 flag; - uint16 length; /* Keylength */ - uint8 type; /* Type of key (for sort) */ - uint8 language; - uint8 null_bit; /* bitmask to test for NULL */ - uint8 bit_start,bit_end; /* if bit field */ - uint8 bit_length; /* Length of bit part */ -} HA_KEYSEG; - -#define get_key_length(length,key) \ -{ if (*(uchar*) (key) != 255) \ - length= (uint) *(uchar*) ((key)++); \ - else \ - { length= mi_uint2korr((key)+1); (key)+=3; } \ -} - -#define get_key_length_rdonly(length,key) \ -{ if (*(uchar*) (key) != 255) \ - length= ((uint) *(uchar*) ((key))); \ - else \ - { length= mi_uint2korr((key)+1); } \ -} - -#define get_key_pack_length(length,length_pack,key) \ -{ if (*(uchar*) (key) != 255) \ - { length= (uint) *(uchar*) ((key)++); length_pack= 1; }\ - else \ - { length=mi_uint2korr((key)+1); (key)+= 3; length_pack= 3; } \ -} - -#define store_key_length_inc(key,length) \ -{ if ((length) < 255) \ - { *(key)++= (length); } \ - else \ - { *(key)=255; mi_int2store((key)+1,(length)); (key)+=3; } \ -} - -#define size_to_store_key_length(length) ((length) < 255 ? 1 : 3) - -#define get_rec_bits(bit_ptr, bit_ofs, bit_len) \ - (((((uint16) (bit_ptr)[1] << 8) | (uint16) (bit_ptr)[0]) >> (bit_ofs)) & \ - ((1 << (bit_len)) - 1)) - -#define set_rec_bits(bits, bit_ptr, bit_ofs, bit_len) \ -{ \ - (bit_ptr)[0]= ((bit_ptr)[0] & ~(((1 << (bit_len)) - 1) << (bit_ofs))) | \ - ((bits) << (bit_ofs)); \ - if ((bit_ofs) + (bit_len) > 8) \ - (bit_ptr)[1]= ((bit_ptr)[1] & ~((1 << ((bit_len) - 8 + (bit_ofs))) - 1)) | \ - ((bits) >> (8 - (bit_ofs))); \ -} - -#define clr_rec_bits(bit_ptr, bit_ofs, bit_len) \ - set_rec_bits(0, bit_ptr, bit_ofs, bit_len) - -extern int ha_compare_text(CHARSET_INFO *, uchar *, uint, uchar *, uint , - my_bool, my_bool); -extern int ha_key_cmp(register HA_KEYSEG *keyseg, register uchar *a, - register uchar *b, uint key_length, uint nextflag, - uint *diff_pos); - -extern HA_KEYSEG *ha_find_null(HA_KEYSEG *keyseg, uchar *a); -extern void my_handler_error_register(void); -extern void my_handler_error_unregister(void); -/* - Inside an in-memory data record, memory pointers to pieces of the - record (like BLOBs) are stored in their native byte order and in - this amount of bytes. -*/ -#define portable_sizeof_char_ptr 8 -#ifdef __cplusplus -} -#endif - -#endif /* _my_handler_h */ diff --git a/include/myisam.h b/include/myisam.h index e502daa2f17..09f54ef0019 100644 --- a/include/myisam.h +++ b/include/myisam.h @@ -30,8 +30,30 @@ extern "C" { #ifndef _keycache_h #include "keycache.h" #endif -#include "my_handler.h" #include +#include "my_compare.h" + +/* + There is a hard limit for the maximum number of keys as there are only + 8 bits in the index file header for the number of keys in a table. + This means that 0..255 keys can exist for a table. The idea of + HA_MAX_POSSIBLE_KEY is to ensure that one can use myisamchk & tools on + a MyISAM table for which one has more keys than MyISAM is normally + compiled for. If you don't have this, you will get a core dump when + running myisamchk compiled for 128 keys on a table with 255 keys. +*/ + +#define HA_MAX_POSSIBLE_KEY 255 /* For myisamchk */ +/* + The following defines can be increased if necessary. + But beware the dependency of MI_MAX_POSSIBLE_KEY_BUFF and HA_MAX_KEY_LENGTH. +*/ + +#define HA_MAX_KEY_LENGTH 1000 /* Max length in bytes */ +#define HA_MAX_KEY_SEG 16 /* Max segments for key */ + +#define HA_MAX_POSSIBLE_KEY_BUFF (HA_MAX_KEY_LENGTH + 24+ 6+6) +#define HA_MAX_KEY_BUFF (HA_MAX_KEY_LENGTH+HA_MAX_KEY_SEG*6+8+8) /* Limit max keys according to HA_MAX_POSSIBLE_KEY diff --git a/libmysql/CMakeLists.txt b/libmysql/CMakeLists.txt index 55138e4aa06..129b923dd27 100755 --- a/libmysql/CMakeLists.txt +++ b/libmysql/CMakeLists.txt @@ -82,7 +82,7 @@ SET(CLIENT_SOURCES ../mysys/array.c ../strings/bchange.c ../strings/bmove.c ../mysys/mf_wcomp.c ../mysys/mulalloc.c ../mysys/my_access.c ../mysys/my_alloc.c ../mysys/my_chsize.c ../mysys/my_compress.c ../mysys/my_create.c ../mysys/my_delete.c ../mysys/my_div.c ../mysys/my_error.c ../mysys/my_file.c - ../mysys/my_fopen.c ../mysys/my_fstream.c ../mysys/my_gethostbyname.c + ../mysys/my_fopen.c ../mysys/my_fstream.c ../mysys/my_getopt.c ../mysys/my_getwd.c ../mysys/my_init.c ../mysys/my_lib.c ../mysys/my_malloc.c ../mysys/my_messnc.c ../mysys/my_net.c ../mysys/my_once.c ../mysys/my_open.c ../mysys/my_pread.c ../mysys/my_pthread.c ../mysys/my_read.c diff --git a/libmysql/Makefile.shared b/libmysql/Makefile.shared index a27949eb7ca..7249bcab19a 100644 --- a/libmysql/Makefile.shared +++ b/libmysql/Makefile.shared @@ -66,7 +66,7 @@ mysysobjects1 = my_init.lo my_static.lo my_malloc.lo my_realloc.lo \ charset.lo charset-def.lo hash.lo mf_iocache.lo \ mf_iocache2.lo my_seek.lo my_sleep.lo \ my_pread.lo mf_cache.lo md5.lo sha1.lo \ - my_getopt.lo my_gethostbyname.lo my_port.lo \ + my_getopt.lo \ my_rename.lo my_chsize.lo my_sync.lo my_getsystime.lo sqlobjects = net.lo sql_cmn_objects = pack.lo client.lo my_time.lo diff --git a/mysys/CMakeLists.txt b/mysys/CMakeLists.txt index 7afb800643c..9db8a40407e 100755 --- a/mysys/CMakeLists.txt +++ b/mysys/CMakeLists.txt @@ -33,8 +33,8 @@ SET(MYSYS_SOURCES array.c charset-def.c charset.c checksum.c default.c default_ mf_tempfile.c mf_unixpath.c mf_wcomp.c mf_wfile.c mulalloc.c my_access.c my_aes.c my_alarm.c my_alloc.c my_append.c my_bit.c my_bitmap.c my_chsize.c my_clock.c my_compress.c my_conio.c my_copy.c my_crc32.c my_create.c my_delete.c - my_div.c my_error.c my_file.c my_fopen.c my_fstream.c my_gethostbyname.c - my_gethwaddr.c my_getopt.c my_getsystime.c my_getwd.c my_handler.c my_init.c + my_div.c my_error.c my_file.c my_fopen.c my_fstream.c + my_gethwaddr.c my_getopt.c my_getsystime.c my_getwd.c my_compare.c my_init.c my_lib.c my_lock.c my_lockmem.c my_malloc.c my_messnc.c my_mkdir.c my_mmap.c my_net.c my_once.c my_open.c my_pread.c my_pthread.c my_quick.c my_read.c my_realloc.c my_redel.c my_rename.c my_seek.c my_sleep.c diff --git a/mysys/Makefile.am b/mysys/Makefile.am index e4c71f66079..00575375c11 100644 --- a/mysys/Makefile.am +++ b/mysys/Makefile.am @@ -46,10 +46,10 @@ libmysys_a_SOURCES = my_init.c my_getwd.c mf_getdate.c my_mmap.c \ my_sync.c my_getopt.c my_mkdir.c \ default_modify.c default.c \ my_compress.c checksum.c \ - my_net.c my_port.c my_sleep.c \ + my_net.c my_sleep.c \ charset.c charset-def.c my_bitmap.c my_bit.c md5.c \ - my_gethostbyname.c rijndael.c my_aes.c sha1.c \ - my_handler.c my_netware.c my_largepage.c \ + rijndael.c my_aes.c sha1.c \ + my_compare.c my_netware.c my_largepage.c \ my_memmem.c stacktrace.c \ my_windac.c my_access.c base64.c my_libwrap.c diff --git a/mysys/my_handler.c b/mysys/my_compare.c similarity index 78% rename from mysys/my_handler.c rename to mysys/my_compare.c index 7aa8177040d..8d33861d91c 100644 --- a/mysys/my_handler.c +++ b/mysys/my_compare.c @@ -1,27 +1,19 @@ -/* Copyright (C) 2002-2006 MySQL AB - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Library General Public - License as published by the Free Software Foundation; version 2 - of the License. - - This library is distributed in the hope that it will be useful, +/* Copyright (c) 2011 Oracle and/or its affiliates. All rights reserved. + + This program is free software; you can redistribute it and/or modify + it under the terms of the GNU General Public License as published by + the Free Software Foundation; version 2 of the License. + + This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Library General Public License for more details. + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the + GNU General Public License for more details. - You should have received a copy of the GNU Library General Public - License along with this library; if not, write to the Free - Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, - MA 02111-1307, USA */ + You should have received a copy of the GNU General Public License + along with this program; if not, write to the Free Software + Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA */ -#include -#include -#include -#include -#include - -#include "my_handler_errors.h" +#include "my_compare.h" int ha_compare_text(CHARSET_INFO *charset_info, uchar *a, uint a_length, uchar *b, uint b_length, my_bool part_key, @@ -269,6 +261,7 @@ int ha_key_cmp(register HA_KEYSEG *keyseg, register uchar *a, return ((keyseg->flag & HA_REVERSE_SORT) ? -flag : flag); a+=a_length; b+=b_length; + break; } break; case HA_KEYTYPE_INT8: @@ -474,125 +467,3 @@ end: } return 0; } /* ha_key_cmp */ - - -/* - Find the first NULL value in index-suffix values tuple - - SYNOPSIS - ha_find_null() - keyseg Array of keyparts for key suffix - a Key suffix value tuple - - DESCRIPTION - Find the first NULL value in index-suffix values tuple. - - TODO - Consider optimizing this function or its use so we don't search for - NULL values in completely NOT NULL index suffixes. - - RETURN - First key part that has NULL as value in values tuple, or the last key - part (with keyseg->type==HA_TYPE_END) if values tuple doesn't contain - NULLs. -*/ - -HA_KEYSEG *ha_find_null(HA_KEYSEG *keyseg, uchar *a) -{ - for (; (enum ha_base_keytype) keyseg->type != HA_KEYTYPE_END; keyseg++) - { - uchar *end; - if (keyseg->null_bit) - { - if (!*a++) - return keyseg; - } - end= a+ keyseg->length; - - switch ((enum ha_base_keytype) keyseg->type) { - case HA_KEYTYPE_TEXT: - case HA_KEYTYPE_BINARY: - case HA_KEYTYPE_BIT: - if (keyseg->flag & HA_SPACE_PACK) - { - int a_length; - get_key_length(a_length, a); - a += a_length; - break; - } - else - a= end; - break; - case HA_KEYTYPE_VARTEXT1: - case HA_KEYTYPE_VARTEXT2: - case HA_KEYTYPE_VARBINARY1: - case HA_KEYTYPE_VARBINARY2: - { - int a_length; - get_key_length(a_length, a); - a+= a_length; - break; - } - case HA_KEYTYPE_NUM: - if (keyseg->flag & HA_SPACE_PACK) - { - int alength= *a++; - end= a+alength; - } - a= end; - break; - case HA_KEYTYPE_INT8: - case HA_KEYTYPE_SHORT_INT: - case HA_KEYTYPE_USHORT_INT: - case HA_KEYTYPE_LONG_INT: - case HA_KEYTYPE_ULONG_INT: - case HA_KEYTYPE_INT24: - case HA_KEYTYPE_UINT24: -#ifdef HAVE_LONG_LONG - case HA_KEYTYPE_LONGLONG: - case HA_KEYTYPE_ULONGLONG: -#endif - case HA_KEYTYPE_FLOAT: - case HA_KEYTYPE_DOUBLE: - a= end; - break; - case HA_KEYTYPE_END: /* purecov: inspected */ - /* keep compiler happy */ - DBUG_ASSERT(0); - break; - } - } - return keyseg; -} - - - -/* - Register handler error messages for usage with my_error() - - NOTES - This is safe to call multiple times as my_error_register() - will ignore calls to register already registered error numbers. -*/ - - -void my_handler_error_register(void) -{ - /* - If you got compilation error here about compile_time_assert array, check - that every HA_ERR_xxx constant has a corresponding error message in - handler_error_messages[] list (check mysys/ma_handler_errors.h and - include/my_base.h). - */ - compile_time_assert(HA_ERR_FIRST + array_elements(handler_error_messages) == - HA_ERR_LAST + 1); - my_error_register(handler_error_messages, HA_ERR_FIRST, - HA_ERR_FIRST+ array_elements(handler_error_messages)-1); -} - - -void my_handler_error_unregister(void) -{ - my_error_unregister(HA_ERR_FIRST, - HA_ERR_FIRST+ array_elements(handler_error_messages)-1); -} diff --git a/mysys/my_gethostbyname.c b/mysys/my_gethostbyname.c deleted file mode 100644 index 12cf90271dd..00000000000 --- a/mysys/my_gethostbyname.c +++ /dev/null @@ -1,113 +0,0 @@ -/* Copyright (C) 2002, 2004 MySQL AB - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Library General Public - License as published by the Free Software Foundation; version 2 - of the License. - - This library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Library General Public License for more details. - - You should have received a copy of the GNU Library General Public - License along with this library; if not, write to the Free - Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, - MA 02111-1307, USA */ - -/* Thread safe version of gethostbyname_r() */ - -#include "mysys_priv.h" -#if !defined(__WIN__) -#include -#endif -#include - -/* This file is not needed if my_gethostbyname_r is a macro */ -#if !defined(my_gethostbyname_r) - -/* - Emulate SOLARIS style calls, not because it's better, but just to make the - usage of getbostbyname_r simpler. -*/ - -#if defined(HAVE_GETHOSTBYNAME_R) - -#if defined(HAVE_GETHOSTBYNAME_R_GLIBC2_STYLE) - -struct hostent *my_gethostbyname_r(const char *name, - struct hostent *result, char *buffer, - int buflen, int *h_errnop) -{ - struct hostent *hp; - DBUG_ASSERT((size_t) buflen >= sizeof(*result)); - if (gethostbyname_r(name,result, buffer, (size_t) buflen, &hp, h_errnop)) - return 0; - return hp; -} - -#elif defined(HAVE_GETHOSTBYNAME_R_RETURN_INT) - -struct hostent *my_gethostbyname_r(const char *name, - struct hostent *result, char *buffer, - int buflen, int *h_errnop) -{ - if (gethostbyname_r(name,result,(struct hostent_data *) buffer) == -1) - { - *h_errnop= errno; - return 0; - } - return result; -} - -#else - -/* gethostbyname_r with similar interface as gethostbyname() */ - -struct hostent *my_gethostbyname_r(const char *name, - struct hostent *result, char *buffer, - int buflen, int *h_errnop) -{ - struct hostent *hp; - DBUG_ASSERT(buflen >= sizeof(struct hostent_data)); - hp= gethostbyname_r(name,result,(struct hostent_data *) buffer); - *h_errnop= errno; - return hp; -} -#endif /* GLIBC2_STYLE_GETHOSTBYNAME_R */ - -#else /* !HAVE_GETHOSTBYNAME_R */ - -#ifdef THREAD -extern pthread_mutex_t LOCK_gethostbyname_r; -#endif - -/* - No gethostbyname_r() function exists. - In this case we have to keep a mutex over the call to ensure that no - other thread is going to reuse the internal memory. - - The user is responsible to call my_gethostbyname_r_free() when he - is finished with the structure. -*/ - -struct hostent *my_gethostbyname_r(const char *name, - struct hostent *res __attribute__((unused)), - char *buffer __attribute__((unused)), - int buflen __attribute__((unused)), - int *h_errnop) -{ - struct hostent *hp; - pthread_mutex_lock(&LOCK_gethostbyname_r); - hp= gethostbyname(name); - *h_errnop= h_errno; - return hp; -} - -void my_gethostbyname_r_free() -{ - pthread_mutex_unlock(&LOCK_gethostbyname_r); -} - -#endif /* !HAVE_GETHOSTBYNAME_R */ -#endif /* !my_gethostbyname_r */ diff --git a/mysys/my_net.c b/mysys/my_net.c index 81d977210f8..3d139bb46c3 100644 --- a/mysys/my_net.c +++ b/mysys/my_net.c @@ -31,6 +31,8 @@ #include #endif #endif /* !defined(__WIN__) */ +#include "my_net.h" + void my_inet_ntoa(struct in_addr in, char *buf) { @@ -40,3 +42,90 @@ void my_inet_ntoa(struct in_addr in, char *buf) strmov(buf,ptr); pthread_mutex_unlock(&THR_LOCK_net); } + +/* This code is not needed if my_gethostbyname_r is a macro */ +#if !defined(my_gethostbyname_r) + +/* + Emulate SOLARIS style calls, not because it's better, but just to make the + usage of getbostbyname_r simpler. +*/ + +#if defined(HAVE_GETHOSTBYNAME_R) + +#if defined(HAVE_GETHOSTBYNAME_R_GLIBC2_STYLE) + +struct hostent *my_gethostbyname_r(const char *name, + struct hostent *result, char *buffer, + int buflen, int *h_errnop) +{ + struct hostent *hp; + DBUG_ASSERT((size_t) buflen >= sizeof(*result)); + if (gethostbyname_r(name,result, buffer, (size_t) buflen, &hp, h_errnop)) + return 0; + return hp; +} + +#elif defined(HAVE_GETHOSTBYNAME_R_RETURN_INT) + +struct hostent *my_gethostbyname_r(const char *name, + struct hostent *result, char *buffer, + int buflen, int *h_errnop) +{ + if (gethostbyname_r(name,result,(struct hostent_data *) buffer) == -1) + { + *h_errnop= errno; + return 0; + } + return result; +} + +#else + +/* gethostbyname_r with similar interface as gethostbyname() */ + +struct hostent *my_gethostbyname_r(const char *name, + struct hostent *result, char *buffer, + int buflen, int *h_errnop) +{ + struct hostent *hp; + DBUG_ASSERT(buflen >= sizeof(struct hostent_data)); + hp= gethostbyname_r(name,result,(struct hostent_data *) buffer); + *h_errnop= errno; + return hp; +} +#endif /* GLIBC2_STYLE_GETHOSTBYNAME_R */ + +#else /* !HAVE_GETHOSTBYNAME_R */ + +#ifdef THREAD +extern pthread_mutex_t LOCK_gethostbyname_r; +#endif + +/* + No gethostbyname_r() function exists. + In this case we have to keep a mutex over the call to ensure that no + other thread is going to reuse the internal memory. + + The user is responsible to call my_gethostbyname_r_free() when he + is finished with the structure. +*/ + +struct hostent *my_gethostbyname_r(const char *name, + struct hostent *result, char *buffer, + int buflen, int *h_errnop) +{ + struct hostent *hp; + pthread_mutex_lock(&LOCK_gethostbyname_r); + hp= gethostbyname(name); + *h_errnop= h_errno; + return hp; +} + +void my_gethostbyname_r_free() +{ + pthread_mutex_unlock(&LOCK_gethostbyname_r); +} + +#endif /* !HAVE_GETHOSTBYNAME_R */ +#endif /* !my_gethostbyname_r */ diff --git a/mysys/my_port.c b/mysys/my_port.c deleted file mode 100644 index 9ad333421ca..00000000000 --- a/mysys/my_port.c +++ /dev/null @@ -1,40 +0,0 @@ -/* Copyright (C) 2002 MySQL AB - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Library General Public - License as published by the Free Software Foundation; version 2 - of the License. - - This library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Library General Public License for more details. - - You should have received a copy of the GNU Library General Public - License along with this library; if not, write to the Free - Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, - MA 02111-1307, USA */ - -/* - Small functions to make code portable -*/ - -#include "mysys_priv.h" - -#ifdef _AIX - -/* - On AIX, at least with gcc 3.1, the expression - '(double) (ulonglong) var' doesn't always work for big unsigned - integers like '18446744073709551615'. The end result is that the - high bit is simply dropped. (probably bug in gcc optimizations) - Handling the conversion in a sub function seems to work. -*/ - - - -double my_ulonglong2double(unsigned long long nr) -{ - return (double) nr; -} -#endif /* _AIX */ diff --git a/sql/field.h b/sql/field.h index cbdfa686ff8..285c8307634 100644 --- a/sql/field.h +++ b/sql/field.h @@ -13,6 +13,8 @@ along with this program; if not, write to the Free Software Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA */ +#include "my_compare.h" /* for clr_rec_bits */ + /* Because of the function new_field() all field classes that have static variables must declare the size_of() member function. diff --git a/sql/handler.h b/sql/handler.h index dabc179079a..5f68bb6a8f8 100644 --- a/sql/handler.h +++ b/sql/handler.h @@ -20,7 +20,6 @@ #pragma interface /* gcc class implementation */ #endif -#include #include #include diff --git a/storage/myisam/ft_stopwords.c b/storage/myisam/ft_stopwords.c index 9838b15af34..dbab71f4381 100644 --- a/storage/myisam/ft_stopwords.c +++ b/storage/myisam/ft_stopwords.c @@ -16,7 +16,7 @@ /* Written by Sergei A. Golubchik, who has a shared copyright to this code */ #include "ftdefs.h" -#include "my_handler.h" +#include "my_compare.h" typedef struct st_ft_stopwords { diff --git a/storage/myisam/mi_check.c b/storage/myisam/mi_check.c index 935465e7edf..7bc26729e03 100644 --- a/storage/myisam/mi_check.c +++ b/storage/myisam/mi_check.c @@ -85,6 +85,7 @@ static SORT_KEY_BLOCKS *alloc_key_blocks(MI_CHECK *param, uint blocks, uint buffer_length); static ha_checksum mi_byte_checksum(const uchar *buf, uint length); static void set_data_file_type(SORT_INFO *sort_info, MYISAM_SHARE *share); +static HA_KEYSEG *ha_find_null(HA_KEYSEG *keyseg, uchar *a); void myisamchk_init(MI_CHECK *param) { @@ -4739,3 +4740,89 @@ set_data_file_type(SORT_INFO *sort_info, MYISAM_SHARE *share) share->delete_record=tmp.delete_record; } } + +/* + Find the first NULL value in index-suffix values tuple + + SYNOPSIS + ha_find_null() + keyseg Array of keyparts for key suffix + a Key suffix value tuple + + DESCRIPTION + Find the first NULL value in index-suffix values tuple. + TODO Consider optimizing this fuction or its use so we don't search for + NULL values in completely NOT NULL index suffixes. + + RETURN + First key part that has NULL as value in values tuple, or the last key part + (with keyseg->type==HA_TYPE_END) if values tuple doesn't contain NULLs. +*/ + +static HA_KEYSEG *ha_find_null(HA_KEYSEG *keyseg, uchar *a) +{ + for (; (enum ha_base_keytype) keyseg->type != HA_KEYTYPE_END; keyseg++) + { + uchar *end; + if (keyseg->null_bit) + { + if (!*a++) + return keyseg; + } + end= a+ keyseg->length; + + switch ((enum ha_base_keytype) keyseg->type) { + case HA_KEYTYPE_TEXT: + case HA_KEYTYPE_BINARY: + case HA_KEYTYPE_BIT: + if (keyseg->flag & HA_SPACE_PACK) + { + int a_length; + get_key_length(a_length, a); + a += a_length; + break; + } + else + a= end; + break; + case HA_KEYTYPE_VARTEXT1: + case HA_KEYTYPE_VARTEXT2: + case HA_KEYTYPE_VARBINARY1: + case HA_KEYTYPE_VARBINARY2: + { + int a_length; + get_key_length(a_length, a); + a+= a_length; + break; + } + case HA_KEYTYPE_NUM: + if (keyseg->flag & HA_SPACE_PACK) + { + int alength= *a++; + end= a+alength; + } + a= end; + break; + case HA_KEYTYPE_INT8: + case HA_KEYTYPE_SHORT_INT: + case HA_KEYTYPE_USHORT_INT: + case HA_KEYTYPE_LONG_INT: + case HA_KEYTYPE_ULONG_INT: + case HA_KEYTYPE_INT24: + case HA_KEYTYPE_UINT24: +#ifdef HAVE_LONG_LONG + case HA_KEYTYPE_LONGLONG: + case HA_KEYTYPE_ULONGLONG: +#endif + case HA_KEYTYPE_FLOAT: + case HA_KEYTYPE_DOUBLE: + a= end; + break; + case HA_KEYTYPE_END: /* purecov: inspected */ + /* keep compiler happy */ + DBUG_ASSERT(0); + break; + } + } + return keyseg; +} diff --git a/storage/myisam/mi_test1.c b/storage/myisam/mi_test1.c index 363b024737a..142ee9b4909 100644 --- a/storage/myisam/mi_test1.c +++ b/storage/myisam/mi_test1.c @@ -16,6 +16,7 @@ /* Testing of the basic functions of a MyISAM table */ #include "myisam.h" +#include "myisamdef.h" #include #include diff --git a/storage/myisam/mi_write.c b/storage/myisam/mi_write.c index 72a4e006cc6..3c8ebe5dbd8 100644 --- a/storage/myisam/mi_write.c +++ b/storage/myisam/mi_write.c @@ -17,6 +17,7 @@ #include "fulltext.h" #include "rt_index.h" +#include "my_compare.h" #define MAX_POINTER_LENGTH 8 diff --git a/storage/myisam/myisamdef.h b/storage/myisam/myisamdef.h index 962155e884c..c91601f6503 100644 --- a/storage/myisam/myisamdef.h +++ b/storage/myisam/myisamdef.h @@ -424,6 +424,8 @@ typedef struct st_mi_sort_param #define get_pack_length(length) ((length) >= 255 ? 3 : 1) +#define portable_sizeof_char_ptr 8 + #define MI_MIN_BLOCK_LENGTH 20 /* Because of delete-link */ #define MI_EXTEND_BLOCK_LENGTH 20 /* Don't use to small record-blocks */ #define MI_SPLIT_LENGTH ((MI_EXTEND_BLOCK_LENGTH+4)*2) diff --git a/storage/myisam/sp_test.c b/storage/myisam/sp_test.c index f572c7ab19b..7a30a742fd6 100644 --- a/storage/myisam/sp_test.c +++ b/storage/myisam/sp_test.c @@ -17,6 +17,7 @@ /* Written by Alex Barkov, who has a shared copyright to this code */ #include "myisam.h" +#include "myisamdef.h" #ifdef HAVE_SPATIAL #include "sp_defs.h" From a3ab0d92defbafb462c7c5c50bab324521558971 Mon Sep 17 00:00:00 2001 From: Georgi Kodinov Date: Mon, 28 Mar 2011 13:25:03 +0300 Subject: [PATCH 31/91] Fixed a test failure in embedded because of the fix for BUG#11766769 --- mysql-test/r/variables-notembedded.result | 24 ++++++++++++++++++++ mysql-test/r/variables.result | 23 ------------------- mysql-test/t/variables-notembedded.test | 27 +++++++++++++++++++++++ mysql-test/t/variables.test | 25 --------------------- 4 files changed, 51 insertions(+), 48 deletions(-) diff --git a/mysql-test/r/variables-notembedded.result b/mysql-test/r/variables-notembedded.result index 8c6d54757ed..8056af49090 100644 --- a/mysql-test/r/variables-notembedded.result +++ b/mysql-test/r/variables-notembedded.result @@ -108,3 +108,27 @@ SET @@session.slave_skip_errors= 7; ERROR HY000: Variable 'slave_skip_errors' is a read only variable SET @@global.slave_skip_errors= 7; ERROR HY000: Variable 'slave_skip_errors' is a read only variable +# +# Bug #11766769 : 59959: SMALL VALUES OF --MAX-ALLOWED-PACKET +# ARE NOT BEING HONORED +# +CREATE TABLE t1 (a MEDIUMTEXT); +SET GLOBAL max_allowed_packet=2048; +Warnings: +Warning 1105 The value of 'max_allowed_packet' should be no less than the value of 'net_buffer_length' +SET GLOBAL net_buffer_length=4096; +Warnings: +Warning 1105 The value of 'max_allowed_packet' should be no less than the value of 'net_buffer_length' +SHOW SESSION VARIABLES LIKE 'max_allowed_packet'; +Variable_name Value +max_allowed_packet 2048 +SHOW SESSION VARIABLES LIKE 'net_buffer_length'; +Variable_name Value +net_buffer_length 4096 +ERROR 08S01: Got a packet bigger than 'max_allowed_packet' bytes +SELECT LENGTH(a) FROM t1; +LENGTH(a) +SET GLOBAL max_allowed_packet=default; +SET GLOBAL net_buffer_length=default; +DROP TABLE t1; +End of 5.1 tests diff --git a/mysql-test/r/variables.result b/mysql-test/r/variables.result index f92e1dec4c9..8cff6e99d4f 100644 --- a/mysql-test/r/variables.result +++ b/mysql-test/r/variables.result @@ -1567,27 +1567,4 @@ SET @@global.max_binlog_cache_size=DEFAULT; SET @@global.max_join_size=DEFAULT; SET @@global.key_buffer_size=@kbs; SET @@global.key_cache_block_size=@kcbs; -# -# Bug #11766769 : 59959: SMALL VALUES OF --MAX-ALLOWED-PACKET -# ARE NOT BEING HONORED -# -CREATE TABLE t1 (a MEDIUMTEXT); -SET GLOBAL max_allowed_packet=2048; -Warnings: -Warning 1105 The value of 'max_allowed_packet' should be no less than the value of 'net_buffer_length' -SET GLOBAL net_buffer_length=4096; -Warnings: -Warning 1105 The value of 'max_allowed_packet' should be no less than the value of 'net_buffer_length' -SHOW SESSION VARIABLES LIKE 'max_allowed_packet'; -Variable_name Value -max_allowed_packet 2048 -SHOW SESSION VARIABLES LIKE 'net_buffer_length'; -Variable_name Value -net_buffer_length 4096 -ERROR 08S01: Got a packet bigger than 'max_allowed_packet' bytes -SELECT LENGTH(a) FROM t1; -LENGTH(a) -SET GLOBAL max_allowed_packet=default; -SET GLOBAL net_buffer_length=default; -DROP TABLE t1; End of 5.1 tests diff --git a/mysql-test/t/variables-notembedded.test b/mysql-test/t/variables-notembedded.test index 7cc068c68c7..b440cfa47b0 100644 --- a/mysql-test/t/variables-notembedded.test +++ b/mysql-test/t/variables-notembedded.test @@ -109,3 +109,30 @@ SET @@session.slave_skip_errors= 7; --error ER_INCORRECT_GLOBAL_LOCAL_VAR SET @@global.slave_skip_errors= 7; # + +--echo # +--echo # Bug #11766769 : 59959: SMALL VALUES OF --MAX-ALLOWED-PACKET +--echo # ARE NOT BEING HONORED +--echo # + +CREATE TABLE t1 (a MEDIUMTEXT); + +SET GLOBAL max_allowed_packet=2048; +SET GLOBAL net_buffer_length=4096; +CONNECT (con1,localhost,root,,test); +SHOW SESSION VARIABLES LIKE 'max_allowed_packet'; +SHOW SESSION VARIABLES LIKE 'net_buffer_length'; +--disable_query_log +--error ER_NET_PACKET_TOO_LARGE +INSERT INTO t1 VALUES ('123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890'); +--enable_query_log + +CONNECTION default; +DISCONNECT con1; +SELECT LENGTH(a) FROM t1; + +SET GLOBAL max_allowed_packet=default; +SET GLOBAL net_buffer_length=default; +DROP TABLE t1; + +--echo End of 5.1 tests diff --git a/mysql-test/t/variables.test b/mysql-test/t/variables.test index 8f111e7cf3b..d00b77e64c0 100644 --- a/mysql-test/t/variables.test +++ b/mysql-test/t/variables.test @@ -1318,29 +1318,4 @@ SET @@global.key_buffer_size=@kbs; SET @@global.key_cache_block_size=@kcbs; ---echo # ---echo # Bug #11766769 : 59959: SMALL VALUES OF --MAX-ALLOWED-PACKET ---echo # ARE NOT BEING HONORED ---echo # - -CREATE TABLE t1 (a MEDIUMTEXT); - -SET GLOBAL max_allowed_packet=2048; -SET GLOBAL net_buffer_length=4096; -CONNECT (con1,localhost,root,,test); -SHOW SESSION VARIABLES LIKE 'max_allowed_packet'; -SHOW SESSION VARIABLES LIKE 'net_buffer_length'; ---disable_query_log ---error ER_NET_PACKET_TOO_LARGE -INSERT INTO t1 VALUES ('123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890'); ---enable_query_log -SELECT LENGTH(a) FROM t1; - -CONNECTION default; -DISCONNECT con1; -SET GLOBAL max_allowed_packet=default; -SET GLOBAL net_buffer_length=default; -DROP TABLE t1; - - --echo End of 5.1 tests From cd71e11cc825f55efceba44b055af47db88b5116 Mon Sep 17 00:00:00 2001 From: Georgi Kodinov Date: Mon, 28 Mar 2011 13:32:25 +0300 Subject: [PATCH 32/91] Fixed a test failure becase of a new warning caused by the fix for Bug #11766769 --- mysql-test/r/shm.result | 2 ++ 1 file changed, 2 insertions(+) diff --git a/mysql-test/r/shm.result b/mysql-test/r/shm.result index c504fe222ef..0e086e000c7 100644 --- a/mysql-test/r/shm.result +++ b/mysql-test/r/shm.result @@ -2155,6 +2155,8 @@ mysqld is alive SET @max_allowed_packet= @@global.max_allowed_packet; SET @net_buffer_length= @@global.net_buffer_length; SET GLOBAL max_allowed_packet= 1024; +Warnings: +Warning 1105 The value of 'max_allowed_packet' should be no less than the value of 'net_buffer_length' SET GLOBAL net_buffer_length= 1024; ERROR 1153 (08S01) at line 1: Got a packet bigger than 'max_allowed_packet' bytes SET GLOBAL max_allowed_packet= @max_allowed_packet; From 4ed8cb4a76275a28231a842c9112834d384b7b4c Mon Sep 17 00:00:00 2001 From: Georgi Kodinov Date: Mon, 28 Mar 2011 13:43:30 +0300 Subject: [PATCH 33/91] Added support for VS10. Fixed RelWithDebugInfo bzr ignores. --- .bzrignore | 6 +++++- win/build-vs10.bat | 18 ++++++++++++++++++ win/build-vs10_x64.bat | 18 ++++++++++++++++++ 3 files changed, 41 insertions(+), 1 deletion(-) create mode 100644 win/build-vs10.bat create mode 100644 win/build-vs10_x64.bat diff --git a/.bzrignore b/.bzrignore index 3d27c001e2b..0d668308193 100644 --- a/.bzrignore +++ b/.bzrignore @@ -9,6 +9,7 @@ *.core *.d *.da +*.dir *.dll *.exe *.exp @@ -30,6 +31,7 @@ *.pdb *.reject *.res +*.rule *.sbr *.so *.so.* @@ -37,6 +39,8 @@ *.user *.vcproj *.vcproj.cmake +*.vcxproj +*.vcxproj.filters */*.dir/* */*_pure_*warnings */.deps @@ -45,7 +49,7 @@ */debug/* */minsizerel/* */release/* -*/relwithdebinfo/* +RelWithDebInfo *~ .*.swp ./CMakeCache.txt diff --git a/win/build-vs10.bat b/win/build-vs10.bat new file mode 100644 index 00000000000..c2bc09b17df --- /dev/null +++ b/win/build-vs10.bat @@ -0,0 +1,18 @@ +@echo off + +REM Copyright (c) 2006,2010 Oracle and/or its affiliates. All rights reserved. +REM +REM This program is free software; you can redistribute it and/or modify +REM it under the terms of the GNU General Public License as published by +REM the Free Software Foundation; version 2 of the License. +REM +REM This program is distributed in the hope that it will be useful, +REM but WITHOUT ANY WARRANTY; without even the implied warranty of +REM MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the +REM GNU General Public License for more details. +REM +REM You should have received a copy of the GNU General Public License +REM along with this program; if not, write to the Free Software +REM Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA +cmake -G "Visual Studio 10" + diff --git a/win/build-vs10_x64.bat b/win/build-vs10_x64.bat new file mode 100644 index 00000000000..6fabe62a1ff --- /dev/null +++ b/win/build-vs10_x64.bat @@ -0,0 +1,18 @@ +@echo off + +REM Copyright (c) 2006,2010 Oracle and/or its affiliates. All rights reserved. +REM +REM This program is free software; you can redistribute it and/or modify +REM it under the terms of the GNU General Public License as published by +REM the Free Software Foundation; version 2 of the License. +REM +REM This program is distributed in the hope that it will be useful, +REM but WITHOUT ANY WARRANTY; without even the implied warranty of +REM MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the +REM GNU General Public License for more details. +REM +REM You should have received a copy of the GNU General Public License +REM along with this program; if not, write to the Free Software +REM Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA +cmake -G "Visual Studio 10 Win64" + From d6125b27b38432d1a465397c0c5a9e62bb1c65d3 Mon Sep 17 00:00:00 2001 From: Sergey Glukhov Date: Mon, 28 Mar 2011 17:24:25 +0400 Subject: [PATCH 34/91] Bug#11765216 58154: UNINITIALIZED VARIABLE FORMAT IN STR_TO_DATE FUNCTION Valgrind warning happens due to uninitialized cached_format_type field which is used later in Item_func_str_to_date::val_str method. The fix is to init cached_format_type field. mysql-test/r/func_time.result: test case mysql-test/t/func_time.test: test case sql/item_timefunc.cc: init cached_format_type field --- mysql-test/r/func_time.result | 6 ++++++ mysql-test/t/func_time.test | 8 ++++++++ sql/item_timefunc.cc | 1 + 3 files changed, 15 insertions(+) diff --git a/mysql-test/r/func_time.result b/mysql-test/r/func_time.result index f63860039d7..01743e4a1dc 100644 --- a/mysql-test/r/func_time.result +++ b/mysql-test/r/func_time.result @@ -1381,4 +1381,10 @@ DROP TABLE t1; SELECT STR_TO_DATE(SPACE(2),'1'); STR_TO_DATE(SPACE(2),'1') 0000-00-00 +# +# Bug#11765216 58154: UNINITIALIZED VARIABLE FORMAT IN STR_TO_DATE FUNCTION +# +SET GLOBAL SQL_MODE=''; +DO STR_TO_DATE((''), FROM_DAYS(@@GLOBAL.SQL_MODE)); +SET GLOBAL SQL_MODE=DEFAULT; End of 5.1 tests diff --git a/mysql-test/t/func_time.test b/mysql-test/t/func_time.test index c48351d33f2..3f441c42d48 100644 --- a/mysql-test/t/func_time.test +++ b/mysql-test/t/func_time.test @@ -887,4 +887,12 @@ DROP TABLE t1; SELECT STR_TO_DATE(SPACE(2),'1'); +--echo # +--echo # Bug#11765216 58154: UNINITIALIZED VARIABLE FORMAT IN STR_TO_DATE FUNCTION +--echo # + +SET GLOBAL SQL_MODE=''; +DO STR_TO_DATE((''), FROM_DAYS(@@GLOBAL.SQL_MODE)); +SET GLOBAL SQL_MODE=DEFAULT; + --echo End of 5.1 tests diff --git a/sql/item_timefunc.cc b/sql/item_timefunc.cc index 71b2baf4fee..ecf790cc061 100644 --- a/sql/item_timefunc.cc +++ b/sql/item_timefunc.cc @@ -3293,6 +3293,7 @@ void Item_func_str_to_date::fix_length_and_dec() { maybe_null= 1; decimals=0; + cached_format_type= DATE_TIME; cached_field_type= MYSQL_TYPE_DATETIME; max_length= MAX_DATETIME_FULL_WIDTH*MY_CHARSET_BIN_MB_MAXLEN; cached_timestamp_type= MYSQL_TIMESTAMP_NONE; From 47885f552b1822291584b71c791fd5175ba6567f Mon Sep 17 00:00:00 2001 From: Sergey Glukhov Date: Mon, 28 Mar 2011 17:27:44 +0400 Subject: [PATCH 35/91] Bug#11766087 59125: VALGRIND UNINITIALISED VALUE WARNING IN ULL2DEC, LONGLONG2DECIMAL Valgrind warning happens due to missing NULL value check in Item_func::val_decimal. The fix is to add this check. mysql-test/r/func_time.result: test case mysql-test/t/func_time.test: test case sql/item_func.cc: added check for NULL value --- mysql-test/r/func_time.result | 6 ++++++ mysql-test/t/func_time.test | 6 ++++++ sql/item_func.cc | 5 ++++- 3 files changed, 16 insertions(+), 1 deletion(-) diff --git a/mysql-test/r/func_time.result b/mysql-test/r/func_time.result index 01743e4a1dc..bbb506035dc 100644 --- a/mysql-test/r/func_time.result +++ b/mysql-test/r/func_time.result @@ -1387,4 +1387,10 @@ STR_TO_DATE(SPACE(2),'1') SET GLOBAL SQL_MODE=''; DO STR_TO_DATE((''), FROM_DAYS(@@GLOBAL.SQL_MODE)); SET GLOBAL SQL_MODE=DEFAULT; +# +# Bug#11766087 59125: VALGRIND UNINITIALISED VALUE WARNING IN ULL2DEC, LONGLONG2DECIMAL +# +SELECT FORMAT(YEAR(STR_TO_DATE('',GET_FORMAT(TIME,''))),1); +FORMAT(YEAR(STR_TO_DATE('',GET_FORMAT(TIME,''))),1) +NULL End of 5.1 tests diff --git a/mysql-test/t/func_time.test b/mysql-test/t/func_time.test index 3f441c42d48..2c3d3849793 100644 --- a/mysql-test/t/func_time.test +++ b/mysql-test/t/func_time.test @@ -895,4 +895,10 @@ SET GLOBAL SQL_MODE=''; DO STR_TO_DATE((''), FROM_DAYS(@@GLOBAL.SQL_MODE)); SET GLOBAL SQL_MODE=DEFAULT; +--echo # +--echo # Bug#11766087 59125: VALGRIND UNINITIALISED VALUE WARNING IN ULL2DEC, LONGLONG2DECIMAL +--echo # + +SELECT FORMAT(YEAR(STR_TO_DATE('',GET_FORMAT(TIME,''))),1); + --echo End of 5.1 tests diff --git a/sql/item_func.cc b/sql/item_func.cc index 79fa37bd372..595629b51be 100644 --- a/sql/item_func.cc +++ b/sql/item_func.cc @@ -482,7 +482,10 @@ bool Item_func::is_expensive_processor(uchar *arg) my_decimal *Item_func::val_decimal(my_decimal *decimal_value) { DBUG_ASSERT(fixed); - int2my_decimal(E_DEC_FATAL_ERROR, val_int(), unsigned_flag, decimal_value); + longlong nr= val_int(); + if (null_value) + return 0; /* purecov: inspected */ + int2my_decimal(E_DEC_FATAL_ERROR, nr, unsigned_flag, decimal_value); return decimal_value; } From 08e472ff349bb5d21b4881828ed62748ecf7aa40 Mon Sep 17 00:00:00 2001 From: Mayank Prasad Date: Mon, 28 Mar 2011 21:01:37 +0530 Subject: [PATCH 36/91] Bug#11751148 : show events shows events in other schema Issue: ====== Test case Correction for bug#11751148. mysql-test/r/events_bugs.result: Result file Correction for bug#11751148. mysql-test/t/events_bugs.test: Test case Correction for bug#11751148. --- mysql-test/r/events_bugs.result | 8 ++++---- mysql-test/t/events_bugs.test | 8 ++++---- 2 files changed, 8 insertions(+), 8 deletions(-) diff --git a/mysql-test/r/events_bugs.result b/mysql-test/r/events_bugs.result index ab1e9884efd..dfb8f008c5a 100644 --- a/mysql-test/r/events_bugs.result +++ b/mysql-test/r/events_bugs.result @@ -747,15 +747,15 @@ event_name originator ev1 4294967295 DROP EVENT ev1; SET GLOBAL server_id = @old_server_id; +CREATE DATABASE event_test12; +USE event_test12; +CREATE EVENT ev1 ON SCHEDULE EVERY 1 DAY DO SELECT 1; CREATE DATABASE event_test1; USE event_test1; -CREATE EVENT ev1 ON SCHEDULE EVERY 1 DAY DO SELECT 1; -CREATE DATABASE event_test2; -USE event_test2; SHOW EVENTS; Db Name Definer Time zone Type Execute at Interval value Interval field Starts Ends Status Originator character_set_client collation_connection Database Collation DROP DATABASE event_test1; -DROP DATABASE event_test2; +DROP DATABASE event_test12; DROP DATABASE events_test; SET GLOBAL event_scheduler= 'ON'; SET @@global.concurrent_insert= @concurrent_insert; diff --git a/mysql-test/t/events_bugs.test b/mysql-test/t/events_bugs.test index 83e37cdccdb..420e7183621 100644 --- a/mysql-test/t/events_bugs.test +++ b/mysql-test/t/events_bugs.test @@ -1225,15 +1225,15 @@ SET GLOBAL server_id = @old_server_id; # Bug#11751148: show events shows events in other schema # +CREATE DATABASE event_test12; +USE event_test12; +CREATE EVENT ev1 ON SCHEDULE EVERY 1 DAY DO SELECT 1; CREATE DATABASE event_test1; USE event_test1; -CREATE EVENT ev1 ON SCHEDULE EVERY 1 DAY DO SELECT 1; -CREATE DATABASE event_test2; -USE event_test2; # Following show events should not show ev1 SHOW EVENTS; DROP DATABASE event_test1; -DROP DATABASE event_test2; +DROP DATABASE event_test12; ########################################################################### From 4e26a41f3e2cac5ec5016b862944c0116a18b0f6 Mon Sep 17 00:00:00 2001 From: Jon Olav Hauglid Date: Tue, 29 Mar 2011 10:09:05 +0200 Subject: [PATCH 37/91] Bug# 11763784 (former 56541) ASSERTION TABLE->DB_STAT FAILED IN SQL_BASE.CC::OPEN_TABLE() DURING I_S Q This assert could be triggered if a statement requiring a name lock on a table (e.g. DROP TRIGGER) executed concurrently with an I_S query which also used the table. One connection first started an I_S query that opened a given table. Then another connection started a statement requiring a name lock on the same table. This statement was blocked since the table was in use by the I_S query. When the I_S query resumed and tried to open the table again as part of get_all_tables(), it would encounter a table instance with an old version number representing the pending name lock. Since I_S queries ignore version checks and thus pending name locks, it would try to continue. This caused it to encounter the assert. The assert checked that the TABLE instance found with a different version, was a real, open table. However, since this TABLE instance instead represented a pending name lock, the check would fail and trigger the assert. This patch fixes the problem by removing the assert. It is ok for TABLE::db_stat to be 0 in this case since the TABLE instance can represent a pending name lock. Test case added to lock_sync.test. --- mysql-test/r/lock_sync.result | 27 ++++++++++++++++++ mysql-test/t/lock_sync.test | 54 +++++++++++++++++++++++++++++++++++ sql/sql_base.cc | 3 +- 3 files changed, 82 insertions(+), 2 deletions(-) diff --git a/mysql-test/r/lock_sync.result b/mysql-test/r/lock_sync.result index 752f278a2b4..8b662cc8a82 100644 --- a/mysql-test/r/lock_sync.result +++ b/mysql-test/r/lock_sync.result @@ -629,3 +629,30 @@ drop procedure p1; drop procedure p2; drop table t1, t2, t3, t4, t5, te; set @@global.concurrent_insert= @old_concurrent_insert; +# +# Bug#11763784 56541: ASSERTION TABLE->DB_STAT FAILED IN +# SQL_BASE.CC::OPEN_TABLE() DURING I_S Q +# +DROP TABLE IF EXISTS t1; +CREATE TABLE t1(a int); +INSERT INTO t1 VALUES (1), (2); +CREATE TRIGGER t1_bi BEFORE INSERT ON t1 FOR EACH ROW BEGIN END; +# Connection con2 +SET DEBUG_SYNC= 'before_open_in_get_all_tables SIGNAL is_waits WAIT_FOR is_cont'; +# Sending: +SELECT * FROM information_schema.table_constraints JOIN t1 ON table_name = a; +# Connection con1 +SET DEBUG_SYNC= 'now WAIT_FOR is_waits'; +# Sending: +DROP TRIGGER t1_bi; +# Connection default +# Wait until DROP TRIGGER is blocked, waiting for t1 +SET DEBUG_SYNC= 'now SIGNAL is_cont'; +# Connection con2 +# Reaping SELECT * FROM information_schema.table_constraints JOIN t1... +CONSTRAINT_CATALOG CONSTRAINT_SCHEMA CONSTRAINT_NAME TABLE_SCHEMA TABLE_NAME CONSTRAINT_TYPE a +# Connection con1 +# Reaping DROP TRIGGER t1_bi +# Connection default +DROP TABLE t1; +SET DEBUG_SYNC= 'RESET'; diff --git a/mysql-test/t/lock_sync.test b/mysql-test/t/lock_sync.test index 17f8abb75f3..1df09524140 100644 --- a/mysql-test/t/lock_sync.test +++ b/mysql-test/t/lock_sync.test @@ -862,6 +862,60 @@ disconnect con2; set @@global.concurrent_insert= @old_concurrent_insert; +--echo # +--echo # Bug#11763784 56541: ASSERTION TABLE->DB_STAT FAILED IN +--echo # SQL_BASE.CC::OPEN_TABLE() DURING I_S Q +--echo # + +--disable_warnings +DROP TABLE IF EXISTS t1; +--enable_warnings + +CREATE TABLE t1(a int); +INSERT INTO t1 VALUES (1), (2); +CREATE TRIGGER t1_bi BEFORE INSERT ON t1 FOR EACH ROW BEGIN END; + +connect (con1, localhost, root); +--echo # Connection con2 +connect (con2, localhost, root); +SET DEBUG_SYNC= 'before_open_in_get_all_tables SIGNAL is_waits WAIT_FOR is_cont'; +--echo # Sending: +--send SELECT * FROM information_schema.table_constraints JOIN t1 ON table_name = a + +--echo # Connection con1 +connection con1; +SET DEBUG_SYNC= 'now WAIT_FOR is_waits'; +--echo # Sending: +--send DROP TRIGGER t1_bi + +--echo # Connection default +connection default; +--echo # Wait until DROP TRIGGER is blocked, waiting for t1 +let $wait_condition= + SELECT COUNT(*) = 1 FROM information_schema.processlist + WHERE state = "Waiting for table" AND + info = "DROP TRIGGER t1_bi"; +--source include/wait_condition.inc +SET DEBUG_SYNC= 'now SIGNAL is_cont'; + +--echo # Connection con2 +connection con2; +--echo # Reaping SELECT * FROM information_schema.table_constraints JOIN t1... +--reap + +--echo # Connection con1 +connection con1; +--echo # Reaping DROP TRIGGER t1_bi +--reap + +--echo # Connection default +connection default; +DROP TABLE t1; +SET DEBUG_SYNC= 'RESET'; +disconnect con1; +disconnect con2; + + # Check that all connections opened by test cases in this file are really # gone so execution of other tests won't be affected by their presence. --source include/wait_until_count_sessions.inc diff --git a/sql/sql_base.cc b/sql/sql_base.cc index 9765148cda1..dc78f3b84c6 100644 --- a/sql/sql_base.cc +++ b/sql/sql_base.cc @@ -2798,10 +2798,9 @@ TABLE *open_table(THD *thd, TABLE_LIST *table_list, MEM_ROOT *mem_root, ("Found table '%s.%s' with different refresh version", table_list->db, table_list->table_name)); - /* Ignore FLUSH, but not name locks! */ + /* Ignore FLUSH and pending name locks, but not acquired name locks! */ if (flags & MYSQL_LOCK_IGNORE_FLUSH && !table->open_placeholder) { - DBUG_ASSERT(table->db_stat); /* Force close at once after usage */ thd->version= table->s->version; continue; From 3b7f044534ae24ce0a098d598bc7fc7a2b40fe4f Mon Sep 17 00:00:00 2001 From: Sergey Glukhov Date: Wed, 30 Mar 2011 11:00:41 +0400 Subject: [PATCH 38/91] Bug#11766126 59166: ANOTHER DATETIME VALGRIND UNINITIALIZED WARNING Valgrind warning happens because null values check happens too late in Item_func_month::val_str(after result string calculation).The fix is to check null value before result string calculation. mysql-test/r/func_time.result: test case mysql-test/t/func_time.test: test case sql/item_timefunc.h: check null value before result string calculation. --- mysql-test/r/func_time.result | 6 ++++++ mysql-test/t/func_time.test | 6 ++++++ sql/item_timefunc.h | 7 +++++-- 3 files changed, 17 insertions(+), 2 deletions(-) diff --git a/mysql-test/r/func_time.result b/mysql-test/r/func_time.result index bbb506035dc..fd543ba4308 100644 --- a/mysql-test/r/func_time.result +++ b/mysql-test/r/func_time.result @@ -1393,4 +1393,10 @@ SET GLOBAL SQL_MODE=DEFAULT; SELECT FORMAT(YEAR(STR_TO_DATE('',GET_FORMAT(TIME,''))),1); FORMAT(YEAR(STR_TO_DATE('',GET_FORMAT(TIME,''))),1) NULL +# +# Bug#11766126 59166: ANOTHER DATETIME VALGRIND UNINITIALIZED WARNING +# +SELECT CAST((MONTH(FROM_UNIXTIME(@@GLOBAL.SQL_MODE))) AS BINARY(1025)); +CAST((MONTH(FROM_UNIXTIME(@@GLOBAL.SQL_MODE))) AS BINARY(1025)) +NULL End of 5.1 tests diff --git a/mysql-test/t/func_time.test b/mysql-test/t/func_time.test index 2c3d3849793..1bc56c0f403 100644 --- a/mysql-test/t/func_time.test +++ b/mysql-test/t/func_time.test @@ -901,4 +901,10 @@ SET GLOBAL SQL_MODE=DEFAULT; SELECT FORMAT(YEAR(STR_TO_DATE('',GET_FORMAT(TIME,''))),1); +--echo # +--echo # Bug#11766126 59166: ANOTHER DATETIME VALGRIND UNINITIALIZED WARNING +--echo # + +SELECT CAST((MONTH(FROM_UNIXTIME(@@GLOBAL.SQL_MODE))) AS BINARY(1025)); + --echo End of 5.1 tests diff --git a/sql/item_timefunc.h b/sql/item_timefunc.h index 9c1ac512bcb..396b5bbb200 100644 --- a/sql/item_timefunc.h +++ b/sql/item_timefunc.h @@ -106,8 +106,11 @@ public: { DBUG_ASSERT(fixed == 1); return (double) Item_func_month::val_int(); } String *val_str(String *str) { - str->set(val_int(), &my_charset_bin); - return null_value ? 0 : str; + longlong nr= val_int(); + if (null_value) + return 0; + str->set(nr, &my_charset_bin); + return str; } const char *func_name() const { return "month"; } enum Item_result result_type () const { return INT_RESULT; } From a7d383cbb8db5478c1c53a025afda967ad09299b Mon Sep 17 00:00:00 2001 From: Sergey Glukhov Date: Wed, 30 Mar 2011 11:08:35 +0400 Subject: [PATCH 39/91] Bug#11766124 59164: VALGRIND: UNINITIALIZED VALUE IN NUMBER_TO_DATETIME Valgrind warning happens due to missing NULL value check in Item::get_date. The fix is to add this check. mysql-test/r/func_time.result: test case mysql-test/t/func_time.test: test case sql/item.cc: added check for NULL value --- mysql-test/r/func_time.result | 6 ++++++ mysql-test/t/func_time.test | 6 ++++++ sql/item.cc | 6 +++++- 3 files changed, 17 insertions(+), 1 deletion(-) diff --git a/mysql-test/r/func_time.result b/mysql-test/r/func_time.result index fd543ba4308..f67171af99f 100644 --- a/mysql-test/r/func_time.result +++ b/mysql-test/r/func_time.result @@ -1399,4 +1399,10 @@ NULL SELECT CAST((MONTH(FROM_UNIXTIME(@@GLOBAL.SQL_MODE))) AS BINARY(1025)); CAST((MONTH(FROM_UNIXTIME(@@GLOBAL.SQL_MODE))) AS BINARY(1025)) NULL +# +# Bug#11766124 59164: VALGRIND: UNINITIALIZED VALUE IN NUMBER_TO_DATETIME +# +SELECT ADDDATE(MONTH(FROM_UNIXTIME(NULL)),INTERVAL 1 HOUR); +ADDDATE(MONTH(FROM_UNIXTIME(NULL)),INTERVAL 1 HOUR) +NULL End of 5.1 tests diff --git a/mysql-test/t/func_time.test b/mysql-test/t/func_time.test index 1bc56c0f403..938359f8c11 100644 --- a/mysql-test/t/func_time.test +++ b/mysql-test/t/func_time.test @@ -907,4 +907,10 @@ SELECT FORMAT(YEAR(STR_TO_DATE('',GET_FORMAT(TIME,''))),1); SELECT CAST((MONTH(FROM_UNIXTIME(@@GLOBAL.SQL_MODE))) AS BINARY(1025)); +--echo # +--echo # Bug#11766124 59164: VALGRIND: UNINITIALIZED VALUE IN NUMBER_TO_DATETIME +--echo # + +SELECT ADDDATE(MONTH(FROM_UNIXTIME(NULL)),INTERVAL 1 HOUR); + --echo End of 5.1 tests diff --git a/sql/item.cc b/sql/item.cc index 357cc6d7fe4..f90cf562c0b 100644 --- a/sql/item.cc +++ b/sql/item.cc @@ -926,8 +926,12 @@ bool Item::get_date(MYSQL_TIME *ltime,uint fuzzydate) } else { - longlong value= val_int(); int was_cut; + longlong value= val_int(); + + if (null_value) + goto err; + if (number_to_datetime(value, ltime, fuzzydate, &was_cut) == LL(-1)) { char buff[22], *end; From ddec6ecdd8521d6fd6e4c26498e7bd752fd3eddf Mon Sep 17 00:00:00 2001 From: =?UTF-8?q?Marko=20M=C3=A4kel=C3=A4?= Date: Wed, 30 Mar 2011 14:25:58 +0300 Subject: [PATCH 40/91] Bug#11877216 InnoDB too eager to commit suicide on a busy server sync_array_print_long_waits(): Return the longest waiting thread ID and the longest waited-for lock. Only if those remain unchanged between calls in srv_error_monitor_thread(), increment fatal_cnt. Otherwise, reset fatal_cnt. Background: There is a built-in watchdog in InnoDB whose purpose is to kill the server when some thread is stuck waiting for a mutex or rw-lock. Before this fix, the logic was flawed. The function sync_array_print_long_waits() returns TRUE if it finds a lock wait that exceeds 10 minutes (srv_fatal_semaphore_wait_threshold). The function srv_error_monitor_thread() will kill the server if this happens 10 times in a row (fatal_cnt reaches 10), checked every 30 seconds. This is wrong, because this situation does not mean that the server is hung. If the server is very busy for a little over 15 minutes, it will be killed. Consider this example. Thread T1 is waiting for mutex M. Some time later, threads T2..Tn start waiting for the same mutex M. If T1 keeps waiting for 600 seconds, fatal_cnt will be incremented to 1. So far, so good. Now, if M is granted to T1, the server was obviously not stuck. But, T2..Tn keeps waiting, and their wait time will be longer than 600 seconds. If 5 minutes later, some Tn has still been waiting for more than 10 minutes for the mutex M, the server can be killed, even though it is not stuck. rb:622 approved by Jimmy Yang --- storage/innobase/include/sync0arr.h | 11 +++++--- storage/innobase/srv/srv0srv.c | 19 +++++++++---- storage/innobase/sync/sync0arr.c | 36 ++++++++++++++++++------ storage/innodb_plugin/ChangeLog | 5 ++++ storage/innodb_plugin/include/sync0arr.h | 7 +++-- storage/innodb_plugin/srv/srv0srv.c | 11 +++++++- storage/innodb_plugin/sync/sync0arr.c | 32 ++++++++++++++++----- 7 files changed, 93 insertions(+), 28 deletions(-) diff --git a/storage/innobase/include/sync0arr.h b/storage/innobase/include/sync0arr.h index fae26b7a63e..ec48059dbcb 100644 --- a/storage/innobase/include/sync0arr.h +++ b/storage/innobase/include/sync0arr.h @@ -93,10 +93,13 @@ sync_arr_wake_threads_if_sema_free(void); Prints warnings of long semaphore waits to stderr. */ ibool -sync_array_print_long_waits(void); -/*=============================*/ - /* out: TRUE if fatal semaphore wait threshold - was exceeded */ +sync_array_print_long_waits( +/*========================*/ + /* out: TRUE if fatal semaphore wait threshold + was exceeded */ + os_thread_id_t* waiter, /* out: longest waiting thread */ + const void** sema) /* out: longest-waited-for semaphore */ + __attribute__((nonnull)); /************************************************************************ Validates the integrity of the wait array. Checks that the number of reserved cells equals the count variable. */ diff --git a/storage/innobase/srv/srv0srv.c b/storage/innobase/srv/srv0srv.c index 9c34e73109c..3f6f1982992 100644 --- a/storage/innobase/srv/srv0srv.c +++ b/storage/innobase/srv/srv0srv.c @@ -2180,9 +2180,15 @@ srv_error_monitor_thread( os_thread_create */ { /* number of successive fatal timeouts observed */ - ulint fatal_cnt = 0; - dulint old_lsn; - dulint new_lsn; + ulint fatal_cnt = 0; + dulint old_lsn; + dulint new_lsn; + /* longest waiting thread for a semaphore */ + os_thread_id_t waiter = os_thread_get_curr_id(); + os_thread_id_t old_waiter = waiter; + /* the semaphore that is being waited for */ + const void* sema = NULL; + const void* old_sema = NULL; old_lsn = srv_start_lsn; @@ -2224,10 +2230,11 @@ loop: /* In case mutex_exit is not a memory barrier, it is theoretically possible some threads are left waiting though the semaphore is already released. Wake up those threads: */ - + sync_arr_wake_threads_if_sema_free(); - if (sync_array_print_long_waits()) { + if (sync_array_print_long_waits(&waiter, &sema) + && sema == old_sema && os_thread_eq(waiter, old_waiter)) { fatal_cnt++; if (fatal_cnt > 10) { @@ -2242,6 +2249,8 @@ loop: } } else { fatal_cnt = 0; + old_waiter = waiter; + old_sema = sema; } /* Flush stderr so that a database user gets the output diff --git a/storage/innobase/sync/sync0arr.c b/storage/innobase/sync/sync0arr.c index 41d3492c8c9..93a7398f252 100644 --- a/storage/innobase/sync/sync0arr.c +++ b/storage/innobase/sync/sync0arr.c @@ -916,10 +916,12 @@ sync_arr_wake_threads_if_sema_free(void) Prints warnings of long semaphore waits to stderr. */ ibool -sync_array_print_long_waits(void) -/*=============================*/ - /* out: TRUE if fatal semaphore wait threshold - was exceeded */ +sync_array_print_long_waits( +/*========================*/ + /* out: TRUE if fatal semaphore wait threshold + was exceeded */ + os_thread_id_t* waiter, /* out: longest waiting thread */ + const void** sema) /* out: longest-waited-for semaphore */ { sync_cell_t* cell; ibool old_val; @@ -927,24 +929,40 @@ sync_array_print_long_waits(void) ulint i; ulint fatal_timeout = srv_fatal_semaphore_wait_threshold; ibool fatal = FALSE; + double longest_diff = 0; for (i = 0; i < sync_primary_wait_array->n_cells; i++) { + double diff; + void* wait_object; + cell = sync_array_get_nth_cell(sync_primary_wait_array, i); - if (cell->wait_object != NULL && cell->waiting - && difftime(time(NULL), cell->reservation_time) > 240) { + wait_object = cell->wait_object; + + if (wait_object == NULL || !cell->waiting) { + + continue; + } + + diff = difftime(time(NULL), cell->reservation_time); + + if (diff > 240) { fputs("InnoDB: Warning: a long semaphore wait:\n", stderr); sync_array_cell_print(stderr, cell); noticed = TRUE; } - if (cell->wait_object != NULL && cell->waiting - && difftime(time(NULL), cell->reservation_time) - > fatal_timeout) { + if (diff > fatal_timeout) { fatal = TRUE; } + + if (diff > longest_diff) { + longest_diff = diff; + *sema = wait_object; + *waiter = cell->thread; + } } if (noticed) { diff --git a/storage/innodb_plugin/ChangeLog b/storage/innodb_plugin/ChangeLog index 7c82cd9c27f..100cf3690ce 100644 --- a/storage/innodb_plugin/ChangeLog +++ b/storage/innodb_plugin/ChangeLog @@ -1,3 +1,8 @@ +2011-03-30 The InnoDB Team + + * srv/srv0srv.c, sync/sync0arr.h, sync/sync0arr.c: + Fix Bug#11877216 InnoDB too eager to commit suicide on a busy server + 2011-03-15 The InnoDB Team * btr/btr0cur.c, page/page0zip.c: diff --git a/storage/innodb_plugin/include/sync0arr.h b/storage/innodb_plugin/include/sync0arr.h index 5f1280f5e28..6e931346238 100644 --- a/storage/innodb_plugin/include/sync0arr.h +++ b/storage/innodb_plugin/include/sync0arr.h @@ -115,8 +115,11 @@ Prints warnings of long semaphore waits to stderr. @return TRUE if fatal semaphore wait threshold was exceeded */ UNIV_INTERN ibool -sync_array_print_long_waits(void); -/*=============================*/ +sync_array_print_long_waits( +/*========================*/ + os_thread_id_t* waiter, /*!< out: longest waiting thread */ + const void** sema) /*!< out: longest-waited-for semaphore */ + __attribute__((nonnull)); /********************************************************************//** Validates the integrity of the wait array. Checks that the number of reserved cells equals the count variable. */ diff --git a/storage/innodb_plugin/srv/srv0srv.c b/storage/innodb_plugin/srv/srv0srv.c index 3cf17f33c40..b1fc1ac67fd 100644 --- a/storage/innodb_plugin/srv/srv0srv.c +++ b/storage/innodb_plugin/srv/srv0srv.c @@ -2236,6 +2236,12 @@ srv_error_monitor_thread( ulint fatal_cnt = 0; ib_uint64_t old_lsn; ib_uint64_t new_lsn; + /* longest waiting thread for a semaphore */ + os_thread_id_t waiter = os_thread_get_curr_id(); + os_thread_id_t old_waiter = waiter; + /* the semaphore that is being waited for */ + const void* sema = NULL; + const void* old_sema = NULL; old_lsn = srv_start_lsn; @@ -2284,7 +2290,8 @@ loop: sync_arr_wake_threads_if_sema_free(); - if (sync_array_print_long_waits()) { + if (sync_array_print_long_waits(&waiter, &sema) + && sema == old_sema && os_thread_eq(waiter, old_waiter)) { fatal_cnt++; if (fatal_cnt > 10) { @@ -2299,6 +2306,8 @@ loop: } } else { fatal_cnt = 0; + old_waiter = waiter; + old_sema = sema; } /* Flush stderr so that a database user gets the output diff --git a/storage/innodb_plugin/sync/sync0arr.c b/storage/innodb_plugin/sync/sync0arr.c index ad29b90d344..13970023573 100644 --- a/storage/innodb_plugin/sync/sync0arr.c +++ b/storage/innodb_plugin/sync/sync0arr.c @@ -914,8 +914,10 @@ Prints warnings of long semaphore waits to stderr. @return TRUE if fatal semaphore wait threshold was exceeded */ UNIV_INTERN ibool -sync_array_print_long_waits(void) -/*=============================*/ +sync_array_print_long_waits( +/*========================*/ + os_thread_id_t* waiter, /*!< out: longest waiting thread */ + const void** sema) /*!< out: longest-waited-for semaphore */ { sync_cell_t* cell; ibool old_val; @@ -923,24 +925,40 @@ sync_array_print_long_waits(void) ulint i; ulint fatal_timeout = srv_fatal_semaphore_wait_threshold; ibool fatal = FALSE; + double longest_diff = 0; for (i = 0; i < sync_primary_wait_array->n_cells; i++) { + double diff; + void* wait_object; + cell = sync_array_get_nth_cell(sync_primary_wait_array, i); - if (cell->wait_object != NULL && cell->waiting - && difftime(time(NULL), cell->reservation_time) > 240) { + wait_object = cell->wait_object; + + if (wait_object == NULL || !cell->waiting) { + + continue; + } + + diff = difftime(time(NULL), cell->reservation_time); + + if (diff > 240) { fputs("InnoDB: Warning: a long semaphore wait:\n", stderr); sync_array_cell_print(stderr, cell); noticed = TRUE; } - if (cell->wait_object != NULL && cell->waiting - && difftime(time(NULL), cell->reservation_time) - > fatal_timeout) { + if (diff > fatal_timeout) { fatal = TRUE; } + + if (diff > longest_diff) { + longest_diff = diff; + *sema = wait_object; + *waiter = cell->thread; + } } if (noticed) { From 4c1eb0c1719004b66187a166ddf0765cb481a927 Mon Sep 17 00:00:00 2001 From: Bjorn Munch Date: Wed, 30 Mar 2011 14:33:53 +0200 Subject: [PATCH 41/91] mtr: cleaned up some superfluos global warning suppressions --- .../extra/rpl_tests/rpl_extra_col_master.test | 6 +-- mysql-test/include/mix1.inc | 4 ++ mysql-test/include/mtr_warnings.sql | 46 +------------------ mysql-test/r/ctype_cp932_binlog_stm.result | 1 + mysql-test/r/order_by.result | 1 + mysql-test/r/show_check.result | 1 + mysql-test/r/sp-destruct.result | 1 + .../rpl/r/rpl_extra_col_master_innodb.result | 18 ++++---- .../rpl/r/rpl_extra_col_master_myisam.result | 18 ++++---- mysql-test/t/ctype_cp932_binlog_stm.test | 2 + mysql-test/t/order_by.test | 3 +- mysql-test/t/show_check.test | 1 + mysql-test/t/sp-destruct.test | 1 + 13 files changed, 35 insertions(+), 68 deletions(-) diff --git a/mysql-test/extra/rpl_tests/rpl_extra_col_master.test b/mysql-test/extra/rpl_tests/rpl_extra_col_master.test index 6dba4202260..9bab1192d97 100644 --- a/mysql-test/extra/rpl_tests/rpl_extra_col_master.test +++ b/mysql-test/extra/rpl_tests/rpl_extra_col_master.test @@ -123,9 +123,9 @@ SELECT f1,f2,f3,f4,f5,f6,f7,f8,f9, #connection slave; call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column 2 type mismatch.* 1535"); -call mtr.add_suppression("Slave SQL.*Error .Can.t DROP .c7.; check that column.key exists. on query.* 1091"); -call mtr.add_suppression("Slave SQL.*Error .Unknown column .c7. in .t15.. on query.* 1054"); -call mtr.add_suppression("Slave SQL.*Error .Key column .c6. doesn.t exist in table. on query.* 1072"); +call mtr.add_suppression("Slave.*Can.t DROP .c7.; check that column.key exists.* Error_code: 1091"); +call mtr.add_suppression("Slave.*Unknown column .c7. in .t15.* Error_code: 1054"); +call mtr.add_suppression("Slave.*Key column .c6. doesn.t exist in table.* Error_code: 1072"); sync_slave_with_master; --echo diff --git a/mysql-test/include/mix1.inc b/mysql-test/include/mix1.inc index 194d9e41108..10f0d4546ed 100644 --- a/mysql-test/include/mix1.inc +++ b/mysql-test/include/mix1.inc @@ -634,6 +634,10 @@ drop table t1; drop table bug29807; create table bug29807 (a int); drop table bug29807; +--disable_query_log +call mtr.add_suppression("InnoDB: Error: table .test...bug29807. does not exist in the InnoDB internal"); +call mtr.add_suppression("Cannot find or open table test\/bug29807 from"); +--enable_query_log # diff --git a/mysql-test/include/mtr_warnings.sql b/mysql-test/include/mtr_warnings.sql index 30919dd10dc..03148f09fac 100644 --- a/mysql-test/include/mtr_warnings.sql +++ b/mysql-test/include/mtr_warnings.sql @@ -53,7 +53,7 @@ END -- Insert patterns that should always be suppressed -- INSERT INTO global_suppressions VALUES - ("'SELECT UNIX_TIMESTAMP\\(\\)' failed on master"), + (".SELECT UNIX_TIMESTAMP... failed on master"), ("Aborted connection"), ("Client requested master to start replication from impossible position"), ("Could not find first log file name in binary log"), @@ -110,7 +110,6 @@ INSERT INTO global_suppressions VALUES ("Sort aborted"), ("Time-out in NDB"), ("Warning:\s+One can only use the --user.*root"), - ("Warning:\s+Setting lower_case_table_names=2"), ("Warning:\s+Table:.* on (delete|rename)"), ("You have an error in your SQL syntax"), ("deprecated"), @@ -123,55 +122,21 @@ INSERT INTO global_suppressions VALUES ("slave SQL thread aborted"), ("Slave: .*Duplicate entry"), - /* - Special case, made as specific as possible, for: - Bug #28436: Incorrect position in SHOW BINLOG EVENTS causes - server coredump - */ - - ("Error in Log_event::read_log_event\\\(\\\): 'Sanity check failed', data_len: 258, event_type: 49"), - ("Statement may not be safe to log in statement format"), - /* test case for Bug#bug29807 copies a stray frm into database */ - ("InnoDB: Error: table `test`.`bug29807` does not exist in the InnoDB internal"), - ("Cannot find or open table test\/bug29807 from"), - /* innodb foreign key tests that fail in ALTER or RENAME produce this */ ("InnoDB: Error: in ALTER TABLE `test`.`t[123]`"), ("InnoDB: Error: in RENAME TABLE table `test`.`t1`"), ("InnoDB: Error: table `test`.`t[123]` does not exist in the InnoDB internal"), - /* Test case for Bug#14233 produces the following warnings: */ - ("Stored routine 'test'.'bug14233_1': invalid value in column mysql.proc"), - ("Stored routine 'test'.'bug14233_2': invalid value in column mysql.proc"), - ("Stored routine 'test'.'bug14233_3': invalid value in column mysql.proc"), - /* BUG#32080 - Excessive warnings on Solaris: setrlimit could not change the size of core files */ ("setrlimit could not change the size of core files to 'infinity'"), - /* - rpl_extrColmaster_*.test, the slave thread produces warnings - when it get updates to a table that has more columns on the - master - */ - ("Slave: Unknown column 'c7' in 't15' Error_code: 1054"), - ("Slave: Can't DROP 'c7'.* 1091"), - ("Slave: Key column 'c6'.* 1072"), ("The slave I.O thread stops because a fatal error is encountered when it try to get the value of SERVER_ID variable from master."), - (".SELECT UNIX_TIMESTAMP... failed on master, do not trust column Seconds_Behind_Master of SHOW SLAVE STATUS"), - /* Test case for Bug#31590 in order_by.test produces the following error */ - ("Out of sort memory; increase server sort buffer size"), - - /* Special case for Bug #26402 in show_check.test - - Question marks are not valid file name parts on Windows. Ignore - this error message. - */ - ("Can't find file: '.\\\\test\\\\\\?{8}.frm'"), ("Slave: Unknown table 't1' Error_code: 1051"), /* Messages from valgrind */ @@ -189,15 +154,6 @@ INSERT INTO global_suppressions VALUES ("==[0-9]*== Warning: invalid file descriptor -1 in syscall write()"), ("==[0-9]*== Warning: invalid file descriptor -1 in syscall read()"), - /* - Transient network failures that cause warnings on reconnect. - BUG#47743 and BUG#47983. - */ - ("Slave I/O: Get master SERVER_ID failed with error:.*"), - ("Slave I/O: Get master clock failed with error:.*"), - ("Slave I/O: Get master COLLATION_SERVER failed with error:.*"), - ("Slave I/O: Get master TIME_ZONE failed with error:.*"), - ("THE_LAST_SUPPRESSION")|| diff --git a/mysql-test/r/ctype_cp932_binlog_stm.result b/mysql-test/r/ctype_cp932_binlog_stm.result index 8854a835e25..1841cc3ef69 100644 --- a/mysql-test/r/ctype_cp932_binlog_stm.result +++ b/mysql-test/r/ctype_cp932_binlog_stm.result @@ -44,6 +44,7 @@ master-bin.000001 # Query # # use `test`; INSERT INTO t4 VALUES ( NAME_CONST('in master-bin.000001 # Query # # use `test`; DROP PROCEDURE bug18293 master-bin.000001 # Query # # use `test`; DROP TABLE t4 End of 5.0 tests +call mtr.add_suppression("Error in Log_event::read_log_event\\\(\\\): 'Sanity check failed', data_len: 258, event_type: 49"); SHOW BINLOG EVENTS FROM 365; ERROR HY000: Error when executing command SHOW BINLOG EVENTS: Wrong offset or I/O error Bug#44352 UPPER/LOWER function doesn't work correctly on cp932 and sjis environment. diff --git a/mysql-test/r/order_by.result b/mysql-test/r/order_by.result index 30879af418a..90b03711191 100644 --- a/mysql-test/r/order_by.result +++ b/mysql-test/r/order_by.result @@ -1428,6 +1428,7 @@ set session max_sort_length= 2180; select * from t1 order by b; ERROR HY001: Out of sort memory; increase server sort buffer size drop table t1; +call mtr.add_suppression("Out of sort memory; increase server sort buffer size"); # # Bug #39844: Query Crash Mysql Server 5.0.67 # diff --git a/mysql-test/r/show_check.result b/mysql-test/r/show_check.result index 1aa3d62fc70..7cb3f696449 100644 --- a/mysql-test/r/show_check.result +++ b/mysql-test/r/show_check.result @@ -1339,6 +1339,7 @@ drop table `été`; set names latin1; show columns from `#mysql50#????????`; Got one of the listed errors +call mtr.add_suppression("Can.t find file: '.\\\\test\\\\\\?{8}.frm'"); DROP TABLE IF EXISTS t1; DROP PROCEDURE IF EXISTS p1; CREATE TABLE t1(c1 INT); diff --git a/mysql-test/r/sp-destruct.result b/mysql-test/r/sp-destruct.result index b6891df2420..a9db461e84e 100644 --- a/mysql-test/r/sp-destruct.result +++ b/mysql-test/r/sp-destruct.result @@ -1,4 +1,5 @@ call mtr.add_suppression("Column count of mysql.proc is wrong. Expected 20, found 19. The table is probably corrupted"); +call mtr.add_suppression("Stored routine .test...bug14233_[123].: invalid value in column mysql.proc"); use test; drop procedure if exists bug14233; drop function if exists bug14233; diff --git a/mysql-test/suite/rpl/r/rpl_extra_col_master_innodb.result b/mysql-test/suite/rpl/r/rpl_extra_col_master_innodb.result index f235c68cc95..160f970fd5e 100644 --- a/mysql-test/suite/rpl/r/rpl_extra_col_master_innodb.result +++ b/mysql-test/suite/rpl/r/rpl_extra_col_master_innodb.result @@ -59,9 +59,9 @@ f1 f2 f3 f4 f5 f6 f7 f8 f9 hex(f10) hex(f11) 29 29 29 second 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 30 30 30 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column 2 type mismatch.* 1535"); -call mtr.add_suppression("Slave SQL.*Error .Can.t DROP .c7.; check that column.key exists. on query.* 1091"); -call mtr.add_suppression("Slave SQL.*Error .Unknown column .c7. in .t15.. on query.* 1054"); -call mtr.add_suppression("Slave SQL.*Error .Key column .c6. doesn.t exist in table. on query.* 1072"); +call mtr.add_suppression("Slave.*Can.t DROP .c7.; check that column.key exists.* Error_code: 1091"); +call mtr.add_suppression("Slave.*Unknown column .c7. in .t15.* Error_code: 1054"); +call mtr.add_suppression("Slave.*Key column .c6. doesn.t exist in table.* Error_code: 1072"); * Select count and 20 rows from Slave * @@ -934,9 +934,9 @@ f1 f2 f3 f4 f5 f6 f7 f8 f9 hex(f10) hex(f11) 29 29 29 second 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 30 30 30 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column 2 type mismatch.* 1535"); -call mtr.add_suppression("Slave SQL.*Error .Can.t DROP .c7.; check that column.key exists. on query.* 1091"); -call mtr.add_suppression("Slave SQL.*Error .Unknown column .c7. in .t15.. on query.* 1054"); -call mtr.add_suppression("Slave SQL.*Error .Key column .c6. doesn.t exist in table. on query.* 1072"); +call mtr.add_suppression("Slave.*Can.t DROP .c7.; check that column.key exists.* Error_code: 1091"); +call mtr.add_suppression("Slave.*Unknown column .c7. in .t15.* Error_code: 1054"); +call mtr.add_suppression("Slave.*Key column .c6. doesn.t exist in table.* Error_code: 1072"); * Select count and 20 rows from Slave * @@ -1809,9 +1809,9 @@ f1 f2 f3 f4 f5 f6 f7 f8 f9 hex(f10) hex(f11) 29 29 29 second 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 30 30 30 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column 2 type mismatch.* 1535"); -call mtr.add_suppression("Slave SQL.*Error .Can.t DROP .c7.; check that column.key exists. on query.* 1091"); -call mtr.add_suppression("Slave SQL.*Error .Unknown column .c7. in .t15.. on query.* 1054"); -call mtr.add_suppression("Slave SQL.*Error .Key column .c6. doesn.t exist in table. on query.* 1072"); +call mtr.add_suppression("Slave.*Can.t DROP .c7.; check that column.key exists.* Error_code: 1091"); +call mtr.add_suppression("Slave.*Unknown column .c7. in .t15.* Error_code: 1054"); +call mtr.add_suppression("Slave.*Key column .c6. doesn.t exist in table.* Error_code: 1072"); * Select count and 20 rows from Slave * diff --git a/mysql-test/suite/rpl/r/rpl_extra_col_master_myisam.result b/mysql-test/suite/rpl/r/rpl_extra_col_master_myisam.result index 52f4a7a8453..11356dd8620 100644 --- a/mysql-test/suite/rpl/r/rpl_extra_col_master_myisam.result +++ b/mysql-test/suite/rpl/r/rpl_extra_col_master_myisam.result @@ -59,9 +59,9 @@ f1 f2 f3 f4 f5 f6 f7 f8 f9 hex(f10) hex(f11) 29 29 29 second 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 30 30 30 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column 2 type mismatch.* 1535"); -call mtr.add_suppression("Slave SQL.*Error .Can.t DROP .c7.; check that column.key exists. on query.* 1091"); -call mtr.add_suppression("Slave SQL.*Error .Unknown column .c7. in .t15.. on query.* 1054"); -call mtr.add_suppression("Slave SQL.*Error .Key column .c6. doesn.t exist in table. on query.* 1072"); +call mtr.add_suppression("Slave.*Can.t DROP .c7.; check that column.key exists.* Error_code: 1091"); +call mtr.add_suppression("Slave.*Unknown column .c7. in .t15.* Error_code: 1054"); +call mtr.add_suppression("Slave.*Key column .c6. doesn.t exist in table.* Error_code: 1072"); * Select count and 20 rows from Slave * @@ -934,9 +934,9 @@ f1 f2 f3 f4 f5 f6 f7 f8 f9 hex(f10) hex(f11) 29 29 29 second 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 30 30 30 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column 2 type mismatch.* 1535"); -call mtr.add_suppression("Slave SQL.*Error .Can.t DROP .c7.; check that column.key exists. on query.* 1091"); -call mtr.add_suppression("Slave SQL.*Error .Unknown column .c7. in .t15.. on query.* 1054"); -call mtr.add_suppression("Slave SQL.*Error .Key column .c6. doesn.t exist in table. on query.* 1072"); +call mtr.add_suppression("Slave.*Can.t DROP .c7.; check that column.key exists.* Error_code: 1091"); +call mtr.add_suppression("Slave.*Unknown column .c7. in .t15.* Error_code: 1054"); +call mtr.add_suppression("Slave.*Key column .c6. doesn.t exist in table.* Error_code: 1072"); * Select count and 20 rows from Slave * @@ -1809,9 +1809,9 @@ f1 f2 f3 f4 f5 f6 f7 f8 f9 hex(f10) hex(f11) 29 29 29 second 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 30 30 30 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column 2 type mismatch.* 1535"); -call mtr.add_suppression("Slave SQL.*Error .Can.t DROP .c7.; check that column.key exists. on query.* 1091"); -call mtr.add_suppression("Slave SQL.*Error .Unknown column .c7. in .t15.. on query.* 1054"); -call mtr.add_suppression("Slave SQL.*Error .Key column .c6. doesn.t exist in table. on query.* 1072"); +call mtr.add_suppression("Slave.*Can.t DROP .c7.; check that column.key exists.* Error_code: 1091"); +call mtr.add_suppression("Slave.*Unknown column .c7. in .t15.* Error_code: 1054"); +call mtr.add_suppression("Slave.*Key column .c6. doesn.t exist in table.* Error_code: 1072"); * Select count and 20 rows from Slave * diff --git a/mysql-test/t/ctype_cp932_binlog_stm.test b/mysql-test/t/ctype_cp932_binlog_stm.test index f3038ccfa61..95252a95368 100644 --- a/mysql-test/t/ctype_cp932_binlog_stm.test +++ b/mysql-test/t/ctype_cp932_binlog_stm.test @@ -33,6 +33,8 @@ delimiter ;| # Note: 364 is a magic position (found experimentally, depends on # the log's contents) that caused the server crash. +call mtr.add_suppression("Error in Log_event::read_log_event\\\(\\\): 'Sanity check failed', data_len: 258, event_type: 49"); + --error 1220 SHOW BINLOG EVENTS FROM 365; diff --git a/mysql-test/t/order_by.test b/mysql-test/t/order_by.test index 1064320b65c..e310d960c97 100644 --- a/mysql-test/t/order_by.test +++ b/mysql-test/t/order_by.test @@ -846,8 +846,7 @@ set session max_sort_length= 2180; --error 1038 select * from t1 order by b; drop table t1; - - +call mtr.add_suppression("Out of sort memory; increase server sort buffer size"); --echo # --echo # Bug #39844: Query Crash Mysql Server 5.0.67 --echo # diff --git a/mysql-test/t/show_check.test b/mysql-test/t/show_check.test index d46261f38d2..e5ca35bda32 100644 --- a/mysql-test/t/show_check.test +++ b/mysql-test/t/show_check.test @@ -1064,6 +1064,7 @@ set names latin1; # --error ER_NO_SUCH_TABLE,ER_FILE_NOT_FOUND show columns from `#mysql50#????????`; +call mtr.add_suppression("Can.t find file: '.\\\\test\\\\\\?{8}.frm'"); # # SHOW CREATE TRIGGER test. diff --git a/mysql-test/t/sp-destruct.test b/mysql-test/t/sp-destruct.test index 720c24b2c24..b006a36b8fd 100644 --- a/mysql-test/t/sp-destruct.test +++ b/mysql-test/t/sp-destruct.test @@ -14,6 +14,7 @@ # Supress warnings written to the log file call mtr.add_suppression("Column count of mysql.proc is wrong. Expected 20, found 19. The table is probably corrupted"); +call mtr.add_suppression("Stored routine .test...bug14233_[123].: invalid value in column mysql.proc"); # Backup proc table let $MYSQLD_DATADIR= `select @@datadir`; From b8faa8f2c69a13c83d763f8d8605dcf3612c1257 Mon Sep 17 00:00:00 2001 From: Magne Mahre Date: Wed, 30 Mar 2011 16:14:13 +0200 Subject: [PATCH 42/91] Fix-up after commit of Bug#11900714 The patch fixes a build problem on MacOSX, where the compiler complains about unused parameters. --- mysys/my_net.c | 6 ++++-- 1 file changed, 4 insertions(+), 2 deletions(-) diff --git a/mysys/my_net.c b/mysys/my_net.c index 3d139bb46c3..e2cc0679134 100644 --- a/mysys/my_net.c +++ b/mysys/my_net.c @@ -112,8 +112,10 @@ extern pthread_mutex_t LOCK_gethostbyname_r; */ struct hostent *my_gethostbyname_r(const char *name, - struct hostent *result, char *buffer, - int buflen, int *h_errnop) + struct hostent *result __attribute__((unused)), + char *buffer __attribute__((unused)), + int buflen __attribute__((unused)), + int *h_errnop) { struct hostent *hp; pthread_mutex_lock(&LOCK_gethostbyname_r); From 997eb49e49077fe3f65cfdf488f1f8807ba4b311 Mon Sep 17 00:00:00 2001 From: Bjorn Munch Date: Thu, 31 Mar 2011 10:33:07 +0200 Subject: [PATCH 43/91] Small followup fix after MTR warning cleanup --- mysql-test/extra/rpl_tests/rpl_extra_col_master.test | 3 +++ .../suite/rpl/r/rpl_extra_col_master_innodb.result | 12 ------------ .../suite/rpl/r/rpl_extra_col_master_myisam.result | 12 ------------ 3 files changed, 3 insertions(+), 24 deletions(-) diff --git a/mysql-test/extra/rpl_tests/rpl_extra_col_master.test b/mysql-test/extra/rpl_tests/rpl_extra_col_master.test index 9bab1192d97..981adcf6d54 100644 --- a/mysql-test/extra/rpl_tests/rpl_extra_col_master.test +++ b/mysql-test/extra/rpl_tests/rpl_extra_col_master.test @@ -122,10 +122,13 @@ SELECT f1,f2,f3,f4,f5,f6,f7,f8,f9, #connection slave; +--disable_query_log call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column 2 type mismatch.* 1535"); call mtr.add_suppression("Slave.*Can.t DROP .c7.; check that column.key exists.* Error_code: 1091"); call mtr.add_suppression("Slave.*Unknown column .c7. in .t15.* Error_code: 1054"); call mtr.add_suppression("Slave.*Key column .c6. doesn.t exist in table.* Error_code: 1072"); +call mtr.add_suppression("Slave I/O: Get master clock failed with error:.* Error_code: 2013"); +--enable_query_log sync_slave_with_master; --echo diff --git a/mysql-test/suite/rpl/r/rpl_extra_col_master_innodb.result b/mysql-test/suite/rpl/r/rpl_extra_col_master_innodb.result index 160f970fd5e..affb179d50e 100644 --- a/mysql-test/suite/rpl/r/rpl_extra_col_master_innodb.result +++ b/mysql-test/suite/rpl/r/rpl_extra_col_master_innodb.result @@ -58,10 +58,6 @@ f1 f2 f3 f4 f5 f6 f7 f8 f9 hex(f10) hex(f11) 27 27 27 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 29 29 29 second 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 30 30 30 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 -call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column 2 type mismatch.* 1535"); -call mtr.add_suppression("Slave.*Can.t DROP .c7.; check that column.key exists.* Error_code: 1091"); -call mtr.add_suppression("Slave.*Unknown column .c7. in .t15.* Error_code: 1054"); -call mtr.add_suppression("Slave.*Key column .c6. doesn.t exist in table.* Error_code: 1072"); * Select count and 20 rows from Slave * @@ -933,10 +929,6 @@ f1 f2 f3 f4 f5 f6 f7 f8 f9 hex(f10) hex(f11) 27 27 27 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 29 29 29 second 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 30 30 30 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 -call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column 2 type mismatch.* 1535"); -call mtr.add_suppression("Slave.*Can.t DROP .c7.; check that column.key exists.* Error_code: 1091"); -call mtr.add_suppression("Slave.*Unknown column .c7. in .t15.* Error_code: 1054"); -call mtr.add_suppression("Slave.*Key column .c6. doesn.t exist in table.* Error_code: 1072"); * Select count and 20 rows from Slave * @@ -1808,10 +1800,6 @@ f1 f2 f3 f4 f5 f6 f7 f8 f9 hex(f10) hex(f11) 27 27 27 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 29 29 29 second 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 30 30 30 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 -call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column 2 type mismatch.* 1535"); -call mtr.add_suppression("Slave.*Can.t DROP .c7.; check that column.key exists.* Error_code: 1091"); -call mtr.add_suppression("Slave.*Unknown column .c7. in .t15.* Error_code: 1054"); -call mtr.add_suppression("Slave.*Key column .c6. doesn.t exist in table.* Error_code: 1072"); * Select count and 20 rows from Slave * diff --git a/mysql-test/suite/rpl/r/rpl_extra_col_master_myisam.result b/mysql-test/suite/rpl/r/rpl_extra_col_master_myisam.result index 11356dd8620..8aeb5bdc1c9 100644 --- a/mysql-test/suite/rpl/r/rpl_extra_col_master_myisam.result +++ b/mysql-test/suite/rpl/r/rpl_extra_col_master_myisam.result @@ -58,10 +58,6 @@ f1 f2 f3 f4 f5 f6 f7 f8 f9 hex(f10) hex(f11) 27 27 27 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 29 29 29 second 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 30 30 30 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 -call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column 2 type mismatch.* 1535"); -call mtr.add_suppression("Slave.*Can.t DROP .c7.; check that column.key exists.* Error_code: 1091"); -call mtr.add_suppression("Slave.*Unknown column .c7. in .t15.* Error_code: 1054"); -call mtr.add_suppression("Slave.*Key column .c6. doesn.t exist in table.* Error_code: 1072"); * Select count and 20 rows from Slave * @@ -933,10 +929,6 @@ f1 f2 f3 f4 f5 f6 f7 f8 f9 hex(f10) hex(f11) 27 27 27 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 29 29 29 second 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 30 30 30 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 -call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column 2 type mismatch.* 1535"); -call mtr.add_suppression("Slave.*Can.t DROP .c7.; check that column.key exists.* Error_code: 1091"); -call mtr.add_suppression("Slave.*Unknown column .c7. in .t15.* Error_code: 1054"); -call mtr.add_suppression("Slave.*Key column .c6. doesn.t exist in table.* Error_code: 1072"); * Select count and 20 rows from Slave * @@ -1808,10 +1800,6 @@ f1 f2 f3 f4 f5 f6 f7 f8 f9 hex(f10) hex(f11) 27 27 27 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 29 29 29 second 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 30 30 30 next 2 kaks 2 got stolen from the paradise very fat blob 1555 123456 -call mtr.add_suppression("Slave SQL.*Table definition on master and slave does not match: Column 2 type mismatch.* 1535"); -call mtr.add_suppression("Slave.*Can.t DROP .c7.; check that column.key exists.* Error_code: 1091"); -call mtr.add_suppression("Slave.*Unknown column .c7. in .t15.* Error_code: 1054"); -call mtr.add_suppression("Slave.*Key column .c6. doesn.t exist in table.* Error_code: 1072"); * Select count and 20 rows from Slave * From fc7a12c05d179bf749a650b79c86574d095458b1 Mon Sep 17 00:00:00 2001 From: Bjorn Munch Date: Thu, 31 Mar 2011 15:48:05 +0200 Subject: [PATCH 44/91] One more test suppression for rpl_extra_col_master tests --- mysql-test/extra/rpl_tests/rpl_extra_col_master.test | 1 + 1 file changed, 1 insertion(+) diff --git a/mysql-test/extra/rpl_tests/rpl_extra_col_master.test b/mysql-test/extra/rpl_tests/rpl_extra_col_master.test index 981adcf6d54..1c103512318 100644 --- a/mysql-test/extra/rpl_tests/rpl_extra_col_master.test +++ b/mysql-test/extra/rpl_tests/rpl_extra_col_master.test @@ -128,6 +128,7 @@ call mtr.add_suppression("Slave.*Can.t DROP .c7.; check that column.key exists.* call mtr.add_suppression("Slave.*Unknown column .c7. in .t15.* Error_code: 1054"); call mtr.add_suppression("Slave.*Key column .c6. doesn.t exist in table.* Error_code: 1072"); call mtr.add_suppression("Slave I/O: Get master clock failed with error:.* Error_code: 2013"); +call mtr.add_suppression("Slave I/O: Get master SERVER_ID failed with error:.* Error_code: 2013"); --enable_query_log sync_slave_with_master; From 7aa81e2a02e78200eec105b968bda675af6f4987 Mon Sep 17 00:00:00 2001 From: Gleb Shchepa Date: Thu, 31 Mar 2011 22:59:11 +0400 Subject: [PATCH 45/91] Bug #11766094 - 59132: MIN() AND MAX() REMOVE UNSIGNEDNESS In the string context the MIN() and MAX() functions don't take into account the unsignedness of the UNSIGNED BIGINT argument column. I.e.: CREATE TABLE t1 (a BIGINT UNSIGNED); INSERT INTO t1 VALUES (18446668621106209655); SELECT CONCAT(MAX(a)) FROM t1; returns -75452603341961. mysql-test/r/func_group.result: Test case for bug #11766094. mysql-test/t/func_group.test: Test case for bug #11766094. sql/item.cc: Bug #11766094 - 59132: MIN() AND MAX() REMOVE UNSIGNEDNESS The Item_cache_int::val_str() method has been modified to take into account the unsigned_flag value when converting data to string. --- mysql-test/r/func_group.result | 9 +++++++++ mysql-test/t/func_group.test | 10 ++++++++++ sql/item.cc | 2 +- 3 files changed, 20 insertions(+), 1 deletion(-) diff --git a/mysql-test/r/func_group.result b/mysql-test/r/func_group.result index 1a21fb5872f..69bce1c8bd8 100644 --- a/mysql-test/r/func_group.result +++ b/mysql-test/r/func_group.result @@ -1737,4 +1737,13 @@ SELECT MIN(GET_LOCK('aaaaaaaaaaaaaaaaa',0) / '0b11111111111111111111111111111111 SELECT MIN(GET_LOCK('aaaaaaaaaaaaaaaaa',0) / '0b1111111111111111111111111111111111111111111111111111111111111111111111111' ^ (RAND())); SELECT RELEASE_LOCK('aaaaaaaaaaaaaaaaa'); # +# Bug #11766094 - 59132: MIN() AND MAX() REMOVE UNSIGNEDNESS +# +CREATE TABLE t1 (a BIGINT UNSIGNED); +INSERT INTO t1 VALUES (18446668621106209655); +SELECT MAX(LENGTH(a)), LENGTH(MAX(a)), MIN(a), MAX(a), CONCAT(MIN(a)), CONCAT(MAX(a)) FROM t1; +MAX(LENGTH(a)) LENGTH(MAX(a)) MIN(a) MAX(a) CONCAT(MIN(a)) CONCAT(MAX(a)) +20 20 18446668621106209655 18446668621106209655 18446668621106209655 18446668621106209655 +DROP TABLE t1; +# End of 5.1 tests diff --git a/mysql-test/t/func_group.test b/mysql-test/t/func_group.test index 8839a28b9dd..600b46fcde6 100644 --- a/mysql-test/t/func_group.test +++ b/mysql-test/t/func_group.test @@ -1117,6 +1117,16 @@ SELECT RELEASE_LOCK('aaaaaaaaaaaaaaaaa'); --enable_result_log + +--echo # +--echo # Bug #11766094 - 59132: MIN() AND MAX() REMOVE UNSIGNEDNESS +--echo # + +CREATE TABLE t1 (a BIGINT UNSIGNED); +INSERT INTO t1 VALUES (18446668621106209655); +SELECT MAX(LENGTH(a)), LENGTH(MAX(a)), MIN(a), MAX(a), CONCAT(MIN(a)), CONCAT(MAX(a)) FROM t1; +DROP TABLE t1; + --echo # --echo End of 5.1 tests diff --git a/sql/item.cc b/sql/item.cc index f90cf562c0b..24c3107ece9 100644 --- a/sql/item.cc +++ b/sql/item.cc @@ -7109,7 +7109,7 @@ String *Item_cache_int::val_str(String *str) DBUG_ASSERT(fixed == 1); if (!value_cached && !cache_value()) return NULL; - str->set(value, default_charset()); + str->set_int(value, unsigned_flag, default_charset()); return str; } From 5321b3a57a5191471cba0db85a11e21fb702200a Mon Sep 17 00:00:00 2001 From: Georgi Kodinov Date: Mon, 4 Apr 2011 16:04:15 +0300 Subject: [PATCH 46/91] Bug #11758687: 50924: object names not resolved correctly on lctn2 systems There was a local variable in get_all_tables() to store the "original" value of the database name as it can get lowercased depending on the lower_case_table_name value. get_all_tables() iterates over database names and for each database iterates over the tables in it. The "original" db name was assigned in the table names loop. Thus the first table is ok, but the second and subsequent tables get the lowercased name from processing the first table. Fixed by moving the assignment of the original database name from the inner (table name) to the outer (database name) loop. Test suite added. --- mysql-test/r/lowercase_table2.result | 30 ++++++++++++++++++++++ mysql-test/t/lowercase_table2.test | 37 ++++++++++++++++++++++++++++ mysys/my_net.c | 11 +++++---- sql/sql_show.cc | 12 +++++---- 4 files changed, 80 insertions(+), 10 deletions(-) diff --git a/mysql-test/r/lowercase_table2.result b/mysql-test/r/lowercase_table2.result index c9a46b70fab..ee555a9006c 100644 --- a/mysql-test/r/lowercase_table2.result +++ b/mysql-test/r/lowercase_table2.result @@ -175,3 +175,33 @@ TABLE_SCHEMA TABLE_NAME mysqltest_lc2 myUC use test; drop database mysqltest_LC2; +# +# Bug #11758687: 50924: object names not resolved correctly +# on lctn2 systems +# +CREATE DATABASE BUP_XPFM_COMPAT_DB2; +CREATE TABLE BUP_XPFM_COMPAT_DB2.TABLE2 (c13 INT) DEFAULT CHARSET latin1; +CREATE TABLE BUP_XPFM_COMPAT_DB2.table1 (c13 INT) DEFAULT CHARSET latin1; +CREATE TABLE bup_xpfm_compat_db2.table3 (c13 INT) DEFAULT CHARSET latin1; +CREATE TRIGGER BUP_XPFM_COMPAT_DB2.trigger1 AFTER INSERT +ON BUP_XPFM_COMPAT_DB2.table1 FOR EACH ROW +update BUP_XPFM_COMPAT_DB2.table1 set c13=12; +| +CREATE TRIGGER BUP_XPFM_COMPAT_DB2.TRIGGER2 AFTER INSERT +ON BUP_XPFM_COMPAT_DB2.TABLE2 FOR EACH ROW +update BUP_XPFM_COMPAT_DB2.table1 set c13=12; +| +CREATE TRIGGER BUP_XPFM_COMPAT_DB2.TrigGer3 AFTER INSERT +ON BUP_XPFM_COMPAT_DB2.TaBle3 FOR EACH ROW +update BUP_XPFM_COMPAT_DB2.table1 set c13=12; +| +SELECT trigger_schema, trigger_name, event_object_table FROM +INFORMATION_SCHEMA.TRIGGERS +WHERE trigger_schema COLLATE utf8_bin = 'BUP_XPFM_COMPAT_DB2' + ORDER BY trigger_schema, trigger_name; +trigger_schema trigger_name event_object_table +BUP_XPFM_COMPAT_DB2 trigger1 table1 +BUP_XPFM_COMPAT_DB2 TRIGGER2 TABLE2 +BUP_XPFM_COMPAT_DB2 TrigGer3 table3 +DROP DATABASE BUP_XPFM_COMPAT_DB2; +End of 5.1 tests diff --git a/mysql-test/t/lowercase_table2.test b/mysql-test/t/lowercase_table2.test index 521df01cc9b..b595d4b1775 100644 --- a/mysql-test/t/lowercase_table2.test +++ b/mysql-test/t/lowercase_table2.test @@ -150,3 +150,40 @@ select TABLE_SCHEMA,TABLE_NAME FROM information_schema.TABLES where TABLE_SCHEMA ='mysqltest_LC2'; use test; drop database mysqltest_LC2; + + +--echo # +--echo # Bug #11758687: 50924: object names not resolved correctly +--echo # on lctn2 systems +--echo # + +CREATE DATABASE BUP_XPFM_COMPAT_DB2; + +CREATE TABLE BUP_XPFM_COMPAT_DB2.TABLE2 (c13 INT) DEFAULT CHARSET latin1; +CREATE TABLE BUP_XPFM_COMPAT_DB2.table1 (c13 INT) DEFAULT CHARSET latin1; +CREATE TABLE bup_xpfm_compat_db2.table3 (c13 INT) DEFAULT CHARSET latin1; + +delimiter |; +# +CREATE TRIGGER BUP_XPFM_COMPAT_DB2.trigger1 AFTER INSERT + ON BUP_XPFM_COMPAT_DB2.table1 FOR EACH ROW + update BUP_XPFM_COMPAT_DB2.table1 set c13=12; +| +CREATE TRIGGER BUP_XPFM_COMPAT_DB2.TRIGGER2 AFTER INSERT + ON BUP_XPFM_COMPAT_DB2.TABLE2 FOR EACH ROW + update BUP_XPFM_COMPAT_DB2.table1 set c13=12; +| +CREATE TRIGGER BUP_XPFM_COMPAT_DB2.TrigGer3 AFTER INSERT + ON BUP_XPFM_COMPAT_DB2.TaBle3 FOR EACH ROW + update BUP_XPFM_COMPAT_DB2.table1 set c13=12; +| +delimiter ;| + +SELECT trigger_schema, trigger_name, event_object_table FROM +INFORMATION_SCHEMA.TRIGGERS + WHERE trigger_schema COLLATE utf8_bin = 'BUP_XPFM_COMPAT_DB2' + ORDER BY trigger_schema, trigger_name; + +DROP DATABASE BUP_XPFM_COMPAT_DB2; + +--echo End of 5.1 tests diff --git a/mysys/my_net.c b/mysys/my_net.c index e2cc0679134..820abf32386 100644 --- a/mysys/my_net.c +++ b/mysys/my_net.c @@ -111,11 +111,12 @@ extern pthread_mutex_t LOCK_gethostbyname_r; is finished with the structure. */ -struct hostent *my_gethostbyname_r(const char *name, - struct hostent *result __attribute__((unused)), - char *buffer __attribute__((unused)), - int buflen __attribute__((unused)), - int *h_errnop) +struct hostent * +my_gethostbyname_r(const char *name, + struct hostent *result __attribute__((unused)), + char *buffer __attribute__((unused)), + int buflen __attribute__((unused)), + int *h_errnop) { struct hostent *hp; pthread_mutex_lock(&LOCK_gethostbyname_r); diff --git a/sql/sql_show.cc b/sql/sql_show.cc index 1524a8fb87f..5b835096042 100644 --- a/sql/sql_show.cc +++ b/sql/sql_show.cc @@ -3399,6 +3399,12 @@ int get_all_tables(THD *thd, TABLE_LIST *tables, COND *cond) it.rewind(); /* To get access to new elements in basis list */ while ((db_name= it++)) { + LEX_STRING orig_db_name; + + /* db_name can be changed in make_table_list() func */ + if (!thd->make_lex_string(&orig_db_name, db_name->str, + db_name->length, FALSE)) + goto err; #ifndef NO_EMBEDDED_ACCESS_CHECKS if (!(check_access(thd,SELECT_ACL, db_name->str, &thd->col_access, 0, 1, with_i_schema) || @@ -3461,17 +3467,13 @@ int get_all_tables(THD *thd, TABLE_LIST *tables, COND *cond) } int res; - LEX_STRING tmp_lex_string, orig_db_name; + LEX_STRING tmp_lex_string; /* Set the parent lex of 'sel' because it is needed by sel.init_query() which is called inside make_table_list. */ thd->no_warnings_for_error= 1; sel.parent_lex= lex; - /* db_name can be changed in make_table_list() func */ - if (!thd->make_lex_string(&orig_db_name, db_name->str, - db_name->length, FALSE)) - goto err; if (make_table_list(thd, &sel, db_name, table_name)) goto err; TABLE_LIST *show_table_list= sel.table_list.first; From 402217544e74e17236128156951371a86c873e90 Mon Sep 17 00:00:00 2001 From: Vasil Dimov Date: Tue, 5 Apr 2011 11:08:36 +0300 Subject: [PATCH 47/91] Add the testcase for Bug#59410 to 5.1/builtin Bug#59410 read uncommitted: unlock row could not find a 3 mode lock on the record This bug is present only in 5.6 but I am adding the test case to earlier versions to ensure it never appears in earlier versions too. --- .../suite/innodb/r/innodb_bug59410.result | 17 +++++++++++++ .../suite/innodb/t/innodb_bug59410.test | 24 +++++++++++++++++++ 2 files changed, 41 insertions(+) create mode 100644 mysql-test/suite/innodb/r/innodb_bug59410.result create mode 100644 mysql-test/suite/innodb/t/innodb_bug59410.test diff --git a/mysql-test/suite/innodb/r/innodb_bug59410.result b/mysql-test/suite/innodb/r/innodb_bug59410.result new file mode 100644 index 00000000000..494d601ba4f --- /dev/null +++ b/mysql-test/suite/innodb/r/innodb_bug59410.result @@ -0,0 +1,17 @@ +create table `bug59410_1`(`a` int)engine=innodb; +insert into `bug59410_1` values (1),(2),(3); +select 1 from `bug59410_1` where `a` <> any ( +select 1 from `bug59410_1` where `a` <> 1 for update) +for update; +1 +1 +1 +drop table bug59410_1; +create table bug59410_2(`a` char(1),`b` int)engine=innodb; +insert into bug59410_2 values('0',0); +set transaction isolation level read uncommitted; +start transaction; +set @a=(select b from bug59410_2 where +(select 1 from bug59410_2 where a group by @a=b) +group by @a:=b); +drop table bug59410_2; diff --git a/mysql-test/suite/innodb/t/innodb_bug59410.test b/mysql-test/suite/innodb/t/innodb_bug59410.test new file mode 100644 index 00000000000..30bb0642679 --- /dev/null +++ b/mysql-test/suite/innodb/t/innodb_bug59410.test @@ -0,0 +1,24 @@ +# +# Bug#59410 read uncommitted: unlock row could not find a 3 mode lock on the record +# +-- source include/have_innodb.inc + +# only interested that the following do not produce something like +# InnoDB: Error: unlock row could not find a 2 mode lock on the record +# in the error log + +create table `bug59410_1`(`a` int)engine=innodb; +insert into `bug59410_1` values (1),(2),(3); +select 1 from `bug59410_1` where `a` <> any ( +select 1 from `bug59410_1` where `a` <> 1 for update) +for update; +drop table bug59410_1; + +create table bug59410_2(`a` char(1),`b` int)engine=innodb; +insert into bug59410_2 values('0',0); +set transaction isolation level read uncommitted; +start transaction; +set @a=(select b from bug59410_2 where +(select 1 from bug59410_2 where a group by @a=b) +group by @a:=b); +drop table bug59410_2; From b93cc42623ba99237c1c625e19e34a1f4419e899 Mon Sep 17 00:00:00 2001 From: Vasil Dimov Date: Tue, 5 Apr 2011 11:20:20 +0300 Subject: [PATCH 48/91] Add the testcase for Bug#59410 to 5.1/InnoDB Plugin Bug#59410 read uncommitted: unlock row could not find a 3 mode lock on the record This bug is present only in 5.6 but I am adding the test case to earlier versions to ensure it never appears in earlier versions too. --- .../innodb_plugin/r/innodb_bug59410.result | 17 +++++++++++++ .../innodb_plugin/t/innodb_bug59410.test | 24 +++++++++++++++++++ 2 files changed, 41 insertions(+) create mode 100644 mysql-test/suite/innodb_plugin/r/innodb_bug59410.result create mode 100644 mysql-test/suite/innodb_plugin/t/innodb_bug59410.test diff --git a/mysql-test/suite/innodb_plugin/r/innodb_bug59410.result b/mysql-test/suite/innodb_plugin/r/innodb_bug59410.result new file mode 100644 index 00000000000..494d601ba4f --- /dev/null +++ b/mysql-test/suite/innodb_plugin/r/innodb_bug59410.result @@ -0,0 +1,17 @@ +create table `bug59410_1`(`a` int)engine=innodb; +insert into `bug59410_1` values (1),(2),(3); +select 1 from `bug59410_1` where `a` <> any ( +select 1 from `bug59410_1` where `a` <> 1 for update) +for update; +1 +1 +1 +drop table bug59410_1; +create table bug59410_2(`a` char(1),`b` int)engine=innodb; +insert into bug59410_2 values('0',0); +set transaction isolation level read uncommitted; +start transaction; +set @a=(select b from bug59410_2 where +(select 1 from bug59410_2 where a group by @a=b) +group by @a:=b); +drop table bug59410_2; diff --git a/mysql-test/suite/innodb_plugin/t/innodb_bug59410.test b/mysql-test/suite/innodb_plugin/t/innodb_bug59410.test new file mode 100644 index 00000000000..30bb0642679 --- /dev/null +++ b/mysql-test/suite/innodb_plugin/t/innodb_bug59410.test @@ -0,0 +1,24 @@ +# +# Bug#59410 read uncommitted: unlock row could not find a 3 mode lock on the record +# +-- source include/have_innodb.inc + +# only interested that the following do not produce something like +# InnoDB: Error: unlock row could not find a 2 mode lock on the record +# in the error log + +create table `bug59410_1`(`a` int)engine=innodb; +insert into `bug59410_1` values (1),(2),(3); +select 1 from `bug59410_1` where `a` <> any ( +select 1 from `bug59410_1` where `a` <> 1 for update) +for update; +drop table bug59410_1; + +create table bug59410_2(`a` char(1),`b` int)engine=innodb; +insert into bug59410_2 values('0',0); +set transaction isolation level read uncommitted; +start transaction; +set @a=(select b from bug59410_2 where +(select 1 from bug59410_2 where a group by @a=b) +group by @a:=b); +drop table bug59410_2; From acedd7a4a5542288b30969ff5a6f11566458e9d4 Mon Sep 17 00:00:00 2001 From: Vasil Dimov Date: Wed, 6 Apr 2011 14:38:24 +0300 Subject: [PATCH 49/91] Load the innodb plugin instead of builtin in innodb_plugin.innodb_bug59410 Spotted by: Marko --- mysql-test/suite/innodb_plugin/t/innodb_bug59410.test | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) diff --git a/mysql-test/suite/innodb_plugin/t/innodb_bug59410.test b/mysql-test/suite/innodb_plugin/t/innodb_bug59410.test index 30bb0642679..6eabe0a8403 100644 --- a/mysql-test/suite/innodb_plugin/t/innodb_bug59410.test +++ b/mysql-test/suite/innodb_plugin/t/innodb_bug59410.test @@ -1,7 +1,7 @@ # # Bug#59410 read uncommitted: unlock row could not find a 3 mode lock on the record # --- source include/have_innodb.inc +-- source include/have_innodb_plugin.inc # only interested that the following do not produce something like # InnoDB: Error: unlock row could not find a 2 mode lock on the record From 8028a1043c6a7662594d6d465f11e30a846df534 Mon Sep 17 00:00:00 2001 From: Georgi Kodinov Date: Thu, 7 Apr 2011 14:44:26 +0300 Subject: [PATCH 50/91] fixed a missing warning --- mysql-test/r/cast.result | 2 ++ 1 file changed, 2 insertions(+) diff --git a/mysql-test/r/cast.result b/mysql-test/r/cast.result index 974a6bee63f..44d57055e7f 100644 --- a/mysql-test/r/cast.result +++ b/mysql-test/r/cast.result @@ -455,6 +455,8 @@ DROP TABLE t1; # Bug #11765023: 57934: DOS POSSIBLE SINCE BINARY CASTING # DOESN'T ADHERE TO MAX_ALLOWED_PACKET SET @@GLOBAL.max_allowed_packet=2048; +Warnings: +Warning 1105 The value of 'max_allowed_packet' should be no less than the value of 'net_buffer_length' SELECT CONVERT('a', BINARY(2049)); CONVERT('a', BINARY(2049)) NULL From dc65d9217c36a0edc8fab0a4a09fbeda7a5c278d Mon Sep 17 00:00:00 2001 From: Guilhem Bichot Date: Thu, 7 Apr 2011 15:09:19 +0200 Subject: [PATCH 51/91] Fix for Bug#11765141 - "58072: LOAD DATA INFILE: LEAKS IO CACHE MEMORY WHEN ERROR OCCURS" mysql-test/t/loaddata.test: test for bug; without fix, running the test with --valgrind would show the leak and make the test fail. sql/sql_load.cc: * In READ_INFO class, 'need_end_io_cache' is true as long as init_io_cache() was called, so if it's true, we need to call end_io_cache(), to free memory allocated by init_io_cache(). No matter the value of 'error'. In the bug's scenario, 'error' was set to true in read_sep_field() because '1' (read from file) isn't suitable to load into a geometric column. Because of 'error', end_io_cache() was not called. Note: end_io_cache() calls my_b_flush_io_cache(), which will do nothing wrong given that the file is opened for reads only; see the init_io_cache() call which uses only those read-only types: (get_it_from_net) ? READ_NET : (is_fifo ? READ_FIFO : READ_CACHE). IF the cache were rather used to write to the file, my_b_flush_io_cache() may write to it, and it may be questionable to write to the file if 'error' is true. But here there's no problem. * Now that 'need_end_io_cache' is checked even if 'error' is true, it needs to be initialized in all cases. * Bonus: move some variables to the initialization list. --- mysql-test/r/loaddata.result | 9 +++++++++ mysql-test/t/loaddata.test | 15 +++++++++++++++ sql/sql_load.cc | 9 ++++----- 3 files changed, 28 insertions(+), 5 deletions(-) diff --git a/mysql-test/r/loaddata.result b/mysql-test/r/loaddata.result index 3a421b3ea3f..59a1b904744 100644 --- a/mysql-test/r/loaddata.result +++ b/mysql-test/r/loaddata.result @@ -539,4 +539,13 @@ CREATE TABLE t1(f1 INT); SELECT 0xE1BB30 INTO OUTFILE 't1.dat'; LOAD DATA INFILE 't1.dat' IGNORE INTO TABLE t1 CHARACTER SET utf8; DROP TABLE t1; +# +# Bug#11765141 - 58072: LOAD DATA INFILE: LEAKS IO CACHE MEMORY +# WHEN ERROR OCCURS +# +SELECT '1\n' INTO DUMPFILE 'MYSQLTEST_VARDIR/tmp/bug11735141.txt'; +create table t1(a point); +LOAD DATA INFILE 'MYSQLTEST_VARDIR/tmp/bug11735141.txt' INTO TABLE t1; +ERROR 22003: Cannot get geometry object from data you send to the GEOMETRY field +drop table t1; End of 5.1 tests diff --git a/mysql-test/t/loaddata.test b/mysql-test/t/loaddata.test index e0764b67ec0..3d0fdea05ed 100644 --- a/mysql-test/t/loaddata.test +++ b/mysql-test/t/loaddata.test @@ -625,4 +625,19 @@ DROP TABLE t1; let $MYSQLD_DATADIR= `select @@datadir`; remove_file $MYSQLD_DATADIR/test/t1.dat; +--echo # +--echo # Bug#11765141 - 58072: LOAD DATA INFILE: LEAKS IO CACHE MEMORY +--echo # WHEN ERROR OCCURS +--echo # + +--let $file=$MYSQLTEST_VARDIR/tmp/bug11735141.txt +--replace_result $MYSQLTEST_VARDIR MYSQLTEST_VARDIR +--eval SELECT '1\n' INTO DUMPFILE '$file' + +create table t1(a point); +--replace_result $MYSQLTEST_VARDIR MYSQLTEST_VARDIR +--error ER_CANT_CREATE_GEOMETRY_OBJECT +--eval LOAD DATA INFILE '$file' INTO TABLE t1 +drop table t1; + --echo End of 5.1 tests diff --git a/sql/sql_load.cc b/sql/sql_load.cc index 513cd62b510..b9b7bd74f6c 100644 --- a/sql/sql_load.cc +++ b/sql/sql_load.cc @@ -1075,9 +1075,10 @@ READ_INFO::READ_INFO(File file_par, uint tot_length, CHARSET_INFO *cs, String &field_term, String &line_start, String &line_term, String &enclosed_par, int escape, bool get_it_from_net, bool is_fifo) - :file(file_par),escape_char(escape) + :file(file_par), buff_length(tot_length), escape_char(escape), + found_end_of_line(false), eof(false), need_end_io_cache(false), + error(false), line_cuted(false), found_null(false), read_charset(cs) { - read_charset= cs; field_term_ptr=(char*) field_term.ptr(); field_term_length= field_term.length(); line_term_ptr=(char*) line_term.ptr(); @@ -1104,8 +1105,6 @@ READ_INFO::READ_INFO(File file_par, uint tot_length, CHARSET_INFO *cs, (uchar) enclosed_par[0] : INT_MAX; field_term_char= field_term_length ? (uchar) field_term_ptr[0] : INT_MAX; line_term_char= line_term_length ? (uchar) line_term_ptr[0] : INT_MAX; - error=eof=found_end_of_line=found_null=line_cuted=0; - buff_length=tot_length; /* Set of a stack for unget if long terminators */ @@ -1151,7 +1150,7 @@ READ_INFO::READ_INFO(File file_par, uint tot_length, CHARSET_INFO *cs, READ_INFO::~READ_INFO() { - if (!error && need_end_io_cache) + if (need_end_io_cache) ::end_io_cache(&cache); my_free(buffer, MYF(MY_ALLOW_ZERO_PTR)); From 0ff2a182b67ea433d9070628696e648dff170fdd Mon Sep 17 00:00:00 2001 From: =?UTF-8?q?Marko=20M=C3=A4kel=C3=A4?= Date: Thu, 7 Apr 2011 21:12:54 +0300 Subject: [PATCH 52/91] Bug #11766513 - 59641: Prepared XA transaction in system after hard crash causes future shutdown hang InnoDB would hang on shutdown if any XA transactions exist in the system in the PREPARED state. This has been masked by the fact that MySQL would roll back any PREPARED transaction on shutdown, in the spirit of Bug #12161 Xa recovery and client disconnection. [mysql-test-run] do_shutdown_server: Interpret --shutdown_server 0 as a request to kill the server immediately without initiating a shutdown procedure. xid_cache_insert(): Initialize XID_STATE::rm_error in order to avoid a bogus error message on XA ROLLBACK of a recovered PREPARED transaction. innobase_commit_by_xid(), innobase_rollback_by_xid(): Free the InnoDB transaction object after rolling back a PREPARED transaction. trx_get_trx_by_xid(): Only consider transactions whose trx->is_prepared flag is set. The MySQL layer seems to prevent attempts to roll back connected transactions that are in the PREPARED state from another connection, but it is better to play it safe. The is_prepared flag was introduced in the InnoDB Plugin. trx_n_prepared: A new counter, counting the number of InnoDB transactions in the PREPARED state. logs_empty_and_mark_files_at_shutdown(): On shutdown, allow trx_n_prepared transactions to exist in the system. trx_undo_free_prepared(), trx_free_prepared(): New functions, to free the memory objects of PREPARED transactions on shutdown. This is not needed in the built-in InnoDB, because it would collect all allocated memory on shutdown. The InnoDB Plugin needs this because of innodb_use_sys_malloc. trx_sys_close(): Invoke trx_free_prepared() on all remaining transactions. --- client/mysqltest.cc | 12 ++-- .../suite/innodb/r/innodb_bug59641.result | 57 +++++++++++++++ .../suite/innodb/t/innodb_bug59641.test | 66 +++++++++++++++++ .../innodb_plugin/r/innodb_bug59641.result | 57 +++++++++++++++ .../innodb_plugin/t/innodb_bug59641.test | 70 +++++++++++++++++++ sql/sql_class.cc | 1 + storage/innobase/handler/ha_innodb.cc | 6 +- storage/innobase/include/trx0trx.h | 5 ++ storage/innobase/log/log0log.c | 9 +-- storage/innobase/trx/trx0trx.c | 11 +++ storage/innodb_plugin/ChangeLog | 7 ++ storage/innodb_plugin/handler/ha_innodb.cc | 6 +- storage/innodb_plugin/include/trx0trx.h | 11 +++ storage/innodb_plugin/include/trx0undo.h | 9 +++ storage/innodb_plugin/log/log0log.c | 9 +-- storage/innodb_plugin/trx/trx0sys.c | 10 +++ storage/innodb_plugin/trx/trx0trx.c | 70 ++++++++++++++++++- storage/innodb_plugin/trx/trx0undo.c | 28 ++++++++ 18 files changed, 425 insertions(+), 19 deletions(-) create mode 100644 mysql-test/suite/innodb/r/innodb_bug59641.result create mode 100644 mysql-test/suite/innodb/t/innodb_bug59641.test create mode 100644 mysql-test/suite/innodb_plugin/r/innodb_bug59641.result create mode 100644 mysql-test/suite/innodb_plugin/t/innodb_bug59641.test diff --git a/client/mysqltest.cc b/client/mysqltest.cc index 52c76b8c68e..a1813838a24 100644 --- a/client/mysqltest.cc +++ b/client/mysqltest.cc @@ -4461,13 +4461,14 @@ static int my_kill(int pid, int sig) command called command DESCRIPTION - shutdown [] + shutdown_server [] */ void do_shutdown_server(struct st_command *command) { - int timeout=60, pid; + long timeout=60; + int pid; DYNAMIC_STRING ds_pidfile_name; MYSQL* mysql = &cur_con->mysql; static DYNAMIC_STRING ds_timeout; @@ -4482,8 +4483,9 @@ void do_shutdown_server(struct st_command *command) if (ds_timeout.length) { - timeout= atoi(ds_timeout.str); - if (timeout == 0) + char* endptr; + timeout= strtol(ds_timeout.str, &endptr, 10); + if (*endptr != '\0') die("Illegal argument for timeout: '%s'", ds_timeout.str); } dynstr_free(&ds_timeout); @@ -4525,7 +4527,7 @@ void do_shutdown_server(struct st_command *command) DBUG_PRINT("info", ("Process %d does not exist anymore", pid)); DBUG_VOID_RETURN; } - DBUG_PRINT("info", ("Sleeping, timeout: %d", timeout)); + DBUG_PRINT("info", ("Sleeping, timeout: %ld", timeout)); my_sleep(1000000L); } diff --git a/mysql-test/suite/innodb/r/innodb_bug59641.result b/mysql-test/suite/innodb/r/innodb_bug59641.result new file mode 100644 index 00000000000..361172aa82b --- /dev/null +++ b/mysql-test/suite/innodb/r/innodb_bug59641.result @@ -0,0 +1,57 @@ +CREATE TABLE t(a INT PRIMARY KEY, b INT)ENGINE=InnoDB; +INSERT INTO t VALUES(2,2),(4,4),(8,8),(16,16),(32,32); +COMMIT; +XA START '123'; +INSERT INTO t VALUES(1,1); +XA END '123'; +XA PREPARE '123'; +XA START '456'; +INSERT INTO t VALUES(3,47),(5,67); +UPDATE t SET b=2*b WHERE a BETWEEN 5 AND 8; +XA END '456'; +XA PREPARE '456'; +XA START '789'; +UPDATE t SET b=4*a WHERE a=32; +XA END '789'; +XA PREPARE '789'; +call mtr.add_suppression("Found 3 prepared XA transactions"); +SET TRANSACTION ISOLATION LEVEL READ UNCOMMITTED; +SELECT * FROM t; +a b +1 1 +2 2 +3 47 +4 4 +5 134 +8 16 +16 16 +32 128 +COMMIT; +SET TRANSACTION ISOLATION LEVEL READ UNCOMMITTED; +SELECT * FROM t; +a b +1 1 +2 2 +3 47 +4 4 +5 134 +8 16 +16 16 +32 128 +COMMIT; +XA RECOVER; +formatID gtrid_length bqual_length data +1 3 0 789 +1 3 0 456 +1 3 0 123 +XA ROLLBACK '123'; +XA ROLLBACK '456'; +XA COMMIT '789'; +SELECT * FROM t; +a b +2 2 +4 4 +8 8 +16 16 +32 128 +DROP TABLE t; diff --git a/mysql-test/suite/innodb/t/innodb_bug59641.test b/mysql-test/suite/innodb/t/innodb_bug59641.test new file mode 100644 index 00000000000..0237673061c --- /dev/null +++ b/mysql-test/suite/innodb/t/innodb_bug59641.test @@ -0,0 +1,66 @@ +# Bug #59641 Prepared XA transaction causes shutdown hang after a crash + +-- source include/not_embedded.inc +-- source include/have_innodb.inc + +CREATE TABLE t(a INT PRIMARY KEY, b INT)ENGINE=InnoDB; +INSERT INTO t VALUES(2,2),(4,4),(8,8),(16,16),(32,32); +COMMIT; +XA START '123'; +INSERT INTO t VALUES(1,1); +XA END '123'; +XA PREPARE '123'; + +CONNECT (con1,localhost,root,,); +CONNECTION con1; + +XA START '456'; +INSERT INTO t VALUES(3,47),(5,67); +UPDATE t SET b=2*b WHERE a BETWEEN 5 AND 8; +XA END '456'; +XA PREPARE '456'; + +CONNECT (con2,localhost,root,,); +CONNECTION con2; + +XA START '789'; +UPDATE t SET b=4*a WHERE a=32; +XA END '789'; +XA PREPARE '789'; + +# The server would issue this warning on restart. +call mtr.add_suppression("Found 3 prepared XA transactions"); + +# Kill the server without sending a shutdown command +-- exec echo "wait" > $MYSQLTEST_VARDIR/tmp/mysqld.1.expect +-- shutdown_server 0 +-- source include/wait_until_disconnected.inc + +# Restart the server. +-- exec echo "restart" > $MYSQLTEST_VARDIR/tmp/mysqld.1.expect +-- enable_reconnect +-- source include/wait_until_connected_again.inc +SET TRANSACTION ISOLATION LEVEL READ UNCOMMITTED; +SELECT * FROM t; +COMMIT; + +# Shut down the server. This would hang because of the bug. +-- exec echo "wait" > $MYSQLTEST_VARDIR/tmp/mysqld.1.expect +-- shutdown_server +-- source include/wait_until_disconnected.inc + +# Restart the server. +-- exec echo "restart" > $MYSQLTEST_VARDIR/tmp/mysqld.1.expect +-- enable_reconnect +-- source include/wait_until_connected_again.inc + +SET TRANSACTION ISOLATION LEVEL READ UNCOMMITTED; +SELECT * FROM t; +COMMIT; +XA RECOVER; +XA ROLLBACK '123'; +XA ROLLBACK '456'; +XA COMMIT '789'; +SELECT * FROM t; + +DROP TABLE t; diff --git a/mysql-test/suite/innodb_plugin/r/innodb_bug59641.result b/mysql-test/suite/innodb_plugin/r/innodb_bug59641.result new file mode 100644 index 00000000000..361172aa82b --- /dev/null +++ b/mysql-test/suite/innodb_plugin/r/innodb_bug59641.result @@ -0,0 +1,57 @@ +CREATE TABLE t(a INT PRIMARY KEY, b INT)ENGINE=InnoDB; +INSERT INTO t VALUES(2,2),(4,4),(8,8),(16,16),(32,32); +COMMIT; +XA START '123'; +INSERT INTO t VALUES(1,1); +XA END '123'; +XA PREPARE '123'; +XA START '456'; +INSERT INTO t VALUES(3,47),(5,67); +UPDATE t SET b=2*b WHERE a BETWEEN 5 AND 8; +XA END '456'; +XA PREPARE '456'; +XA START '789'; +UPDATE t SET b=4*a WHERE a=32; +XA END '789'; +XA PREPARE '789'; +call mtr.add_suppression("Found 3 prepared XA transactions"); +SET TRANSACTION ISOLATION LEVEL READ UNCOMMITTED; +SELECT * FROM t; +a b +1 1 +2 2 +3 47 +4 4 +5 134 +8 16 +16 16 +32 128 +COMMIT; +SET TRANSACTION ISOLATION LEVEL READ UNCOMMITTED; +SELECT * FROM t; +a b +1 1 +2 2 +3 47 +4 4 +5 134 +8 16 +16 16 +32 128 +COMMIT; +XA RECOVER; +formatID gtrid_length bqual_length data +1 3 0 789 +1 3 0 456 +1 3 0 123 +XA ROLLBACK '123'; +XA ROLLBACK '456'; +XA COMMIT '789'; +SELECT * FROM t; +a b +2 2 +4 4 +8 8 +16 16 +32 128 +DROP TABLE t; diff --git a/mysql-test/suite/innodb_plugin/t/innodb_bug59641.test b/mysql-test/suite/innodb_plugin/t/innodb_bug59641.test new file mode 100644 index 00000000000..0fb24e47a54 --- /dev/null +++ b/mysql-test/suite/innodb_plugin/t/innodb_bug59641.test @@ -0,0 +1,70 @@ +# Bug #59641 Prepared XA transaction causes shutdown hang after a crash + +-- source include/not_embedded.inc +-- source include/have_innodb_plugin.inc + +let $innodb_file_format_check_orig=`select @@innodb_file_format_check`; + +CREATE TABLE t(a INT PRIMARY KEY, b INT)ENGINE=InnoDB; +INSERT INTO t VALUES(2,2),(4,4),(8,8),(16,16),(32,32); +COMMIT; +XA START '123'; +INSERT INTO t VALUES(1,1); +XA END '123'; +XA PREPARE '123'; + +CONNECT (con1,localhost,root,,); +CONNECTION con1; + +XA START '456'; +INSERT INTO t VALUES(3,47),(5,67); +UPDATE t SET b=2*b WHERE a BETWEEN 5 AND 8; +XA END '456'; +XA PREPARE '456'; + +CONNECT (con2,localhost,root,,); +CONNECTION con2; + +XA START '789'; +UPDATE t SET b=4*a WHERE a=32; +XA END '789'; +XA PREPARE '789'; + +# The server would issue this warning on restart. +call mtr.add_suppression("Found 3 prepared XA transactions"); + +# Kill the server without sending a shutdown command +-- exec echo "wait" > $MYSQLTEST_VARDIR/tmp/mysqld.1.expect +-- shutdown_server 0 +-- source include/wait_until_disconnected.inc + +# Restart the server. +-- exec echo "restart" > $MYSQLTEST_VARDIR/tmp/mysqld.1.expect +-- enable_reconnect +-- source include/wait_until_connected_again.inc +SET TRANSACTION ISOLATION LEVEL READ UNCOMMITTED; +SELECT * FROM t; +COMMIT; + +# Shut down the server. This would hang because of the bug. +-- exec echo "wait" > $MYSQLTEST_VARDIR/tmp/mysqld.1.expect +-- shutdown_server +-- source include/wait_until_disconnected.inc + +# Restart the server. +-- exec echo "restart" > $MYSQLTEST_VARDIR/tmp/mysqld.1.expect +-- enable_reconnect +-- source include/wait_until_connected_again.inc + +SET TRANSACTION ISOLATION LEVEL READ UNCOMMITTED; +SELECT * FROM t; +COMMIT; +XA RECOVER; +XA ROLLBACK '123'; +XA ROLLBACK '456'; +XA COMMIT '789'; +SELECT * FROM t; + +DROP TABLE t; +--disable_query_log +eval set global innodb_file_format_check=$innodb_file_format_check_orig; diff --git a/sql/sql_class.cc b/sql/sql_class.cc index a61ce7bfd14..ae21a5335fd 100644 --- a/sql/sql_class.cc +++ b/sql/sql_class.cc @@ -3383,6 +3383,7 @@ bool xid_cache_insert(XID *xid, enum xa_states xa_state) xs->xa_state=xa_state; xs->xid.set(xid); xs->in_thd=0; + xs->rm_error=0; res=my_hash_insert(&xid_cache, (uchar*)xs); } pthread_mutex_unlock(&LOCK_xid_cache); diff --git a/storage/innobase/handler/ha_innodb.cc b/storage/innobase/handler/ha_innodb.cc index 6f58fd70fbd..75c732c44d4 100644 --- a/storage/innobase/handler/ha_innodb.cc +++ b/storage/innobase/handler/ha_innodb.cc @@ -8565,7 +8565,7 @@ innobase_commit_by_xid( if (trx) { innobase_commit_low(trx); - + trx_free_for_background(trx); return(XA_OK); } else { return(XAER_NOTA); @@ -8588,7 +8588,9 @@ innobase_rollback_by_xid( trx = trx_get_trx_by_xid(xid); if (trx) { - return(innobase_rollback_trx(trx)); + int ret = innobase_rollback_trx(trx); + trx_free_for_background(trx); + return(ret); } else { return(XAER_NOTA); } diff --git a/storage/innobase/include/trx0trx.h b/storage/innobase/include/trx0trx.h index 4652f45892e..7cb16107746 100644 --- a/storage/innobase/include/trx0trx.h +++ b/storage/innobase/include/trx0trx.h @@ -19,7 +19,12 @@ Created 3/26/1996 Heikki Tuuri #include "dict0types.h" #include "trx0xa.h" +/* Number of transactions currently allocated for MySQL: protected by +the kernel mutex */ extern ulint trx_n_mysql_transactions; +/* Number of transactions currently in the XA PREPARED state: protected by +the kernel mutex */ +extern ulint trx_n_prepared; /************************************************************************ Releases the search latch if trx has reserved it. */ diff --git a/storage/innobase/log/log0log.c b/storage/innobase/log/log0log.c index 3300997112b..092e3bfe37f 100644 --- a/storage/innobase/log/log0log.c +++ b/storage/innobase/log/log0log.c @@ -3052,12 +3052,13 @@ loop: goto loop; } - /* Check that there are no longer transactions. We need this wait even - for the 'very fast' shutdown, because the InnoDB layer may have - committed or prepared transactions and we don't want to lose them. */ + /* Check that there are no longer transactions, except for + PREPARED ones. We need this wait even for the 'very fast' + shutdown, because the InnoDB layer may have committed or + prepared transactions and we don't want to lose them. */ if (trx_n_mysql_transactions > 0 - || UT_LIST_GET_LEN(trx_sys->trx_list) > 0) { + || UT_LIST_GET_LEN(trx_sys->trx_list) > trx_n_prepared) { mutex_exit(&kernel_mutex); diff --git a/storage/innobase/trx/trx0trx.c b/storage/innobase/trx/trx0trx.c index a82d7f452fc..d174f1e1b37 100644 --- a/storage/innobase/trx/trx0trx.c +++ b/storage/innobase/trx/trx0trx.c @@ -41,6 +41,9 @@ sess_t* trx_dummy_sess = NULL; /* Number of transactions currently allocated for MySQL: protected by the kernel mutex */ ulint trx_n_mysql_transactions = 0; +/* Number of transactions currently in the XA PREPARED state: protected by +the kernel mutex */ +ulint trx_n_prepared = 0; /***************************************************************** Starts the transaction if it is not yet started. */ @@ -480,6 +483,7 @@ trx_lists_init_at_db_start(void) if (srv_force_recovery == 0) { trx->conc_state = TRX_PREPARED; + trx_n_prepared++; } else { fprintf(stderr, "InnoDB: Since" @@ -558,6 +562,7 @@ trx_lists_init_at_db_start(void) trx->conc_state = TRX_PREPARED; + trx_n_prepared++; } else { fprintf(stderr, "InnoDB: Since" @@ -832,6 +837,11 @@ trx_commit_off_kernel( || trx->conc_state == TRX_PREPARED); ut_ad(mutex_own(&kernel_mutex)); + if (UNIV_UNLIKELY(trx->conc_state == TRX_PREPARED)) { + ut_a(trx_n_prepared > 0); + trx_n_prepared--; + } + /* The following assignment makes the transaction committed in memory and makes its changes to data visible to other transactions. NOTE that there is a small discrepancy from the strict formal @@ -1882,6 +1892,7 @@ trx_prepare_off_kernel( /*--------------------------------------*/ trx->conc_state = TRX_PREPARED; + trx_n_prepared++; /*--------------------------------------*/ if (must_flush_log) { diff --git a/storage/innodb_plugin/ChangeLog b/storage/innodb_plugin/ChangeLog index 100cf3690ce..d062fc7e648 100644 --- a/storage/innodb_plugin/ChangeLog +++ b/storage/innodb_plugin/ChangeLog @@ -1,3 +1,10 @@ +2011-04-07 The InnoDB Team + + * handler/ha_innodb.cc, include/trx0trx.h, include/trx0undo.h, + log/log0log.c, trx/trx0sys.c, trx/trx0trx.c, trx/trx0undo.c: + Fix Bug #59641 Prepared XA transaction in system after hard crash + causes future shutdown hang + 2011-03-30 The InnoDB Team * srv/srv0srv.c, sync/sync0arr.h, sync/sync0arr.c: diff --git a/storage/innodb_plugin/handler/ha_innodb.cc b/storage/innodb_plugin/handler/ha_innodb.cc index dda2fbaa4d2..7f92d797d30 100644 --- a/storage/innodb_plugin/handler/ha_innodb.cc +++ b/storage/innodb_plugin/handler/ha_innodb.cc @@ -9998,7 +9998,7 @@ innobase_commit_by_xid( if (trx) { innobase_commit_low(trx); - + trx_free_for_background(trx); return(XA_OK); } else { return(XAER_NOTA); @@ -10024,7 +10024,9 @@ innobase_rollback_by_xid( trx = trx_get_trx_by_xid(xid); if (trx) { - return(innobase_rollback_trx(trx)); + int ret = innobase_rollback_trx(trx); + trx_free_for_background(trx); + return(ret); } else { return(XAER_NOTA); } diff --git a/storage/innodb_plugin/include/trx0trx.h b/storage/innodb_plugin/include/trx0trx.h index 833bae4a4ff..4bf3e75a5ee 100644 --- a/storage/innodb_plugin/include/trx0trx.h +++ b/storage/innodb_plugin/include/trx0trx.h @@ -44,6 +44,9 @@ extern sess_t* trx_dummy_sess; /** Number of transactions currently allocated for MySQL: protected by the kernel mutex */ extern ulint trx_n_mysql_transactions; +/** Number of transactions currently in the XA PREPARED state: protected by +the kernel mutex */ +extern ulint trx_n_prepared; /********************************************************************//** Releases the search latch if trx has reserved it. */ @@ -108,6 +111,14 @@ trx_free( /*=====*/ trx_t* trx); /*!< in, own: trx object */ /********************************************************************//** +At shutdown, frees a transaction object that is in the PREPARED state. */ +UNIV_INTERN +void +trx_free_prepared( +/*==============*/ + trx_t* trx) /*!< in, own: trx object */ + __attribute__((nonnull)); +/********************************************************************//** Frees a transaction object for MySQL. */ UNIV_INTERN void diff --git a/storage/innodb_plugin/include/trx0undo.h b/storage/innodb_plugin/include/trx0undo.h index a084f2394b5..4f15cd85833 100644 --- a/storage/innodb_plugin/include/trx0undo.h +++ b/storage/innodb_plugin/include/trx0undo.h @@ -298,6 +298,15 @@ void trx_undo_insert_cleanup( /*====================*/ trx_t* trx); /*!< in: transaction handle */ + +/********************************************************************//** +At shutdown, frees the undo logs of a PREPARED transaction. */ +UNIV_INTERN +void +trx_undo_free_prepared( +/*===================*/ + trx_t* trx) /*!< in/out: PREPARED transaction */ + __attribute__((nonnull)); #endif /* !UNIV_HOTBACKUP */ /***********************************************************//** Parses the redo log entry of an undo log page initialization. diff --git a/storage/innodb_plugin/log/log0log.c b/storage/innodb_plugin/log/log0log.c index 183c24d2147..4bb9abdc1a4 100644 --- a/storage/innodb_plugin/log/log0log.c +++ b/storage/innodb_plugin/log/log0log.c @@ -3085,12 +3085,13 @@ loop: goto loop; } - /* Check that there are no longer transactions. We need this wait even - for the 'very fast' shutdown, because the InnoDB layer may have - committed or prepared transactions and we don't want to lose them. */ + /* Check that there are no longer transactions, except for + PREPARED ones. We need this wait even for the 'very fast' + shutdown, because the InnoDB layer may have committed or + prepared transactions and we don't want to lose them. */ if (trx_n_mysql_transactions > 0 - || UT_LIST_GET_LEN(trx_sys->trx_list) > 0) { + || UT_LIST_GET_LEN(trx_sys->trx_list) > trx_n_prepared) { mutex_exit(&kernel_mutex); diff --git a/storage/innodb_plugin/trx/trx0sys.c b/storage/innodb_plugin/trx/trx0sys.c index 6eb356947cc..352fa6af219 100644 --- a/storage/innodb_plugin/trx/trx0sys.c +++ b/storage/innodb_plugin/trx/trx0sys.c @@ -37,6 +37,7 @@ Created 3/26/1996 Heikki Tuuri #include "trx0rseg.h" #include "trx0undo.h" #include "srv0srv.h" +#include "srv0start.h" #include "trx0purge.h" #include "log0log.h" #include "os0file.h" @@ -1548,10 +1549,12 @@ void trx_sys_close(void) /*===============*/ { + trx_t* trx; trx_rseg_t* rseg; read_view_t* view; ut_ad(trx_sys != NULL); + ut_ad(srv_shutdown_state == SRV_SHUTDOWN_EXIT_THREADS); /* Check that all read views are closed except read view owned by a purge. */ @@ -1583,6 +1586,13 @@ trx_sys_close(void) mem_free(trx_doublewrite); trx_doublewrite = NULL; + /* Only prepared transactions may be left in the system. Free them. */ + ut_a(UT_LIST_GET_LEN(trx_sys->trx_list) == trx_n_prepared); + + while ((trx = UT_LIST_GET_FIRST(trx_sys->trx_list)) != NULL) { + trx_free_prepared(trx); + } + /* There can't be any active transactions. */ rseg = UT_LIST_GET_FIRST(trx_sys->rseg_list); diff --git a/storage/innodb_plugin/trx/trx0trx.c b/storage/innodb_plugin/trx/trx0trx.c index f0bbf220815..7f3a3fcb4bf 100644 --- a/storage/innodb_plugin/trx/trx0trx.c +++ b/storage/innodb_plugin/trx/trx0trx.c @@ -50,6 +50,9 @@ UNIV_INTERN sess_t* trx_dummy_sess = NULL; /** Number of transactions currently allocated for MySQL: protected by the kernel mutex */ UNIV_INTERN ulint trx_n_mysql_transactions = 0; +/* Number of transactions currently in the XA PREPARED state: protected by +the kernel mutex */ +UNIV_INTERN ulint trx_n_prepared = 0; /*************************************************************//** Set detailed error message for the transaction. */ @@ -333,6 +336,60 @@ trx_free( mem_free(trx); } +/********************************************************************//** +At shutdown, frees a transaction object that is in the PREPARED state. */ +UNIV_INTERN +void +trx_free_prepared( +/*==============*/ + trx_t* trx) /*!< in, own: trx object */ +{ + ut_ad(mutex_own(&kernel_mutex)); + ut_a(trx->conc_state == TRX_PREPARED); + ut_a(trx->magic_n == TRX_MAGIC_N); + + /* Prepared transactions are sort of active; they allow + ROLLBACK and COMMIT operations. Because the system does not + contain any other transactions than prepared transactions at + the shutdown stage and because a transaction cannot become + PREPARED while holding locks, it is safe to release the locks + held by PREPARED transactions here at shutdown.*/ + lock_release_off_kernel(trx); + + trx_undo_free_prepared(trx); + + mutex_free(&trx->undo_mutex); + + if (trx->undo_no_arr) { + trx_undo_arr_free(trx->undo_no_arr); + } + + ut_a(UT_LIST_GET_LEN(trx->signals) == 0); + ut_a(UT_LIST_GET_LEN(trx->reply_signals) == 0); + + ut_a(trx->wait_lock == NULL); + ut_a(UT_LIST_GET_LEN(trx->wait_thrs) == 0); + + ut_a(!trx->has_search_latch); + + ut_a(trx->dict_operation_lock_mode == 0); + + if (trx->lock_heap) { + mem_heap_free(trx->lock_heap); + } + + if (trx->global_read_view_heap) { + mem_heap_free(trx->global_read_view_heap); + } + + ut_a(ib_vector_is_empty(trx->autoinc_locks)); + ib_vector_free(trx->autoinc_locks); + + UT_LIST_REMOVE(trx_list, trx_sys->trx_list, trx); + + mem_free(trx); +} + /********************************************************************//** Frees a transaction object for MySQL. */ UNIV_INTERN @@ -463,6 +520,7 @@ trx_lists_init_at_db_start(void) if (srv_force_recovery == 0) { trx->conc_state = TRX_PREPARED; + trx_n_prepared++; } else { fprintf(stderr, "InnoDB: Since" @@ -541,6 +599,7 @@ trx_lists_init_at_db_start(void) trx->conc_state = TRX_PREPARED; + trx_n_prepared++; } else { fprintf(stderr, "InnoDB: Since" @@ -820,6 +879,11 @@ trx_commit_off_kernel( || trx->conc_state == TRX_PREPARED); ut_ad(mutex_own(&kernel_mutex)); + if (UNIV_UNLIKELY(trx->conc_state == TRX_PREPARED)) { + ut_a(trx_n_prepared > 0); + trx_n_prepared--; + } + /* The following assignment makes the transaction committed in memory and makes its changes to data visible to other transactions. NOTE that there is a small discrepancy from the strict formal @@ -1857,6 +1921,7 @@ trx_prepare_off_kernel( /*--------------------------------------*/ trx->conc_state = TRX_PREPARED; + trx_n_prepared++; /*--------------------------------------*/ if (lsn) { @@ -2031,10 +2096,11 @@ trx_get_trx_by_xid( while (trx) { /* Compare two X/Open XA transaction id's: their length should be the same and binary comparison - of gtrid_lenght+bqual_length bytes should be + of gtrid_length+bqual_length bytes should be the same */ - if (trx->conc_state == TRX_PREPARED + if (trx->is_recovered + && trx->conc_state == TRX_PREPARED && xid->gtrid_length == trx->xid.gtrid_length && xid->bqual_length == trx->xid.bqual_length && memcmp(xid->data, trx->xid.data, diff --git a/storage/innodb_plugin/trx/trx0undo.c b/storage/innodb_plugin/trx/trx0undo.c index 76e88948e41..68ff82f618c 100644 --- a/storage/innodb_plugin/trx/trx0undo.c +++ b/storage/innodb_plugin/trx/trx0undo.c @@ -36,6 +36,7 @@ Created 3/26/1996 Heikki Tuuri #include "trx0rseg.h" #include "trx0trx.h" #include "srv0srv.h" +#include "srv0start.h" #include "trx0rec.h" #include "trx0purge.h" @@ -1976,4 +1977,31 @@ trx_undo_insert_cleanup( mutex_exit(&(rseg->mutex)); } + +/********************************************************************//** +At shutdown, frees the undo logs of a PREPARED transaction. */ +UNIV_INTERN +void +trx_undo_free_prepared( +/*===================*/ + trx_t* trx) /*!< in/out: PREPARED transaction */ +{ + mutex_enter(&trx->rseg->mutex); + + ut_ad(srv_shutdown_state == SRV_SHUTDOWN_EXIT_THREADS); + + if (trx->update_undo) { + ut_a(trx->update_undo->state == TRX_UNDO_PREPARED); + UT_LIST_REMOVE(undo_list, trx->rseg->update_undo_list, + trx->update_undo); + trx_undo_mem_free(trx->update_undo); + } + if (trx->insert_undo) { + ut_a(trx->insert_undo->state == TRX_UNDO_PREPARED); + UT_LIST_REMOVE(undo_list, trx->rseg->insert_undo_list, + trx->insert_undo); + trx_undo_mem_free(trx->insert_undo); + } + mutex_exit(&trx->rseg->mutex); +} #endif /* !UNIV_HOTBACKUP */ From cb0e49c000b65db94cb40c6331572440b4bc4c3e Mon Sep 17 00:00:00 2001 From: Nirbhay Choubey Date: Fri, 8 Apr 2011 12:22:44 +0530 Subject: [PATCH 53/91] Bug#11765157 - 58090: mysqlslap drops schema specified in create_schema if auto-generate-sql also set. mysqlslap uses a schema to run its tests on and later drops it if auto-generate-sql is used. This can be a problem, if the schema is an already existing one. If create-schema is used with auto-generate-sql option, mysqlslap while performing the cleanup, drops the specified database. Fixed by introducing an option --no-drop, which, if used, will prevent the dropping of schema at the end of the test. client/client_priv.h: Bug#11765157 - 58090: mysqlslap drops schema specified in create_schema if auto-generate-sql also set. Added an option. client/mysqlslap.c: Bug#11765157 - 58090: mysqlslap drops schema specified in create_schema if auto-generate-sql also set. Introduced an option 'no-drop' to forbid the removal of schema even if 'create' or 'auto-generate-sql' options are used. mysql-test/r/mysqlslap.result: Added a testcase for Bug#11765157. mysql-test/t/mysqlslap.test: Added a testcase for Bug#11765157. --- client/client_priv.h | 1 + client/mysqlslap.c | 11 ++++++++--- mysql-test/r/mysqlslap.result | 20 ++++++++++++++++++++ mysql-test/t/mysqlslap.test | 15 +++++++++++++++ 4 files changed, 44 insertions(+), 3 deletions(-) diff --git a/client/client_priv.h b/client/client_priv.h index 689f7277c2e..92f495864bb 100644 --- a/client/client_priv.h +++ b/client/client_priv.h @@ -85,6 +85,7 @@ enum options_client OPT_SLAP_POST_SYSTEM, OPT_SLAP_COMMIT, OPT_SLAP_DETACH, + OPT_SLAP_NO_DROP, OPT_MYSQL_REPLACE_INTO, OPT_BASE64_OUTPUT_MODE, OPT_SERVER_ID, OPT_FIX_TABLE_NAMES, OPT_FIX_DB_NAMES, OPT_SSL_VERIFY_SERVER_CERT, OPT_DEBUG_INFO, OPT_DEBUG_CHECK, OPT_COLUMN_TYPES, OPT_ERROR_LOG_FILE, diff --git a/client/mysqlslap.c b/client/mysqlslap.c index 3b5c14dd74b..851407a108f 100644 --- a/client/mysqlslap.c +++ b/client/mysqlslap.c @@ -131,7 +131,7 @@ const char *delimiter= "\n"; const char *create_schema_string= "mysqlslap"; -static my_bool opt_preserve= TRUE; +static my_bool opt_preserve= TRUE, opt_no_drop= FALSE; static my_bool debug_info_flag= 0, debug_check_flag= 0; static my_bool opt_only_print= FALSE; static my_bool opt_compress= FALSE, tty_password= FALSE, @@ -599,6 +599,8 @@ static struct my_option my_long_options[] = REQUIRED_ARG, 0, 0, 0, 0, 0, 0}, {"iterations", 'i', "Number of times to run the tests.", &iterations, &iterations, 0, GET_UINT, REQUIRED_ARG, 1, 0, 0, 0, 0, 0}, + {"no-drop", OPT_SLAP_NO_DROP, "Do not drop the schema after the test.", + &opt_no_drop, &opt_no_drop, 0, GET_BOOL, NO_ARG, 0, 0, 0, 0, 0, 0}, {"number-char-cols", 'x', "Number of VARCHAR columns to create in table if specifying --auto-generate-sql.", &num_char_cols_opt, &num_char_cols_opt, 0, GET_STR, REQUIRED_ARG, @@ -1147,8 +1149,11 @@ get_options(int *argc,char ***argv) if (!user) user= (char *)"root"; - /* If something is created we clean it up, otherwise we leave schemas alone */ - if (create_string || auto_generate_sql) + /* + If something is created and --no-drop is not specified, we drop the + schema. + */ + if (!opt_no_drop && (create_string || auto_generate_sql)) opt_preserve= FALSE; if (auto_generate_sql && (create_string || user_supplied_query)) diff --git a/mysql-test/r/mysqlslap.result b/mysql-test/r/mysqlslap.result index 4cb01490407..a94d9156462 100644 --- a/mysql-test/r/mysqlslap.result +++ b/mysql-test/r/mysqlslap.result @@ -225,3 +225,23 @@ DROP SCHEMA IF EXISTS `mysqlslap`; DROP PROCEDURE IF EXISTS p1; CREATE PROCEDURE p1() SELECT 1; DROP PROCEDURE p1; +# +# Bug #11765157 - 58090: mysqlslap drops schema specified in +# create_schema if auto-generate-sql also set. +# +# 'bug58090' database should not be present. +SHOW DATABASES; +Database +information_schema +mtr +mysql +test +# 'bug58090' database should be present. +SHOW DATABASES; +Database +information_schema +bug58090 +mtr +mysql +test +DROP DATABASE bug58090; diff --git a/mysql-test/t/mysqlslap.test b/mysql-test/t/mysqlslap.test index 28042f62fe6..757d2813483 100644 --- a/mysql-test/t/mysqlslap.test +++ b/mysql-test/t/mysqlslap.test @@ -53,3 +53,18 @@ CREATE PROCEDURE p1() SELECT 1; --exec $MYSQL_SLAP --create-schema=test --delimiter=";" --query="CALL p1; SELECT 1;" --silent 2>&1 DROP PROCEDURE p1; + + +--echo # +--echo # Bug #11765157 - 58090: mysqlslap drops schema specified in +--echo # create_schema if auto-generate-sql also set. +--echo # + +--exec $MYSQL_SLAP --silent --create-schema=bug58090 --concurrency=5 --iterations=20 --auto-generate-sql +--echo # 'bug58090' database should not be present. +SHOW DATABASES; +--exec $MYSQL_SLAP --silent --create-schema=bug58090 --no-drop --auto-generate-sql +--echo # 'bug58090' database should be present. +SHOW DATABASES; +DROP DATABASE bug58090; + From a77bc59896ee3cd89a8f1d391a65722b443f1841 Mon Sep 17 00:00:00 2001 From: Gleb Shchepa Date: Fri, 8 Apr 2011 12:05:20 +0400 Subject: [PATCH 54/91] Bug #11829681 - 60295: ERROR 1356 ON VIEW THAT EXECUTES FINE AS A QUERY Select from a view with the underlying HAVING clause failed with a message: "1356: View '...' references invalid table(s) or column(s) or function(s) or definer/invoker of view lack rights to use them" The bug is a regression of the fix for bug 11750328 - 40825 (similar case, but the HAVING cause references an aliased field). In the old fix for bug 40825 the Item_field::name_length value has been used in place of the real length of Item_field::name. However, in some cases Item_field::name_length is not in sync with the actual name length (TODO: combine name and name_length into a solid String field). The Item_ref::print() method has been modified to calculate actual name length every time. mysql-test/r/view.result: Test case for bug #11829681 mysql-test/t/view.test: Test case for bug #11829681 sql/item.cc: Bug #11829681 - 60295: ERROR 1356 ON VIEW THAT EXECUTES FINE AS A QUERY The Item_ref::print() method has been modified to calculate actual name length every time. sql/item.h: Minor commentary. --- mysql-test/r/view.result | 9 +++++++++ mysql-test/t/view.test | 12 ++++++++++++ sql/item.cc | 2 +- sql/item.h | 4 ++++ 4 files changed, 26 insertions(+), 1 deletion(-) diff --git a/mysql-test/r/view.result b/mysql-test/r/view.result index 6b0a2103afa..2ca81f20cbb 100644 --- a/mysql-test/r/view.result +++ b/mysql-test/r/view.result @@ -3897,6 +3897,15 @@ DROP TABLE t1; # CREATE VIEW v1 AS SELECT 1 IN (1 LIKE 2,0) AS f; DROP VIEW v1; +# +# Bug 11829681 - 60295: ERROR 1356 ON VIEW THAT EXECUTES FINE AS A QUERY +# +CREATE TABLE t1 (a INT); +CREATE VIEW v1 AS SELECT s.* FROM t1 s, t1 b HAVING a; +SELECT * FROM v1; +a +DROP VIEW v1; +DROP TABLE t1; # ----------------------------------------------------------------- # -- End of 5.1 tests. # ----------------------------------------------------------------- diff --git a/mysql-test/t/view.test b/mysql-test/t/view.test index b1b3b5f2a83..1543924a7ad 100644 --- a/mysql-test/t/view.test +++ b/mysql-test/t/view.test @@ -3941,6 +3941,18 @@ DROP TABLE t1; CREATE VIEW v1 AS SELECT 1 IN (1 LIKE 2,0) AS f; DROP VIEW v1; +--echo # +--echo # Bug 11829681 - 60295: ERROR 1356 ON VIEW THAT EXECUTES FINE AS A QUERY +--echo # + +CREATE TABLE t1 (a INT); +CREATE VIEW v1 AS SELECT s.* FROM t1 s, t1 b HAVING a; + +SELECT * FROM v1; + +DROP VIEW v1; +DROP TABLE t1; + --echo # ----------------------------------------------------------------- --echo # -- End of 5.1 tests. --echo # ----------------------------------------------------------------- diff --git a/sql/item.cc b/sql/item.cc index 24c3107ece9..40be8b205bd 100644 --- a/sql/item.cc +++ b/sql/item.cc @@ -6121,7 +6121,7 @@ void Item_ref::print(String *str, enum_query_type query_type) { THD *thd= current_thd; append_identifier(thd, str, (*ref)->real_item()->name, - (*ref)->real_item()->name_length); + strlen((*ref)->real_item()->name)); } else (*ref)->print(str, query_type); diff --git a/sql/item.h b/sql/item.h index 8568e89542e..8d7ad3c41d3 100644 --- a/sql/item.h +++ b/sql/item.h @@ -515,6 +515,10 @@ public: */ Item *next; uint32 max_length; + /* + TODO: convert name and name_length fields into String to keep them in sync + (see bug #11829681/60295 etc). + */ uint name_length; /* Length of name */ int8 marker; uint8 decimals; From 97e435dd18ae49847abb7775428bd308a400c3c5 Mon Sep 17 00:00:00 2001 From: Alexander Nozdrin Date: Mon, 11 Apr 2011 13:45:41 +0400 Subject: [PATCH 55/91] Bump version. --- configure.in | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) diff --git a/configure.in b/configure.in index 523d36afaea..e07ae7e3191 100644 --- a/configure.in +++ b/configure.in @@ -7,7 +7,7 @@ AC_INIT(sql/mysqld.cc) AC_CANONICAL_SYSTEM # The Docs Makefile.am parses this line! # remember to also change ndb version below and update version.c in ndb -AM_INIT_AUTOMAKE(mysql, 5.0.93) +AM_INIT_AUTOMAKE(mysql, 5.0.94) AM_CONFIG_HEADER([include/config.h:config.h.in]) PROTOCOL_VERSION=10 From ab86b40c05bcde5d27bcf016c4d8626a4ca5cd2a Mon Sep 17 00:00:00 2001 From: Alexander Nozdrin Date: Mon, 11 Apr 2011 13:57:45 +0400 Subject: [PATCH 56/91] Bump NDB-version. --- configure.in | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) diff --git a/configure.in b/configure.in index e07ae7e3191..fdfb7eae871 100644 --- a/configure.in +++ b/configure.in @@ -23,7 +23,7 @@ NDB_SHARED_LIB_VERSION=$NDB_SHARED_LIB_MAJOR_VERSION:0:0 # ndb version NDB_VERSION_MAJOR=5 NDB_VERSION_MINOR=0 -NDB_VERSION_BUILD=93 +NDB_VERSION_BUILD=94 NDB_VERSION_STATUS="" # Set all version vars based on $VERSION. How do we do this more elegant ? From 12fbe05c6a31a7958a4a1cae748477027fffa51f Mon Sep 17 00:00:00 2001 From: =?UTF-8?q?Marko=20M=C3=A4kel=C3=A4?= Date: Mon, 11 Apr 2011 16:40:28 +0300 Subject: [PATCH 57/91] Bug #11760042 - 52409: Assertion failure: long semaphore wait In ha_innobase::create(), we check some things while holding an exclusive lock on the data dictionary. Defer the locking and the creation of transactions until after the checks have passed. The THDVAR could hang due to a mutex wait (see Bug #11750569 - 41163: deadlock in mysqld: LOCK_global_system_variables and LOCK_open), and we want to avoid waiting while holding InnoDB mutexes. innobase_index_name_is_reserved(): Replace the parameter trx_t with THD, so that the test can be performed before starting an InnoDB transaction. We only needed trx->mysql_thd. ha_innobase::create(): Create transaction and lock the data dictionary only after passing the basic tests. create_table_def(): Move the IS_MAGIC_TABLE_AND_USER_DENIED_ACCESS check to ha_innobase::create(). Assign to srv_lower_case_table_names while holding dict_sys->mutex. ha_innobase::delete_table(), ha_innobase::rename_table(), innobase_rename_table(): Assign srv_lower_case_table_names as late as possible. Here, the variable is not necessarily protected by dict_sys->mutex. ha_innobase::add_index(): Invoke innobase_index_name_is_reserved() and innobase_check_index_keys() before allocating anything. rb:618 approved by Jimmy Yang --- storage/innobase/handler/ha_innodb.cc | 93 ++++++++---------- storage/innodb_plugin/ChangeLog | 5 + storage/innodb_plugin/handler/ha_innodb.cc | 94 ++++++++----------- storage/innodb_plugin/handler/ha_innodb.h | 11 +-- .../innodb_plugin/handler/handler0alter.cc | 55 +++++------ 5 files changed, 114 insertions(+), 144 deletions(-) diff --git a/storage/innobase/handler/ha_innodb.cc b/storage/innobase/handler/ha_innodb.cc index 75c732c44d4..2afacf6d2a8 100644 --- a/storage/innobase/handler/ha_innodb.cc +++ b/storage/innobase/handler/ha_innodb.cc @@ -189,7 +189,7 @@ innobase_index_name_is_reserved( /*============================*/ /* out: true if index name matches a reserved name */ - const trx_t* trx, /* in: InnoDB transaction handle */ + THD* thd, /* in/out: MySQL connection */ const TABLE* form, /* in: information on table columns and indexes */ const char* norm_name); /* in: table name */ @@ -5285,10 +5285,6 @@ create_table_def( DBUG_PRINT("enter", ("table_name: %s", table_name)); ut_a(trx->mysql_thd != NULL); - if (IS_MAGIC_TABLE_AND_USER_DENIED_ACCESS(table_name, - (THD*) trx->mysql_thd)) { - DBUG_RETURN(HA_ERR_GENERIC); - } n_cols = form->s->fields; @@ -5397,6 +5393,8 @@ err_col: col_len); } + srv_lower_case_table_names = lower_case_table_names; + error = row_create_table_for_mysql(table, trx); innodb_check_for_record_too_big_error(flags & DICT_TF_COMPACT, error); @@ -5642,6 +5640,35 @@ ha_innobase::create( DBUG_RETURN(HA_ERR_TO_BIG_ROW); } + strcpy(name2, name); + + normalize_table_name(norm_name, name2); + + /* Create the table definition in InnoDB */ + + flags = form->s->row_type != ROW_TYPE_REDUNDANT ? DICT_TF_COMPACT : 0; + + /* Look for a primary key */ + + primary_key_no= (form->s->primary_key != MAX_KEY ? + (int) form->s->primary_key : + -1); + + /* Our function row_get_mysql_key_number_for_index assumes + the primary key is always number 0, if it exists */ + + DBUG_ASSERT(primary_key_no == -1 || primary_key_no == 0); + + /* Check for name conflicts (with reserved name) for + any user indices to be created. */ + if (innobase_index_name_is_reserved(thd, form, norm_name)) { + DBUG_RETURN(-1); + } + + if (IS_MAGIC_TABLE_AND_USER_DENIED_ACCESS(norm_name, thd)) { + DBUG_RETURN(HA_ERR_GENERIC); + } + /* Get the transaction associated with the current thd, or create one if not yet created */ @@ -5665,48 +5692,12 @@ ha_innobase::create( trx->check_unique_secondary = FALSE; } - if (lower_case_table_names) { - srv_lower_case_table_names = TRUE; - } else { - srv_lower_case_table_names = FALSE; - } - - strcpy(name2, name); - - normalize_table_name(norm_name, name2); - /* Latch the InnoDB data dictionary exclusively so that no deadlocks or lock waits can happen in it during a table create operation. Drop table etc. do this latching in row0mysql.c. */ row_mysql_lock_data_dictionary(trx); - /* Create the table definition in InnoDB */ - - flags = 0; - - if (form->s->row_type != ROW_TYPE_REDUNDANT) { - flags |= DICT_TF_COMPACT; - } - - /* Look for a primary key */ - - primary_key_no= (form->s->primary_key != MAX_KEY ? - (int) form->s->primary_key : - -1); - - /* Our function row_get_mysql_key_number_for_index assumes - the primary key is always number 0, if it exists */ - - DBUG_ASSERT(primary_key_no == -1 || primary_key_no == 0); - - /* Check for name conflicts (with reserved name) for - any user indices to be created. */ - if (innobase_index_name_is_reserved(trx, form, norm_name)) { - error = -1; - goto cleanup; - } - error = create_table_def(trx, form, norm_name, create_info->options & HA_LEX_CREATE_TMP_TABLE ? name2 : NULL, flags); @@ -5936,12 +5927,6 @@ ha_innobase::delete_table( trx_search_latch_release_if_reserved(parent_trx); - if (lower_case_table_names) { - srv_lower_case_table_names = TRUE; - } else { - srv_lower_case_table_names = FALSE; - } - trx = trx_allocate_for_mysql(); trx->mysql_thd = thd; @@ -5961,6 +5946,8 @@ ha_innobase::delete_table( /* Drop the table in InnoDB */ + srv_lower_case_table_names = lower_case_table_names; + error = row_drop_table_for_mysql(norm_name, trx, thd_sql_command(thd) == SQLCOM_DROP_DB); @@ -6089,12 +6076,6 @@ ha_innobase::rename_table( trx_search_latch_release_if_reserved(parent_trx); - if (lower_case_table_names) { - srv_lower_case_table_names = TRUE; - } else { - srv_lower_case_table_names = FALSE; - } - trx = trx_allocate_for_mysql(); trx->mysql_thd = thd; INNOBASE_COPY_STMT(thd, trx); @@ -6114,6 +6095,8 @@ ha_innobase::rename_table( /* Rename the table in InnoDB */ + srv_lower_case_table_names = lower_case_table_names; + error = row_rename_table_for_mysql(norm_from, norm_to, trx); /* Flush the log to reduce probability that the .frm files and @@ -8826,7 +8809,7 @@ innobase_index_name_is_reserved( /*============================*/ /* out: true if an index name matches the reserved name */ - const trx_t* trx, /* in: InnoDB transaction handle */ + THD* thd, /* in/out: MySQL connection */ const TABLE* form, /* in: information on table columns and indexes */ const char* norm_name) /* in: table name */ @@ -8840,7 +8823,7 @@ innobase_index_name_is_reserved( if (innobase_strcasecmp(key->name, innobase_index_reserve_name) == 0) { /* Push warning to mysql */ - push_warning_printf((THD*) trx->mysql_thd, + push_warning_printf(thd, MYSQL_ERROR::WARN_LEVEL_WARN, ER_CANT_CREATE_TABLE, "Cannot Create Index with name " diff --git a/storage/innodb_plugin/ChangeLog b/storage/innodb_plugin/ChangeLog index d062fc7e648..0b201816819 100644 --- a/storage/innodb_plugin/ChangeLog +++ b/storage/innodb_plugin/ChangeLog @@ -1,3 +1,8 @@ +2011-04-07 The InnoDB Team + + * handler/ha_innodb.cc, handler/ha_innodb.h, handler/handler0alter.cc: + Fix Bug #52409 Assertion failure: long semaphore wait + 2011-04-07 The InnoDB Team * handler/ha_innodb.cc, include/trx0trx.h, include/trx0undo.h, diff --git a/storage/innodb_plugin/handler/ha_innodb.cc b/storage/innodb_plugin/handler/ha_innodb.cc index 7f92d797d30..2b0dbf82b34 100644 --- a/storage/innodb_plugin/handler/ha_innodb.cc +++ b/storage/innodb_plugin/handler/ha_innodb.cc @@ -6023,10 +6023,6 @@ create_table_def( DBUG_PRINT("enter", ("table_name: %s", table_name)); ut_a(trx->mysql_thd != NULL); - if (IS_MAGIC_TABLE_AND_USER_DENIED_ACCESS(table_name, - (THD*) trx->mysql_thd)) { - DBUG_RETURN(HA_ERR_GENERIC); - } /* MySQL does the name length check. But we do additional check on the name length here */ @@ -6146,6 +6142,8 @@ err_col: col_len); } + srv_lower_case_table_names = lower_case_table_names; + error = row_create_table_for_mysql(table, trx); if (error == DB_DUPLICATE_KEY) { @@ -6562,42 +6560,17 @@ ha_innobase::create( DBUG_RETURN(HA_ERR_TO_BIG_ROW); } - /* Get the transaction associated with the current thd, or create one - if not yet created */ - - parent_trx = check_trx_exists(thd); - - /* In case MySQL calls this in the middle of a SELECT query, release - possible adaptive hash latch to avoid deadlocks of threads */ - - trx_search_latch_release_if_reserved(parent_trx); - - trx = innobase_trx_allocate(thd); - - if (lower_case_table_names) { - srv_lower_case_table_names = TRUE; - } else { - srv_lower_case_table_names = FALSE; - } - strcpy(name2, name); normalize_table_name(norm_name, name2); - /* Latch the InnoDB data dictionary exclusively so that no deadlocks - or lock waits can happen in it during a table create operation. - Drop table etc. do this latching in row0mysql.c. */ - - row_mysql_lock_data_dictionary(trx); - /* Create the table definition in InnoDB */ flags = 0; /* Validate create options if innodb_strict_mode is set. */ if (!create_options_are_valid(thd, form, create_info)) { - error = ER_ILLEGAL_HA_CREATE_OPTION; - goto cleanup; + DBUG_RETURN(ER_ILLEGAL_HA_CREATE_OPTION); } if (create_info->key_block_size) { @@ -6739,16 +6712,37 @@ ha_innobase::create( /* Check for name conflicts (with reserved name) for any user indices to be created. */ - if (innobase_index_name_is_reserved(trx, form->key_info, + if (innobase_index_name_is_reserved(thd, form->key_info, form->s->keys)) { - error = -1; - goto cleanup; + DBUG_RETURN(-1); + } + + if (IS_MAGIC_TABLE_AND_USER_DENIED_ACCESS(norm_name, thd)) { + DBUG_RETURN(HA_ERR_GENERIC); } if (create_info->options & HA_LEX_CREATE_TMP_TABLE) { flags |= DICT_TF2_TEMPORARY << DICT_TF2_SHIFT; } + /* Get the transaction associated with the current thd, or create one + if not yet created */ + + parent_trx = check_trx_exists(thd); + + /* In case MySQL calls this in the middle of a SELECT query, release + possible adaptive hash latch to avoid deadlocks of threads */ + + trx_search_latch_release_if_reserved(parent_trx); + + trx = innobase_trx_allocate(thd); + + /* Latch the InnoDB data dictionary exclusively so that no deadlocks + or lock waits can happen in it during a table create operation. + Drop table etc. do this latching in row0mysql.c. */ + + row_mysql_lock_data_dictionary(trx); + error = create_table_def(trx, form, norm_name, create_info->options & HA_LEX_CREATE_TMP_TABLE ? name2 : NULL, flags); @@ -6992,18 +6986,14 @@ ha_innobase::delete_table( trx = innobase_trx_allocate(thd); - if (lower_case_table_names) { - srv_lower_case_table_names = TRUE; - } else { - srv_lower_case_table_names = FALSE; - } - name_len = strlen(name); ut_a(name_len < 1000); /* Drop the table in InnoDB */ + srv_lower_case_table_names = lower_case_table_names; + error = row_drop_table_for_mysql(norm_name, trx, thd_sql_command(thd) == SQLCOM_DROP_DB); @@ -7119,12 +7109,6 @@ innobase_rename_table( char* norm_to; char* norm_from; - if (lower_case_table_names) { - srv_lower_case_table_names = TRUE; - } else { - srv_lower_case_table_names = FALSE; - } - // Magic number 64 arbitrary norm_to = (char*) my_malloc(strlen(to) + 64, MYF(0)); norm_from = (char*) my_malloc(strlen(from) + 64, MYF(0)); @@ -7139,6 +7123,8 @@ innobase_rename_table( row_mysql_lock_data_dictionary(trx); } + srv_lower_case_table_names = lower_case_table_names; + error = row_rename_table_for_mysql( norm_from, norm_to, trx, lock_and_commit); @@ -10700,19 +10686,19 @@ static int show_innodb_vars(THD *thd, SHOW_VAR *var, char *buff) return 0; } -/*********************************************************************** +/*********************************************************************//** This function checks each index name for a table against reserved -system default primary index name 'GEN_CLUST_INDEX'. If a name matches, -this function pushes an warning message to the client, and returns true. */ +system default primary index name 'GEN_CLUST_INDEX'. If a name +matches, this function pushes an warning message to the client, +and returns true. +@return true if the index name matches the reserved name */ extern "C" UNIV_INTERN bool innobase_index_name_is_reserved( /*============================*/ - /* out: true if an index name - matches the reserved name */ - const trx_t* trx, /* in: InnoDB transaction handle */ - const KEY* key_info, /* in: Indexes to be created */ - ulint num_of_keys) /* in: Number of indexes to + THD* thd, /*!< in/out: MySQL connection */ + const KEY* key_info, /*!< in: Indexes to be created */ + ulint num_of_keys) /*!< in: Number of indexes to be created. */ { const KEY* key; @@ -10724,7 +10710,7 @@ innobase_index_name_is_reserved( if (innobase_strcasecmp(key->name, innobase_index_reserve_name) == 0) { /* Push warning to mysql */ - push_warning_printf((THD*) trx->mysql_thd, + push_warning_printf(thd, MYSQL_ERROR::WARN_LEVEL_WARN, ER_WRONG_NAME_FOR_INDEX, "Cannot Create Index with name " diff --git a/storage/innodb_plugin/handler/ha_innodb.h b/storage/innodb_plugin/handler/ha_innodb.h index 7a8f29853de..f7a5456b1a7 100644 --- a/storage/innodb_plugin/handler/ha_innodb.h +++ b/storage/innodb_plugin/handler/ha_innodb.h @@ -317,15 +317,14 @@ innobase_trx_allocate( This function checks each index name for a table against reserved system default primary index name 'GEN_CLUST_INDEX'. If a name matches, this function pushes an warning message to the client, -and returns true. */ +and returns true. +@return true if the index name matches the reserved name */ extern "C" bool innobase_index_name_is_reserved( /*============================*/ - /* out: true if the index name - matches the reserved name */ - const trx_t* trx, /* in: InnoDB transaction handle */ - const KEY* key_info, /* in: Indexes to be created */ - ulint num_of_keys); /* in: Number of indexes to + THD* thd, /*!< in/out: MySQL connection */ + const KEY* key_info, /*!< in: Indexes to be created */ + ulint num_of_keys); /*!< in: Number of indexes to be created. */ diff --git a/storage/innodb_plugin/handler/handler0alter.cc b/storage/innodb_plugin/handler/handler0alter.cc index dc1317d5c5a..485e03737e3 100644 --- a/storage/innodb_plugin/handler/handler0alter.cc +++ b/storage/innodb_plugin/handler/handler0alter.cc @@ -649,11 +649,30 @@ ha_innobase::add_index( update_thd(); - heap = mem_heap_create(1024); - /* In case MySQL calls this in the middle of a SELECT query, release possible adaptive hash latch to avoid deadlocks of threads. */ trx_search_latch_release_if_reserved(prebuilt->trx); + + /* Check if the index name is reserved. */ + if (innobase_index_name_is_reserved(user_thd, key_info, num_of_keys)) { + DBUG_RETURN(-1); + } + + innodb_table = indexed_table + = dict_table_get(prebuilt->table->name, FALSE); + + if (UNIV_UNLIKELY(!innodb_table)) { + DBUG_RETURN(HA_ERR_NO_SUCH_TABLE); + } + + /* Check that index keys are sensible */ + error = innobase_check_index_keys(key_info, num_of_keys, innodb_table); + + if (UNIV_UNLIKELY(error)) { + DBUG_RETURN(error); + } + + heap = mem_heap_create(1024); trx_start_if_not_started(prebuilt->trx); /* Create a background transaction for the operations on @@ -661,32 +680,6 @@ ha_innobase::add_index( trx = innobase_trx_allocate(user_thd); trx_start_if_not_started(trx); - innodb_table = indexed_table - = dict_table_get(prebuilt->table->name, FALSE); - - if (UNIV_UNLIKELY(!innodb_table)) { - error = HA_ERR_NO_SUCH_TABLE; - goto err_exit; - } - - /* Check if the index name is reserved. */ - if (innobase_index_name_is_reserved(trx, key_info, num_of_keys)) { - error = -1; - } else { - /* Check that index keys are sensible */ - error = innobase_check_index_keys(key_info, num_of_keys, - innodb_table); - } - - if (UNIV_UNLIKELY(error)) { -err_exit: - mem_heap_free(heap); - trx_general_rollback_for_mysql(trx, NULL); - trx_free_for_mysql(trx); - trx_commit_for_mysql(prebuilt->trx); - DBUG_RETURN(error); - } - /* Create table containing all indexes to be built in this alter table add index so that they are in the correct order in the table. */ @@ -758,8 +751,12 @@ err_exit: ut_d(dict_table_check_for_dup_indexes(innodb_table, FALSE)); + mem_heap_free(heap); + trx_general_rollback_for_mysql(trx, NULL); row_mysql_unlock_data_dictionary(trx); - goto err_exit; + trx_free_for_mysql(trx); + trx_commit_for_mysql(prebuilt->trx); + DBUG_RETURN(error); } trx->table_id = indexed_table->id; From e108b3f69eb74490cd1ddf8b53b9b6afd0ad054b Mon Sep 17 00:00:00 2001 From: Sven Sandberg Date: Mon, 11 Apr 2011 16:01:46 +0200 Subject: [PATCH 58/91] corrected bug reference for experimental test --- mysql-test/collections/default.experimental | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) diff --git a/mysql-test/collections/default.experimental b/mysql-test/collections/default.experimental index 1e6ff625d39..703a8a18ef0 100644 --- a/mysql-test/collections/default.experimental +++ b/mysql-test/collections/default.experimental @@ -22,7 +22,7 @@ main.outfile_loaddata @solaris # joro : Bug #46895 ndb.* # joro : NDB tests marked as experimental as agreed with bochklin rpl.rpl_innodb_bug28430 @solaris # Bug#46029 -rpl.rpl_row_sp011 @solaris # Joro : Bug #54138 +rpl.rpl_row_sp011 @solaris # Joro : Bug #45445 rpl_ndb.* # joro : NDB tests marked as experimental as agreed with bochklin rpl_ndb.rpl_ndb_log # Bug#38998 From 914873674b4c08c3f4b726f3a4dba16bfb228ff9 Mon Sep 17 00:00:00 2001 From: unknown Date: Tue, 12 Apr 2011 01:36:38 +0200 Subject: [PATCH 59/91] Bug#11867664: Fix server crashes on update with join on partitioned table. --- sql/ha_partition.cc | 10 +++++++++- 1 file changed, 9 insertions(+), 1 deletion(-) diff --git a/sql/ha_partition.cc b/sql/ha_partition.cc index f55c48189fe..bd8e0d397c4 100644 --- a/sql/ha_partition.cc +++ b/sql/ha_partition.cc @@ -4317,7 +4317,8 @@ int ha_partition::index_read_idx_map(uchar *buf, uint index, break; } } - m_last_part= part; + if (part <= m_part_spec.end_part) + m_last_part= part; } else { @@ -6237,7 +6238,14 @@ void ha_partition::print_error(int error, myf errflag) { /* In case m_file has not been initialized, like in bug#42438 */ if (m_file) + { + if (m_last_part >= m_tot_parts) + { + DBUG_ASSERT(0); + m_last_part= 0; + } m_file[m_last_part]->print_error(error, errflag); + } else handler::print_error(error, errflag); } From 33c2a5e7e3f5ed2dee0f50f6d02052d8bf2234b9 Mon Sep 17 00:00:00 2001 From: Sergey Glukhov Date: Tue, 12 Apr 2011 13:51:36 +0400 Subject: [PATCH 60/91] Bug#11766212 59270: NOT IN (YEAR( ... ), ... ) PRODUCES MANY VALGRIND WARNINGS Valgrind warning happens due to early null values check in Item_func_in::fix_length_and_dec(before item evaluation). As result null value items with uninitialized values are placed into array and it leads to valgrind warnings during value array sorting. The fix is to check null value after item evaluation, item is evaluated in in_array::set() method. mysql-test/r/func_in.result: test case mysql-test/t/func_in.test: test case sql/item_cmpfunc.cc: The fix is to check null value after item evaluation. --- mysql-test/r/func_in.result | 6 ++++++ mysql-test/t/func_in.test | 6 ++++++ sql/item_cmpfunc.cc | 12 +++++------- 3 files changed, 17 insertions(+), 7 deletions(-) diff --git a/mysql-test/r/func_in.result b/mysql-test/r/func_in.result index fdeec2755ca..0b6117581f3 100644 --- a/mysql-test/r/func_in.result +++ b/mysql-test/r/func_in.result @@ -770,4 +770,10 @@ CASE a WHEN a THEN a END NULL DROP TABLE t1; # +# Bug #11766212 59270: NOT IN (YEAR( ... ), ... ) PRODUCES MANY VALGRIND WARNINGS +# +SELECT 1 IN (YEAR(FROM_UNIXTIME(NULL)) ,1); +1 IN (YEAR(FROM_UNIXTIME(NULL)) ,1) +1 +# End of 5.1 tests diff --git a/mysql-test/t/func_in.test b/mysql-test/t/func_in.test index 6efeb2866e6..08469b37967 100644 --- a/mysql-test/t/func_in.test +++ b/mysql-test/t/func_in.test @@ -554,6 +554,12 @@ SELECT CASE a WHEN a THEN a END FROM t1 GROUP BY a WITH ROLLUP; DROP TABLE t1; +--echo # +--echo # Bug #11766212 59270: NOT IN (YEAR( ... ), ... ) PRODUCES MANY VALGRIND WARNINGS +--echo # + +SELECT 1 IN (YEAR(FROM_UNIXTIME(NULL)) ,1); + --echo # --echo End of 5.1 tests diff --git a/sql/item_cmpfunc.cc b/sql/item_cmpfunc.cc index 36ca5537eb5..23f081e1cc0 100644 --- a/sql/item_cmpfunc.cc +++ b/sql/item_cmpfunc.cc @@ -4000,13 +4000,11 @@ void Item_func_in::fix_length_and_dec() uint j=0; for (uint i=1 ; i < arg_count ; i++) { - if (!args[i]->null_value) // Skip NULL values - { - array->set(j,args[i]); - j++; - } - else - have_null= 1; + array->set(j,args[i]); + if (!args[i]->null_value) // Skip NULL values + j++; + else + have_null= 1; } if ((array->used_count= j)) array->sort(); From 7fa7a0cad95b0c8cc4f7f450f7f3411fa632b148 Mon Sep 17 00:00:00 2001 From: Sergey Glukhov Date: Tue, 12 Apr 2011 14:01:33 +0400 Subject: [PATCH 61/91] Bug#11766270 59343: YEAR(4): INCORRECT RESULT AND VALGRIND WARNINGS WITH MIN/MAX, UNION When we create temporary result table for UNION incorrect max_length for YEAR field is used and it leads to incorrect field value and incorrect result string length as YEAR field value calculation depends on field length. The fix is to use underlying item max_length for Item_sum_hybrid::max_length intialization. mysql-test/r/func_group.result: test case mysql-test/t/func_group.test: test case sql/field.cc: added assert sql/item_sum.cc: init Item_sum_hybrid::max_length with use underlying item max_length for INT result type. --- mysql-test/r/func_group.result | 11 +++++++++++ mysql-test/t/func_group.test | 12 ++++++++++++ sql/field.cc | 2 ++ sql/item_sum.cc | 6 +----- 4 files changed, 26 insertions(+), 5 deletions(-) diff --git a/mysql-test/r/func_group.result b/mysql-test/r/func_group.result index 69bce1c8bd8..b90eb2a4c0f 100644 --- a/mysql-test/r/func_group.result +++ b/mysql-test/r/func_group.result @@ -1746,4 +1746,15 @@ MAX(LENGTH(a)) LENGTH(MAX(a)) MIN(a) MAX(a) CONCAT(MIN(a)) CONCAT(MAX(a)) 20 20 18446668621106209655 18446668621106209655 18446668621106209655 18446668621106209655 DROP TABLE t1; # +# Bug #11766270 59343: YEAR(4): INCORRECT RESULT AND VALGRIND WARNINGS WITH MIN/MAX, UNION +# +CREATE TABLE t1(f1 YEAR(4)); +INSERT INTO t1 VALUES (0000),(2001); +(SELECT MAX(f1) FROM t1) UNION (SELECT MAX(f1) FROM t1); +Catalog Database Table Table_alias Column Column_alias Type Length Max length Is_null Flags Decimals Charsetnr +def MAX(f1) MAX(f1) 13 4 4 Y 32864 0 63 +MAX(f1) +2001 +DROP TABLE t1; +# End of 5.1 tests diff --git a/mysql-test/t/func_group.test b/mysql-test/t/func_group.test index 600b46fcde6..177a1ca2471 100644 --- a/mysql-test/t/func_group.test +++ b/mysql-test/t/func_group.test @@ -1127,6 +1127,18 @@ INSERT INTO t1 VALUES (18446668621106209655); SELECT MAX(LENGTH(a)), LENGTH(MAX(a)), MIN(a), MAX(a), CONCAT(MIN(a)), CONCAT(MAX(a)) FROM t1; DROP TABLE t1; +--echo # +--echo # Bug #11766270 59343: YEAR(4): INCORRECT RESULT AND VALGRIND WARNINGS WITH MIN/MAX, UNION +--echo # + +CREATE TABLE t1(f1 YEAR(4)); +INSERT INTO t1 VALUES (0000),(2001); +--enable_metadata +(SELECT MAX(f1) FROM t1) UNION (SELECT MAX(f1) FROM t1); +--disable_metadata +DROP TABLE t1; + + --echo # --echo End of 5.1 tests diff --git a/sql/field.cc b/sql/field.cc index 1ad5e408e07..3707c5b056f 100644 --- a/sql/field.cc +++ b/sql/field.cc @@ -5467,6 +5467,7 @@ double Field_year::val_real(void) longlong Field_year::val_int(void) { ASSERT_COLUMN_MARKED_FOR_READ; + DBUG_ASSERT(field_length == 2 || field_length == 4); int tmp= (int) ptr[0]; if (field_length != 4) tmp%=100; // Return last 2 char @@ -5479,6 +5480,7 @@ longlong Field_year::val_int(void) String *Field_year::val_str(String *val_buffer, String *val_ptr __attribute__((unused))) { + DBUG_ASSERT(field_length < 5); val_buffer->alloc(5); val_buffer->length(field_length); char *to=(char*) val_buffer->ptr(); diff --git a/sql/item_sum.cc b/sql/item_sum.cc index 2a8aea68f7a..c62738abac0 100644 --- a/sql/item_sum.cc +++ b/sql/item_sum.cc @@ -612,17 +612,13 @@ Item_sum_hybrid::fix_fields(THD *thd, Item **ref) switch (hybrid_type= item->result_type()) { case INT_RESULT: - max_length= 20; - break; case DECIMAL_RESULT: + case STRING_RESULT: max_length= item->max_length; break; case REAL_RESULT: max_length= float_length(decimals); break; - case STRING_RESULT: - max_length= item->max_length; - break; case ROW_RESULT: default: DBUG_ASSERT(0); From da267719197397fbf0ba70fe0749788a82581267 Mon Sep 17 00:00:00 2001 From: Sven Sandberg Date: Tue, 12 Apr 2011 13:14:49 +0200 Subject: [PATCH 62/91] marked rpl_stop_slave experimental due to BUG#12345981 --- mysql-test/collections/default.experimental | 1 + 1 file changed, 1 insertion(+) diff --git a/mysql-test/collections/default.experimental b/mysql-test/collections/default.experimental index 703a8a18ef0..4e566436ac8 100644 --- a/mysql-test/collections/default.experimental +++ b/mysql-test/collections/default.experimental @@ -23,6 +23,7 @@ ndb.* # joro : NDB tests marked as experiment rpl.rpl_innodb_bug28430 @solaris # Bug#46029 rpl.rpl_row_sp011 @solaris # Joro : Bug #45445 +rpl.rpl_stop_slave @freebsd # Sven : BUG#12345981 rpl_ndb.* # joro : NDB tests marked as experimental as agreed with bochklin rpl_ndb.rpl_ndb_log # Bug#38998 From 729e9a65943823b2636ea8dc3c50486a3844c02c Mon Sep 17 00:00:00 2001 From: Serge Kozlov Date: Thu, 14 Apr 2011 00:18:08 +0400 Subject: [PATCH 63/91] WL#5867, reorganize test cases of bugs suite --- mysql-test/collections/default.experimental | 5 + .../r/binlog_bug23533.result} | 20 +-- .../suite/binlog/r/binlog_bug36391.result | 10 ++ .../t/binlog_bug23533.test} | 18 +- .../t/binlog_bug36391-master.opt} | 0 .../t/binlog_bug36391.test} | 23 +-- mysql-test/suite/bugs/combinations | 8 - mysql-test/suite/bugs/data/rpl_bug12691.dat | 3 - mysql-test/suite/bugs/r/rpl_bug12691.result | 33 ---- mysql-test/suite/bugs/r/rpl_bug31582.result | 16 -- mysql-test/suite/bugs/r/rpl_bug31583.result | 16 -- mysql-test/suite/bugs/r/rpl_bug33029.result | 15 -- mysql-test/suite/bugs/r/rpl_bug36391.result | 18 -- mysql-test/suite/bugs/r/rpl_bug37426.result | 17 -- mysql-test/suite/bugs/r/rpl_bug38205.result | 56 ------ mysql-test/suite/bugs/t/rpl_bug12691.test | 49 ------ mysql-test/suite/bugs/t/rpl_bug31582.test | 25 --- mysql-test/suite/bugs/t/rpl_bug31583.test | 25 --- mysql-test/suite/bugs/t/rpl_bug33029.test | 26 --- mysql-test/suite/bugs/t/rpl_bug38205.test | 166 ------------------ mysql-test/suite/rpl/r/rpl_bug37426.result | 12 ++ .../suite/{bugs => rpl}/t/rpl_bug37426.test | 11 +- 22 files changed, 63 insertions(+), 509 deletions(-) rename mysql-test/suite/{bugs/r/rpl_bug23533.result => binlog/r/binlog_bug23533.result} (52%) create mode 100644 mysql-test/suite/binlog/r/binlog_bug36391.result rename mysql-test/suite/{bugs/t/rpl_bug23533.test => binlog/t/binlog_bug23533.test} (76%) rename mysql-test/suite/{bugs/t/rpl_bug36391-master.opt => binlog/t/binlog_bug36391-master.opt} (100%) rename mysql-test/suite/{bugs/t/rpl_bug36391.test => binlog/t/binlog_bug36391.test} (65%) delete mode 100644 mysql-test/suite/bugs/combinations delete mode 100644 mysql-test/suite/bugs/data/rpl_bug12691.dat delete mode 100644 mysql-test/suite/bugs/r/rpl_bug12691.result delete mode 100644 mysql-test/suite/bugs/r/rpl_bug31582.result delete mode 100644 mysql-test/suite/bugs/r/rpl_bug31583.result delete mode 100644 mysql-test/suite/bugs/r/rpl_bug33029.result delete mode 100644 mysql-test/suite/bugs/r/rpl_bug36391.result delete mode 100644 mysql-test/suite/bugs/r/rpl_bug37426.result delete mode 100644 mysql-test/suite/bugs/r/rpl_bug38205.result delete mode 100644 mysql-test/suite/bugs/t/rpl_bug12691.test delete mode 100644 mysql-test/suite/bugs/t/rpl_bug31582.test delete mode 100644 mysql-test/suite/bugs/t/rpl_bug31583.test delete mode 100644 mysql-test/suite/bugs/t/rpl_bug33029.test delete mode 100644 mysql-test/suite/bugs/t/rpl_bug38205.test create mode 100644 mysql-test/suite/rpl/r/rpl_bug37426.result rename mysql-test/suite/{bugs => rpl}/t/rpl_bug37426.test (71%) diff --git a/mysql-test/collections/default.experimental b/mysql-test/collections/default.experimental index 4e566436ac8..72e14135ef0 100644 --- a/mysql-test/collections/default.experimental +++ b/mysql-test/collections/default.experimental @@ -2,6 +2,9 @@ # in alphabetical order. This also helps with merge conflict resolution. binlog.binlog_multi_engine # joro : NDB tests marked as experimental as agreed with bochklin +binlog.binlog_bug23533 # WL#5867: skozlov: test case moved from unused bugs suite +binlog.binlog_bug36391 # WL#5867: skozlov: test case moved from unused bugs suite + funcs_1.charset_collation_1 # depends on compile-time decisions funcs_1.is_cml_ndb # joro : NDB tests marked as experimental as agreed with bochklin @@ -24,6 +27,8 @@ ndb.* # joro : NDB tests marked as experiment rpl.rpl_innodb_bug28430 @solaris # Bug#46029 rpl.rpl_row_sp011 @solaris # Joro : Bug #45445 rpl.rpl_stop_slave @freebsd # Sven : BUG#12345981 +rpl.rpl_bug37426 # WL#5867: skozlov: test case moved from unused bugs suite + rpl_ndb.* # joro : NDB tests marked as experimental as agreed with bochklin rpl_ndb.rpl_ndb_log # Bug#38998 diff --git a/mysql-test/suite/bugs/r/rpl_bug23533.result b/mysql-test/suite/binlog/r/binlog_bug23533.result similarity index 52% rename from mysql-test/suite/bugs/r/rpl_bug23533.result rename to mysql-test/suite/binlog/r/binlog_bug23533.result index 1dda75a69b0..8a28867afb4 100644 --- a/mysql-test/suite/bugs/r/rpl_bug23533.result +++ b/mysql-test/suite/binlog/r/binlog_bug23533.result @@ -1,23 +1,19 @@ -stop slave; -drop table if exists t1,t2,t3,t4,t5,t6,t7,t8,t9; -reset master; -reset slave; -drop table if exists t1,t2,t3,t4,t5,t6,t7,t8,t9; -start slave; -DROP TABLE IF EXISTS t1,t2; SET AUTOCOMMIT=0; -SET GLOBAL max_binlog_cache_size=4096; -SHOW VARIABLES LIKE 'max_binlog_cache_size'; -Variable_name Value -max_binlog_cache_size 4096 CREATE TABLE t1 (a INT NOT NULL AUTO_INCREMENT, b TEXT, PRIMARY KEY(a)) ENGINE=InnoDB; SELECT COUNT(*) FROM t1; COUNT(*) 1000 +SHOW VARIABLES LIKE 'max_binlog_cache_size'; +Variable_name Value +max_binlog_cache_size 4294963200 +SET @saved_max_binlog_cache_size=@@max_binlog_cache_size; +SET GLOBAL max_binlog_cache_size=4096; START TRANSACTION; CREATE TABLE t2 SELECT * FROM t1; -ERROR HY000: Writing one row to the row-based binary log failed +ERROR HY000: Multi-statement transaction required more than 'max_binlog_cache_size' bytes of storage; increase this mysqld variable and try again COMMIT; SHOW TABLES LIKE 't%'; Tables_in_test (t%) t1 +SET GLOBAL max_binlog_cache_size=@saved_max_binlog_cache_size; +DROP TABLE t1; diff --git a/mysql-test/suite/binlog/r/binlog_bug36391.result b/mysql-test/suite/binlog/r/binlog_bug36391.result new file mode 100644 index 00000000000..551bfb9924d --- /dev/null +++ b/mysql-test/suite/binlog/r/binlog_bug36391.result @@ -0,0 +1,10 @@ +CREATE TABLE t1(id INT); +SHOW TABLES; +Tables_in_test +t1 +FLUSH LOGS; +DROP TABLE t1; +SHOW TABLES; +Tables_in_test +t1 +DROP TABLE t1; diff --git a/mysql-test/suite/bugs/t/rpl_bug23533.test b/mysql-test/suite/binlog/t/binlog_bug23533.test similarity index 76% rename from mysql-test/suite/bugs/t/rpl_bug23533.test rename to mysql-test/suite/binlog/t/binlog_bug23533.test index 337dddcef3d..3c9a7ab5896 100644 --- a/mysql-test/suite/bugs/t/rpl_bug23533.test +++ b/mysql-test/suite/binlog/t/binlog_bug23533.test @@ -4,15 +4,13 @@ ############################################################# --source include/have_innodb.inc +--source include/have_log_bin.inc --source include/have_binlog_format_row.inc ---source include/master-slave.inc SET AUTOCOMMIT=0; -SET GLOBAL max_binlog_cache_size=4096; -SHOW VARIABLES LIKE 'max_binlog_cache_size'; +# Create 1st table CREATE TABLE t1 (a INT NOT NULL AUTO_INCREMENT, b TEXT, PRIMARY KEY(a)) ENGINE=InnoDB; - --disable_query_log let $i= 1000; while ($i) @@ -21,16 +19,20 @@ while ($i) dec $i; } --enable_query_log - SELECT COUNT(*) FROM t1; +# Set small value for max_binlog_cache_size +SHOW VARIABLES LIKE 'max_binlog_cache_size'; +SET @saved_max_binlog_cache_size=@@max_binlog_cache_size; +SET GLOBAL max_binlog_cache_size=4096; + # Copied data from t1 into t2 large than max_binlog_cache_size START TRANSACTION; ---error 1534 +--error 1197 CREATE TABLE t2 SELECT * FROM t1; COMMIT; SHOW TABLES LIKE 't%'; - # 5.1 End of Test ---source include/rpl_end.inc +SET GLOBAL max_binlog_cache_size=@saved_max_binlog_cache_size; +DROP TABLE t1; diff --git a/mysql-test/suite/bugs/t/rpl_bug36391-master.opt b/mysql-test/suite/binlog/t/binlog_bug36391-master.opt similarity index 100% rename from mysql-test/suite/bugs/t/rpl_bug36391-master.opt rename to mysql-test/suite/binlog/t/binlog_bug36391-master.opt diff --git a/mysql-test/suite/bugs/t/rpl_bug36391.test b/mysql-test/suite/binlog/t/binlog_bug36391.test similarity index 65% rename from mysql-test/suite/bugs/t/rpl_bug36391.test rename to mysql-test/suite/binlog/t/binlog_bug36391.test index 3961082273d..64d91dfafd9 100644 --- a/mysql-test/suite/bugs/t/rpl_bug36391.test +++ b/mysql-test/suite/binlog/t/binlog_bug36391.test @@ -13,17 +13,18 @@ # # ---source include/master-slave.inc +--source include/have_log_bin.inc +--source include/have_binlog_format_mixed.inc -create table t1(id int); +CREATE TABLE t1(id INT); +let $binlog= query_get_value(SHOW MASTER STATUS, File, 1); +let $binlog_path= `SELECT CONCAT(@@DATADIR, '$binlog')`; +SHOW TABLES; +FLUSH LOGS; +DROP TABLE t1; -show tables; +--exec $MYSQL_BINLOG $binlog_path | $MYSQL test +SHOW TABLES; ---source include/show_master_status.inc - -flush logs; - ---exec $MYSQL_BINLOG $MYSQL_TEST_DIR/var/log/master-bin.000001 | $MYSQL test - -drop table t1; ---source include/rpl_end.inc +# Clean up +DROP TABLE t1; diff --git a/mysql-test/suite/bugs/combinations b/mysql-test/suite/bugs/combinations deleted file mode 100644 index 07042c2cbec..00000000000 --- a/mysql-test/suite/bugs/combinations +++ /dev/null @@ -1,8 +0,0 @@ -[row] -binlog-format=row - -[stmt] -binlog-format=statement - -[mix] -binlog-format=mixed diff --git a/mysql-test/suite/bugs/data/rpl_bug12691.dat b/mysql-test/suite/bugs/data/rpl_bug12691.dat deleted file mode 100644 index de980441c3a..00000000000 --- a/mysql-test/suite/bugs/data/rpl_bug12691.dat +++ /dev/null @@ -1,3 +0,0 @@ -a -b -c diff --git a/mysql-test/suite/bugs/r/rpl_bug12691.result b/mysql-test/suite/bugs/r/rpl_bug12691.result deleted file mode 100644 index 8feeb0effc3..00000000000 --- a/mysql-test/suite/bugs/r/rpl_bug12691.result +++ /dev/null @@ -1,33 +0,0 @@ -stop slave; -drop table if exists t1,t2,t3,t4,t5,t6,t7,t8,t9; -reset master; -reset slave; -drop table if exists t1,t2,t3,t4,t5,t6,t7,t8,t9; -start slave; - -**** On Master **** -CREATE TABLE t1 (b CHAR(10)); - -**** On Slave **** -STOP SLAVE; - -**** On Master **** -LOAD DATA INFILE FILENAME -SELECT COUNT(*) FROM t1; -COUNT(*) -3 -show binlog events from ; -Log_name Pos Event_type Server_id End_log_pos Info -master-bin.000001 # Query # # use `test`; CREATE TABLE t1 (b CHAR(10)) -master-bin.000001 # Begin_load_query # # ;file_id=#;block_len=# -master-bin.000001 # Execute_load_query # # use `test`; LOAD DATA INFILE 'MYSQLTEST_VARDIR/tmp/rpl_bug12691.dat' INTO TABLE `t1` FIELDS TERMINATED BY '|' ENCLOSED BY '' ESCAPED BY '\\' LINES TERMINATED BY '\n' (`b`) ;file_id=# - -**** On Slave **** -SET GLOBAL SQL_SLAVE_SKIP_COUNTER=1; -START SLAVE; -SELECT COUNT(*) FROM t1; -COUNT(*) -0 - -**** On Master **** -DROP TABLE t1; diff --git a/mysql-test/suite/bugs/r/rpl_bug31582.result b/mysql-test/suite/bugs/r/rpl_bug31582.result deleted file mode 100644 index 1f71fbf8fe7..00000000000 --- a/mysql-test/suite/bugs/r/rpl_bug31582.result +++ /dev/null @@ -1,16 +0,0 @@ -stop slave; -drop table if exists t1,t2,t3,t4,t5,t6,t7,t8,t9; -reset master; -reset slave; -drop table if exists t1,t2,t3,t4,t5,t6,t7,t8,t9; -start slave; -CREATE TABLE t1 (a VARCHAR(10) PRIMARY KEY) ENGINE=MyISAM; -INSERT INTO t1 VALUES ('a'); -UPDATE t1 SET a = 'MyISAM'; -SELECT * FROM t1 ORDER BY a; -a -MyISAM -SELECT * FROM t1 ORDER BY a; -a -MyISAM -DROP TABLE t1; diff --git a/mysql-test/suite/bugs/r/rpl_bug31583.result b/mysql-test/suite/bugs/r/rpl_bug31583.result deleted file mode 100644 index 74846607313..00000000000 --- a/mysql-test/suite/bugs/r/rpl_bug31583.result +++ /dev/null @@ -1,16 +0,0 @@ -stop slave; -drop table if exists t1,t2,t3,t4,t5,t6,t7,t8,t9; -reset master; -reset slave; -drop table if exists t1,t2,t3,t4,t5,t6,t7,t8,t9; -start slave; -CREATE TABLE t1 ( a INT, b INT DEFAULT -3 ); -INSERT INTO t1 VALUES (1, DEFAULT); -UPDATE t1 SET a = 3; -SELECT * FROM t1 ORDER BY a; -a b -3 -3 -SELECT * FROM t1 ORDER BY a; -a b -3 -3 -DROP TABLE t1; diff --git a/mysql-test/suite/bugs/r/rpl_bug33029.result b/mysql-test/suite/bugs/r/rpl_bug33029.result deleted file mode 100644 index d11ae1cc0be..00000000000 --- a/mysql-test/suite/bugs/r/rpl_bug33029.result +++ /dev/null @@ -1,15 +0,0 @@ -stop slave; -drop table if exists t1,t2,t3,t4,t5,t6,t7,t8,t9; -reset master; -reset slave; -drop table if exists t1,t2,t3,t4,t5,t6,t7,t8,t9; -start slave; -create table `t1` (`id` int not null auto_increment primary key); -create trigger `trg` before insert on `t1` for each row begin end; -set @@global.debug="+d,simulate_bug33029"; -stop slave; -start slave; -insert into `t1` values (); -select * from t1; -id -1 diff --git a/mysql-test/suite/bugs/r/rpl_bug36391.result b/mysql-test/suite/bugs/r/rpl_bug36391.result deleted file mode 100644 index 33175d89d30..00000000000 --- a/mysql-test/suite/bugs/r/rpl_bug36391.result +++ /dev/null @@ -1,18 +0,0 @@ -stop slave; -drop table if exists t1,t2,t3,t4,t5,t6,t7,t8,t9; -reset master; -reset slave; -drop table if exists t1,t2,t3,t4,t5,t6,t7,t8,t9; -start slave; -drop table if exists t1; -Warnings: -Note 1051 Unknown table 't1' -create table t1(id int); -show tables; -Tables_in_test -t1 -show master status; -File Position Binlog_Do_DB Binlog_Ignore_DB -master-bin.000001 # -flush logs; -drop table t1; diff --git a/mysql-test/suite/bugs/r/rpl_bug37426.result b/mysql-test/suite/bugs/r/rpl_bug37426.result deleted file mode 100644 index 24dfd27ca01..00000000000 --- a/mysql-test/suite/bugs/r/rpl_bug37426.result +++ /dev/null @@ -1,17 +0,0 @@ -stop slave; -drop table if exists t1,t2,t3,t4,t5,t6,t7,t8,t9; -reset master; -reset slave; -drop table if exists t1,t2,t3,t4,t5,t6,t7,t8,t9; -start slave; -CREATE TABLE char128_utf8 ( -i1 INT NOT NULL, -c CHAR(128) CHARACTER SET utf8 NOT NULL, -i2 INT NOT NULL); -INSERT INTO char128_utf8 VALUES ( 1, "123", 1 ); -SELECT * FROM char128_utf8; -i1 c i2 -1 123 1 -SELECT * FROM char128_utf8; -i1 c i2 -1 123 1 diff --git a/mysql-test/suite/bugs/r/rpl_bug38205.result b/mysql-test/suite/bugs/r/rpl_bug38205.result deleted file mode 100644 index 8f1dee344fa..00000000000 --- a/mysql-test/suite/bugs/r/rpl_bug38205.result +++ /dev/null @@ -1,56 +0,0 @@ -stop slave; -drop table if exists t1,t2,t3,t4,t5,t6,t7,t8,t9; -reset master; -reset slave; -drop table if exists t1,t2,t3,t4,t5,t6,t7,t8,t9; -start slave; -create table t1i(n int primary key) engine=innodb; -create table t2m(n int primary key) engine=myisam; -begin; -insert into t1i values (1); -insert into t1i values (2); -insert into t1i values (3); -commit; -begin; -insert into t1i values (5); -begin; -insert into t1i values (4); -insert into t2m values (1); -update t1i set n = 5 where n = 4; -commit; -zero -0 -*** kill sql thread *** -rollback; -*** sql thread is *not* running: No *** -*** the prove: the killed slave has not finished the current transaction *** -three -3 -one -1 -zero -0 -delete from t2m; -start slave sql_thread; -delete from t1i; -delete from t2m; -begin; -insert into t1i values (5); -begin; -insert into t1i values (4); -update t1i set n = 5 where n = 4; -commit; -zero -0 -stop slave sql_thread; -rollback; -*** sql thread is *not* running: No *** -*** the prove: the stopped slave has rolled back the current transaction *** -zero -0 -zero -0 -one -1 -start slave sql_thread; -drop table t1i, t2m; diff --git a/mysql-test/suite/bugs/t/rpl_bug12691.test b/mysql-test/suite/bugs/t/rpl_bug12691.test deleted file mode 100644 index 038f3e57b75..00000000000 --- a/mysql-test/suite/bugs/t/rpl_bug12691.test +++ /dev/null @@ -1,49 +0,0 @@ -# Bug#12691: Exec_master_log_pos corrupted with SQL_SLAVE_SKIP_COUNTER - ---source include/master-slave.inc ---connection master ---source include/have_binlog_format_mixed_or_statement.inc - ---echo ---echo **** On Master **** -CREATE TABLE t1 (b CHAR(10)); ---echo ---echo **** On Slave **** ---sync_slave_with_master -STOP SLAVE; ---source include/wait_for_slave_to_stop.inc - ---connection master - ---echo ---echo **** On Master **** ---exec cp $MYSQL_TEST_DIR/suite/bugs/data/rpl_bug12691.dat $MYSQLTEST_VARDIR/tmp/ ---echo LOAD DATA INFILE FILENAME ---disable_query_log ---eval LOAD DATA INFILE '$MYSQLTEST_VARDIR/tmp/rpl_bug12691.dat' INTO TABLE t1 FIELDS TERMINATED BY '|' ---enable_query_log ---remove_file $MYSQLTEST_VARDIR/tmp/rpl_bug12691.dat - -SELECT COUNT(*) FROM t1; - -source include/show_binlog_events.inc; - ---save_master_pos - ---connection slave ---echo ---echo **** On Slave **** -SET GLOBAL SQL_SLAVE_SKIP_COUNTER=1; -START SLAVE; ---source include/wait_for_slave_to_start.inc ---sync_with_master - -SELECT COUNT(*) FROM t1; - -# Clean up ---connection master ---echo ---echo **** On Master **** -DROP TABLE t1; - ---source include/rpl_end.inc diff --git a/mysql-test/suite/bugs/t/rpl_bug31582.test b/mysql-test/suite/bugs/t/rpl_bug31582.test deleted file mode 100644 index 6bff8ef4172..00000000000 --- a/mysql-test/suite/bugs/t/rpl_bug31582.test +++ /dev/null @@ -1,25 +0,0 @@ - -# BUG#31582: 5.1-telco-6.1 -> 5.1.22. Slave crashes when reading -# UPDATE for VARCHAR - -# This is a problem for any update statement replicating from an old -# server to a new server. The bug consisted of a new slave trying to -# read two column bitmaps, but there is only one available in the old -# format. - -# This test case should be executed replicating from an old server to -# a new server, so make sure you have one handy. - -source include/master-slave.inc; - -CREATE TABLE t1 (a VARCHAR(10) PRIMARY KEY) ENGINE=MyISAM; -INSERT INTO t1 VALUES ('a'); -UPDATE t1 SET a = 'MyISAM'; -SELECT * FROM t1 ORDER BY a; -sync_slave_with_master; -SELECT * FROM t1 ORDER BY a; - -connection master; -DROP TABLE t1; - ---source include/rpl_end.inc diff --git a/mysql-test/suite/bugs/t/rpl_bug31583.test b/mysql-test/suite/bugs/t/rpl_bug31583.test deleted file mode 100644 index ee5b7698016..00000000000 --- a/mysql-test/suite/bugs/t/rpl_bug31583.test +++ /dev/null @@ -1,25 +0,0 @@ -# -# BUG#31583: 5.1-telco-6.1 -> 5.1.22. Slave returns Error in unknown event - -# This is a problem for any update statement replicating from an old -# server to a new server. The bug consisted of a new slave trying to -# read two column bitmaps, but there is only one available in the old -# format. - -# This test case should be executed replicating from an old server to -# a new server, so make sure you have one handy. - -source include/master-slave.inc; - -CREATE TABLE t1 ( a INT, b INT DEFAULT -3 ); - -INSERT INTO t1 VALUES (1, DEFAULT); -UPDATE t1 SET a = 3; -SELECT * FROM t1 ORDER BY a; -sync_slave_with_master; -SELECT * FROM t1 ORDER BY a; - -connection master; -DROP TABLE t1; - ---source include/rpl_end.inc diff --git a/mysql-test/suite/bugs/t/rpl_bug33029.test b/mysql-test/suite/bugs/t/rpl_bug33029.test deleted file mode 100644 index f5aad4de8df..00000000000 --- a/mysql-test/suite/bugs/t/rpl_bug33029.test +++ /dev/null @@ -1,26 +0,0 @@ -# -# Bug #36443 Server crashes when executing insert when insert trigger on table -# -# Emulating the former bug#33029 situation to see that there is no crash anymore. -# - - -source include/master-slave.inc; - -create table `t1` (`id` int not null auto_increment primary key); -create trigger `trg` before insert on `t1` for each row begin end; - -sync_slave_with_master; -set @@global.debug="+d,simulate_bug33029"; - -stop slave; -start slave; - -connection master; - -insert into `t1` values (); - -sync_slave_with_master; -select * from t1; - ---source include/rpl_end.inc diff --git a/mysql-test/suite/bugs/t/rpl_bug38205.test b/mysql-test/suite/bugs/t/rpl_bug38205.test deleted file mode 100644 index 550746719f4..00000000000 --- a/mysql-test/suite/bugs/t/rpl_bug38205.test +++ /dev/null @@ -1,166 +0,0 @@ -# -# Bug #38205 Row-based Replication (RBR) causes inconsistencies: HA_ERR_FOUND_DUPP_KEY -# Bug#319 if while a non-transactional slave is replicating a transaction possible problem -# -# Verifying the fact that STOP SLAVE in the middle of a group execution waits -# for the end of the group before the slave sql thread will stop. -# The patch refines STOP SLAVE to not interrupt a transaction or other type of -# the replication events group (the part I). -# Killing the sql thread continues to provide a "hard" stop (the part II). -# -# Non-deterministic tests -# - -source include/master-slave.inc; -source include/have_innodb.inc; - - -# -# Part II, killed sql slave leaves instantly -# - -# A. multi-statement transaction as the replication group - -connection master; - -create table t1i(n int primary key) engine=innodb; -create table t2m(n int primary key) engine=myisam; - -sync_slave_with_master; - -connection master; - -begin; -insert into t1i values (1); -insert into t1i values (2); -insert into t1i values (3); -commit; - -sync_slave_with_master; - -# -# todo: first challenge is to find out the SQL thread id -# the following is not fully reliable -# - -let $id=`SELECT id from information_schema.processlist where user like 'system user' and state like '%Has read all relay log%' or user like 'system user' and state like '%Reading event from the relay log%'`; -connection slave; -begin; -insert into t1i values (5); - -connection master; -let $pos0_master= query_get_value(SHOW MASTER STATUS, Position, 1); -begin; -insert into t1i values (4); -insert into t2m values (1); # non-ta update -update t1i set n = 5 where n = 4; # to block at. can't be played with killed -commit; -let $pos1_master= query_get_value(SHOW MASTER STATUS, Position, 1); - -connection slave; -# slave sql thread must be locked out by the conn `slave' explicit lock -let $pos0_slave= query_get_value(SHOW SLAVE STATUS, Exec_Master_Log_Pos, 1); ---disable_query_log -eval select $pos0_master - $pos0_slave as zero; ---enable_query_log - -connection slave1; - -let $count= 1; -let $table= t2m; -source include/wait_until_rows_count.inc; -# -# todo: may fail as said above -# ---echo *** kill sql thread *** ---disable_query_log -eval kill connection $id; ---enable_query_log - -connection slave; -rollback; # release the sql thread - -connection slave1; - -source include/wait_for_slave_sql_to_stop.inc; -let $sql_status= query_get_value(SHOW SLAVE STATUS, Slave_SQL_Running, 1); ---echo *** sql thread is *not* running: $sql_status *** -let $pos1_slave= query_get_value(SHOW SLAVE STATUS, Exec_Master_Log_Pos, 1); - -connection slave; ---echo *** the prove: the killed slave has not finished the current transaction *** - ---disable_query_log -select count(*) as three from t1i; -eval select $pos1_master > $pos1_slave as one; -eval select $pos1_slave - $pos0_slave as zero; ---enable_query_log - -delete from t2m; # remove the row to be able to replay -start slave sql_thread; - -# -# Part I: B The homogenous transaction remains interuptable in between -# - -connection master; -delete from t1i; -delete from t2m; - -sync_slave_with_master; -begin; -insert into t1i values (5); - -connection master; -let $pos0_master= query_get_value(SHOW MASTER STATUS, Position, 1); -begin; -insert into t1i values (4); -update t1i set n = 5 where n = 4; # to block at. not to be played -commit; -let $pos1_master= query_get_value(SHOW MASTER STATUS, Position, 1); - - -connection slave1; -# slave sql can't advance as must be locked by the conn `slave' trans -let $pos0_slave= query_get_value(SHOW SLAVE STATUS, Exec_Master_Log_Pos, 1); ---disable_query_log -eval select $pos0_master - $pos0_slave as zero; ---enable_query_log - -# -# the replicated trans is blocked by the slave's local. -# However, it's not easy to catch the exact moment when it happens. -# The test issues sleep which makes the test either non-deterministic or -# wasting too much time. -# ---sleep 3 - -send stop slave sql_thread; - -connection slave; -rollback; # release the sql thread - -connection slave1; -reap; -source include/wait_for_slave_sql_to_stop.inc; -let $sql_status= query_get_value(SHOW SLAVE STATUS, Slave_SQL_Running, 1); ---echo *** sql thread is *not* running: $sql_status *** - -let $pos1_slave= query_get_value(SHOW SLAVE STATUS, Exec_Master_Log_Pos, 1); - ---echo *** the prove: the stopped slave has rolled back the current transaction *** - ---disable_query_log -select count(*) as zero from t1i; -eval select $pos0_master - $pos0_slave as zero; -eval select $pos1_master > $pos0_slave as one; ---enable_query_log - -start slave sql_thread; - -# clean-up - -connection master; -drop table t1i, t2m; - ---source include/rpl_end.inc diff --git a/mysql-test/suite/rpl/r/rpl_bug37426.result b/mysql-test/suite/rpl/r/rpl_bug37426.result new file mode 100644 index 00000000000..bf96255c7b4 --- /dev/null +++ b/mysql-test/suite/rpl/r/rpl_bug37426.result @@ -0,0 +1,12 @@ +include/master-slave.inc +[connection master] +CREATE TABLE char128_utf8 (i1 INT NOT NULL, c CHAR(128) CHARACTER SET utf8 NOT NULL, i2 INT NOT NULL); +INSERT INTO char128_utf8 VALUES ( 1, "123", 1 ); +SELECT * FROM char128_utf8; +i1 c i2 +1 123 1 +SELECT * FROM char128_utf8; +i1 c i2 +1 123 1 +DROP TABLE char128_utf8; +include/rpl_end.inc diff --git a/mysql-test/suite/bugs/t/rpl_bug37426.test b/mysql-test/suite/rpl/t/rpl_bug37426.test similarity index 71% rename from mysql-test/suite/bugs/t/rpl_bug37426.test rename to mysql-test/suite/rpl/t/rpl_bug37426.test index 4c7729ab837..d0a60524fef 100644 --- a/mysql-test/suite/bugs/t/rpl_bug37426.test +++ b/mysql-test/suite/rpl/t/rpl_bug37426.test @@ -7,15 +7,16 @@ source include/master-slave.inc; source include/have_binlog_format_row.inc; connection master; -CREATE TABLE char128_utf8 ( - i1 INT NOT NULL, - c CHAR(128) CHARACTER SET utf8 NOT NULL, - i2 INT NOT NULL); - +CREATE TABLE char128_utf8 (i1 INT NOT NULL, c CHAR(128) CHARACTER SET utf8 NOT NULL, i2 INT NOT NULL); INSERT INTO char128_utf8 VALUES ( 1, "123", 1 ); SELECT * FROM char128_utf8; sync_slave_with_master; SELECT * FROM char128_utf8; + +# Clean up +connection master; +DROP TABLE char128_utf8; +sync_slave_with_master; --source include/rpl_end.inc From 3abe56f31d90f2cc84399e042b5f105b87b2b01a Mon Sep 17 00:00:00 2001 From: Sergey Glukhov Date: Thu, 14 Apr 2011 12:11:57 +0400 Subject: [PATCH 64/91] Bug#11756242 48137: PROCEDURE ANALYSE() LEAKS MEMORY WHEN RETURNING NULL There are two problems with ANALYSE(): 1. Memory leak it happens because do_select() can overwrite JOIN::procedure field(with zero value in our case) and JOIN destructor don't free the memory allocated for JOIN::procedure. The fix is to save original JOIN::procedure before do_select() call and restore it after do_select execution. 2. Wrong result If ANALYSE() procedure is used for the statement with LIMIT clause it could retrun empty result set. It happens because of missing analyse::end_of_records() call. First end_send() function call returns NESTED_LOOP_QUERY_LIMIT and second call of end_send() with end_of_records flag enabled does not happen. The fix is to return NESTED_LOOP_OK from end_send() if procedure is active. mysql-test/r/analyse.result: test case mysql-test/t/analyse.test: test case sql/sql_select.cc: --save original JOIN::procedure before do_select() call and restore it after do_select execution. --return NESTED_LOOP_OK from end_send() if procedure is active --- mysql-test/r/analyse.result | 13 +++++++++++++ mysql-test/t/analyse.test | 12 ++++++++++++ sql/sql_select.cc | 16 ++++++++++++---- 3 files changed, 37 insertions(+), 4 deletions(-) diff --git a/mysql-test/r/analyse.result b/mysql-test/r/analyse.result index 92fc26e7ba3..f82439090f6 100644 --- a/mysql-test/r/analyse.result +++ b/mysql-test/r/analyse.result @@ -135,4 +135,17 @@ SELECT * FROM t1 PROCEDURE ANALYSE(); Field_name Min_value Max_value Min_length Max_length Empties_or_zeros Nulls Avg_value_or_avg_length Std Optimal_fieldtype test.t1.a e e- 1 2 0 0 1.3333 NULL ENUM('e','e-') NOT NULL DROP TABLE t1; +# +# Bug#11756242 48137: PROCEDURE ANALYSE() LEAKS MEMORY WHEN RETURNING NULL +# +CREATE TABLE t1(f1 INT) ENGINE=MYISAM; +CREATE TABLE t2(f2 INT) ENGINE=INNODB; +INSERT INTO t2 VALUES (1); +SELECT DISTINCTROW f1 FROM t1 NATURAL RIGHT OUTER JOIN t2 PROCEDURE ANALYSE(); +Field_name Min_value Max_value Min_length Max_length Empties_or_zeros Nulls Avg_value_or_avg_length Std Optimal_fieldtype +test.t1.f1 NULL NULL 0 0 0 1 0.0 0.0 CHAR(0) +SELECT * FROM t2 LIMIT 1 PROCEDURE ANALYSE(); +Field_name Min_value Max_value Min_length Max_length Empties_or_zeros Nulls Avg_value_or_avg_length Std Optimal_fieldtype +test.t2.f2 1 1 1 1 0 0 1.0000 0.0000 ENUM('1') NOT NULL +DROP TABLE t1, t2; End of 5.1 tests diff --git a/mysql-test/t/analyse.test b/mysql-test/t/analyse.test index 63929d8766b..c77967a0cc9 100644 --- a/mysql-test/t/analyse.test +++ b/mysql-test/t/analyse.test @@ -1,6 +1,7 @@ # # Test of procedure analyse # +-- source include/have_innodb.inc --disable_warnings drop table if exists t1,t2; @@ -144,4 +145,15 @@ INSERT INTO t1 VALUES ('e'),('e'),('e-'); SELECT * FROM t1 PROCEDURE ANALYSE(); DROP TABLE t1; +--echo # +--echo # Bug#11756242 48137: PROCEDURE ANALYSE() LEAKS MEMORY WHEN RETURNING NULL +--echo # + +CREATE TABLE t1(f1 INT) ENGINE=MYISAM; +CREATE TABLE t2(f2 INT) ENGINE=INNODB; +INSERT INTO t2 VALUES (1); +SELECT DISTINCTROW f1 FROM t1 NATURAL RIGHT OUTER JOIN t2 PROCEDURE ANALYSE(); +SELECT * FROM t2 LIMIT 1 PROCEDURE ANALYSE(); +DROP TABLE t1, t2; + --echo End of 5.1 tests diff --git a/sql/sql_select.cc b/sql/sql_select.cc index eb2559fc600..84a09fbc7e6 100644 --- a/sql/sql_select.cc +++ b/sql/sql_select.cc @@ -1929,7 +1929,11 @@ JOIN::exec() if (!curr_join->sort_and_group && curr_join->const_tables != curr_join->tables) curr_join->join_tab[curr_join->const_tables].sorted= 0; - if ((tmp_error= do_select(curr_join, (List *) 0, curr_tmp_table, 0))) + + Procedure *save_proc= curr_join->procedure; + tmp_error= do_select(curr_join, (List *) 0, curr_tmp_table, 0); + curr_join->procedure= save_proc; + if (tmp_error) { error= tmp_error; DBUG_VOID_RETURN; @@ -12354,10 +12358,14 @@ end_send(JOIN *join, JOIN_TAB *join_tab __attribute__((unused)), int error; if (join->having && join->having->val_int() == 0) DBUG_RETURN(NESTED_LOOP_OK); // Didn't match having - error=0; if (join->procedure) - error=join->procedure->send_row(join->procedure_fields_list); - else if (join->do_send_rows) + { + if (join->procedure->send_row(join->procedure_fields_list)) + DBUG_RETURN(NESTED_LOOP_ERROR); + DBUG_RETURN(NESTED_LOOP_OK); + } + error=0; + if (join->do_send_rows) error=join->result->send_data(*join->fields); if (error) DBUG_RETURN(NESTED_LOOP_ERROR); /* purecov: inspected */ From 7634e724e786a91aeb9b450818230629beb66228 Mon Sep 17 00:00:00 2001 From: Serge Kozlov Date: Thu, 14 Apr 2011 15:24:11 +0400 Subject: [PATCH 65/91] WL#5867, postfix for binlog_bug23533 --- mysql-test/suite/binlog/r/binlog_bug23533.result | 3 --- mysql-test/suite/binlog/t/binlog_bug23533.test | 1 - 2 files changed, 4 deletions(-) diff --git a/mysql-test/suite/binlog/r/binlog_bug23533.result b/mysql-test/suite/binlog/r/binlog_bug23533.result index 8a28867afb4..07b124793d1 100644 --- a/mysql-test/suite/binlog/r/binlog_bug23533.result +++ b/mysql-test/suite/binlog/r/binlog_bug23533.result @@ -3,9 +3,6 @@ CREATE TABLE t1 (a INT NOT NULL AUTO_INCREMENT, b TEXT, PRIMARY KEY(a)) ENGINE=I SELECT COUNT(*) FROM t1; COUNT(*) 1000 -SHOW VARIABLES LIKE 'max_binlog_cache_size'; -Variable_name Value -max_binlog_cache_size 4294963200 SET @saved_max_binlog_cache_size=@@max_binlog_cache_size; SET GLOBAL max_binlog_cache_size=4096; START TRANSACTION; diff --git a/mysql-test/suite/binlog/t/binlog_bug23533.test b/mysql-test/suite/binlog/t/binlog_bug23533.test index 3c9a7ab5896..fb2fc808b7b 100644 --- a/mysql-test/suite/binlog/t/binlog_bug23533.test +++ b/mysql-test/suite/binlog/t/binlog_bug23533.test @@ -22,7 +22,6 @@ while ($i) SELECT COUNT(*) FROM t1; # Set small value for max_binlog_cache_size -SHOW VARIABLES LIKE 'max_binlog_cache_size'; SET @saved_max_binlog_cache_size=@@max_binlog_cache_size; SET GLOBAL max_binlog_cache_size=4096; From e675ed063e890c4f442d61eaa6837119505449eb Mon Sep 17 00:00:00 2001 From: Bjorn Munch Date: Thu, 14 Apr 2011 16:17:58 +0200 Subject: [PATCH 66/91] Bug #12351213 MTR --VS-CONFIG DOES NOT WORK LIKE MTR_VS_CONFIG Fix for --vs-config applied Find.pm incorrectly tested an unitialized local variable instead of the global, corrected. Find.pm is also wrong in 5.5: uses a non-existent global variable. Fix when merging up. --- mysql-test/lib/My/Find.pm | 6 ++---- mysql-test/mysql-test-run.pl | 4 ++-- 2 files changed, 4 insertions(+), 6 deletions(-) diff --git a/mysql-test/lib/My/Find.pm b/mysql-test/lib/My/Find.pm index 9c89a7e4e2a..8cbd6db3201 100644 --- a/mysql-test/lib/My/Find.pm +++ b/mysql-test/lib/My/Find.pm @@ -1,5 +1,5 @@ # -*- cperl -*- -# Copyright (C) 2008 MySQL AB +# Copyright (c) 2004, 2011, Oracle and/or its affiliates. All rights reserved. # # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by @@ -28,8 +28,6 @@ use My::Platform; use base qw(Exporter); our @EXPORT= qw(my_find_bin my_find_dir my_find_file NOT_REQUIRED); -our $vs_config_dir; - my $bin_extension= ".exe" if IS_WINDOWS; # Helper function to be used for fourth parameter to find functions @@ -158,7 +156,7 @@ sub my_find_paths { # User can select to look in a special build dir # which is a subdirectory of any of the paths my @extra_dirs; - my $build_dir= $vs_config_dir || $ENV{MTR_VS_CONFIG} || $ENV{MTR_BUILD_DIR}; + my $build_dir= $::opt_vs_config || $ENV{MTR_VS_CONFIG} || $ENV{MTR_BUILD_DIR}; push(@extra_dirs, $build_dir) if defined $build_dir; if (defined $extension){ diff --git a/mysql-test/mysql-test-run.pl b/mysql-test/mysql-test-run.pl index 2301b2444d3..9b8b1dc67cf 100755 --- a/mysql-test/mysql-test-run.pl +++ b/mysql-test/mysql-test-run.pl @@ -1,7 +1,7 @@ #!/usr/bin/perl # -*- cperl -*- -# Copyright (c) 2004, 2010, Oracle and/or its affiliates. All rights reserved. +# Copyright (c) 2004, 2011, Oracle and/or its affiliates. All rights reserved. # # This program is free software; you can redistribute it and/or # modify it under the terms of the GNU Library General Public @@ -893,7 +893,7 @@ sub command_line_setup { 'ssl|with-openssl' => \$opt_ssl, 'skip-ssl' => \$opt_skip_ssl, 'compress' => \$opt_compress, - 'vs-config' => \$opt_vs_config, + 'vs-config=s' => \$opt_vs_config, # Max number of parallel threads to use 'parallel=s' => \$opt_parallel, From dd3d9477b25b546407e18b4b474e766db1709aa7 Mon Sep 17 00:00:00 2001 From: Tor Didriksen Date: Thu, 14 Apr 2011 16:35:24 +0200 Subject: [PATCH 67/91] Bug#11765713 58705: OPTIMIZER LET ENGINE DEPEND ON UNINITIALIZED VALUES CREATED BY OPT_SUM_QU Valgrind warnings were caused by comparing index values to an un-initialized field. mysql-test/r/subselect.result: New test cases. mysql-test/t/subselect.test: New test cases. sql/opt_sum.cc: Add thd to opt_sum_query enabling it to test for errors. If we have a non-nullable index, we cannot use it to match null values, since set_null() will be ignored, and we might compare uninitialized data. sql/sql_select.cc: Add thd to opt_sum_query, enabling it to test for errors. sql/sql_select.h: Add thd to opt_sum_query, enabling it to test for errors. --- mysql-test/r/subselect.result | 18 +++++++++++++++ mysql-test/t/subselect.test | 22 ++++++++++++++++++ sql/opt_sum.cc | 43 +++++++++++++++++++++++++---------- sql/sql_select.cc | 2 +- sql/sql_select.h | 3 ++- 5 files changed, 74 insertions(+), 14 deletions(-) diff --git a/mysql-test/r/subselect.result b/mysql-test/r/subselect.result index dc40e42275b..5f86b0db132 100644 --- a/mysql-test/r/subselect.result +++ b/mysql-test/r/subselect.result @@ -4734,3 +4734,21 @@ SELECT * FROM t2 UNION SELECT * FROM t2 ORDER BY (SELECT * FROM t1 WHERE MATCH(a) AGAINST ('+abc' IN BOOLEAN MODE)); DROP TABLE t1,t2; End of 5.1 tests +# +# Bug #11765713 58705: +# OPTIMIZER LET ENGINE DEPEND ON UNINITIALIZED VALUES +# CREATED BY OPT_SUM_QUERY +# +CREATE TABLE t1(a INT NOT NULL, KEY (a)); +INSERT INTO t1 VALUES (0), (1); +SELECT 1 as foo FROM t1 WHERE a < SOME +(SELECT a FROM t1 WHERE a <=> +(SELECT a FROM t1) +); +ERROR 21000: Subquery returns more than 1 row +SELECT 1 as foo FROM t1 WHERE a < SOME +(SELECT a FROM t1 WHERE a <=> +(SELECT a FROM t1 where a is null) +); +foo +DROP TABLE t1; diff --git a/mysql-test/t/subselect.test b/mysql-test/t/subselect.test index 1f471b46c4e..94a3df21998 100644 --- a/mysql-test/t/subselect.test +++ b/mysql-test/t/subselect.test @@ -3726,3 +3726,25 @@ DROP TABLE t1,t2; --enable_result_log --echo End of 5.1 tests + +--echo # +--echo # Bug #11765713 58705: +--echo # OPTIMIZER LET ENGINE DEPEND ON UNINITIALIZED VALUES +--echo # CREATED BY OPT_SUM_QUERY +--echo # + +CREATE TABLE t1(a INT NOT NULL, KEY (a)); +INSERT INTO t1 VALUES (0), (1); + +--error ER_SUBQUERY_NO_1_ROW +SELECT 1 as foo FROM t1 WHERE a < SOME + (SELECT a FROM t1 WHERE a <=> + (SELECT a FROM t1) + ); + +SELECT 1 as foo FROM t1 WHERE a < SOME + (SELECT a FROM t1 WHERE a <=> + (SELECT a FROM t1 where a is null) + ); + +DROP TABLE t1; diff --git a/sql/opt_sum.cc b/sql/opt_sum.cc index b20a0c4fcbe..1eef3798908 100644 --- a/sql/opt_sum.cc +++ b/sql/opt_sum.cc @@ -211,6 +211,7 @@ static int get_index_max_value(TABLE *table, TABLE_REF *ref, uint range_fl) /** Substitutes constants for some COUNT(), MIN() and MAX() functions. + @param thd thread handler @param tables list of leaves of join table tree @param all_fields All fields to be returned @param conds WHERE clause @@ -228,9 +229,12 @@ static int get_index_max_value(TABLE *table, TABLE_REF *ref, uint range_fl) HA_ERR_KEY_NOT_FOUND on impossible conditions @retval HA_ERR_... if a deadlock or a lock wait timeout happens, for example + @retval + ER_... e.g. ER_SUBQUERY_NO_1_ROW */ -int opt_sum_query(TABLE_LIST *tables, List &all_fields,COND *conds) +int opt_sum_query(THD *thd, + TABLE_LIST *tables, List &all_fields, COND *conds) { List_iterator_fast it(all_fields); int const_result= 1; @@ -242,6 +246,8 @@ int opt_sum_query(TABLE_LIST *tables, List &all_fields,COND *conds) Item *item; int error; + DBUG_ENTER("opt_sum_query"); + if (conds) where_tables= conds->used_tables(); @@ -269,7 +275,7 @@ int opt_sum_query(TABLE_LIST *tables, List &all_fields,COND *conds) WHERE t2.field IS NULL; */ if (tl->table->map & where_tables) - return 0; + DBUG_RETURN(0); } else used_tables|= tl->table->map; @@ -297,7 +303,7 @@ int opt_sum_query(TABLE_LIST *tables, List &all_fields,COND *conds) { tl->table->file->print_error(error, MYF(0)); tl->table->in_use->fatal_error(); - return error; + DBUG_RETURN(error); } count*= tl->table->file->stats.records; } @@ -390,10 +396,10 @@ int opt_sum_query(TABLE_LIST *tables, List &all_fields,COND *conds) if (error) { if (error == HA_ERR_KEY_NOT_FOUND || error == HA_ERR_END_OF_FILE) - return HA_ERR_KEY_NOT_FOUND; // No rows matching WHERE + DBUG_RETURN(HA_ERR_KEY_NOT_FOUND); // No rows matching WHERE /* HA_ERR_LOCK_DEADLOCK or some other error */ table->file->print_error(error, MYF(0)); - return(error); + DBUG_RETURN(error); } removed_tables|= table->map; } @@ -437,6 +443,10 @@ int opt_sum_query(TABLE_LIST *tables, List &all_fields,COND *conds) const_result= 0; } } + + if (thd->is_error()) + DBUG_RETURN(thd->main_da.sql_errno()); + /* If we have a where clause, we can only ignore searching in the tables if MIN/MAX optimisation replaced all used tables @@ -446,7 +456,7 @@ int opt_sum_query(TABLE_LIST *tables, List &all_fields,COND *conds) */ if (removed_tables && used_tables != removed_tables) const_result= 0; // We didn't remove all tables - return const_result; + DBUG_RETURN(const_result); } @@ -732,6 +742,12 @@ static bool matching_cond(bool max_fl, TABLE_REF *ref, KEY *keyinfo, if (is_null || (is_null_safe_eq && args[1]->is_null())) { + /* + If we have a non-nullable index, we cannot use it, + since set_null will be ignored, and we will compare uninitialized data. + */ + if (!part->field->real_maybe_null()) + DBUG_RETURN(false); part->field->set_null(); *key_ptr= (uchar) 1; } @@ -802,8 +818,9 @@ static bool matching_cond(bool max_fl, TABLE_REF *ref, KEY *keyinfo, @param[out] prefix_len Length of prefix for the search range @note - This function may set table->key_read to 1, which must be reset after - index is used! (This can only happen when function returns 1) + This function may set field->table->key_read to true, + which must be reset after index is used! + (This can only happen when function returns 1) @retval 0 Index can not be used to optimize MIN(field)/MAX(field) @@ -818,7 +835,9 @@ static bool find_key_for_maxmin(bool max_fl, TABLE_REF *ref, uint *range_fl, uint *prefix_len) { if (!(field->flags & PART_KEY_FLAG)) - return 0; // Not key field + return false; // Not key field + + DBUG_ENTER("find_key_for_maxmin"); TABLE *table= field->table; uint idx= 0; @@ -843,7 +862,7 @@ static bool find_key_for_maxmin(bool max_fl, TABLE_REF *ref, part++, jdx++, key_part_to_use= (key_part_to_use << 1) | 1) { if (!(table->file->index_flags(idx, jdx, 0) & HA_READ_ORDER)) - return 0; + DBUG_RETURN(false); /* Check whether the index component is partial */ Field *part_field= table->field[part->fieldnr-1]; @@ -892,12 +911,12 @@ static bool find_key_for_maxmin(bool max_fl, TABLE_REF *ref, */ if (field->part_of_key.is_set(idx)) table->set_keyread(TRUE); - return 1; + DBUG_RETURN(true); } } } } - return 0; + DBUG_RETURN(false); } diff --git a/sql/sql_select.cc b/sql/sql_select.cc index 84a09fbc7e6..ab287e57aa1 100644 --- a/sql/sql_select.cc +++ b/sql/sql_select.cc @@ -961,7 +961,7 @@ JOIN::optimize() If all items were resolved by opt_sum_query, there is no need to open any tables. */ - if ((res=opt_sum_query(select_lex->leaf_tables, all_fields, conds))) + if ((res=opt_sum_query(thd, select_lex->leaf_tables, all_fields, conds))) { if (res == HA_ERR_KEY_NOT_FOUND) { diff --git a/sql/sql_select.h b/sql/sql_select.h index 5350e28d8ff..dd810ae5156 100644 --- a/sql/sql_select.h +++ b/sql/sql_select.h @@ -612,7 +612,8 @@ Field* create_tmp_field_from_field(THD *thd, Field* org_field, /* functions from opt_sum.cc */ bool simple_pred(Item_func *func_item, Item **args, bool *inv_order); -int opt_sum_query(TABLE_LIST *tables, List &all_fields,COND *conds); +int opt_sum_query(THD* thd, + TABLE_LIST *tables, List &all_fields, COND *conds); /* from sql_delete.cc, used by opt_range.cc */ extern "C" int refpos_order_cmp(void* arg, const void *a,const void *b); From c95227ca54c291d372e1136d52a0ecc9eb0294cf Mon Sep 17 00:00:00 2001 From: Bjorn Munch Date: Fri, 15 Apr 2011 10:30:52 +0200 Subject: [PATCH 68/91] Bug #12360195 MTR DOES NOT IGNORE TABS IN EXPERIMENTAL FILE Instead of just filtering space, filter white space (\s) I left the default.experimental file as is, with tabs. --- mysql-test/mysql-test-run.pl | 6 +++--- 1 file changed, 3 insertions(+), 3 deletions(-) diff --git a/mysql-test/mysql-test-run.pl b/mysql-test/mysql-test-run.pl index 9b8b1dc67cf..2897ae3142a 100755 --- a/mysql-test/mysql-test-run.pl +++ b/mysql-test/mysql-test-run.pl @@ -1123,7 +1123,7 @@ sub command_line_setup { chomp; # remove comments (# foo) at the beginning of the line, or after a # blank at the end of the line - s/( +|^)#.*$//; + s/(\s+|^)#.*$//; # If @ platform specifier given, use this entry only if it contains # @ or @! where xxx != platform if (/\@.*/) @@ -1134,8 +1134,8 @@ sub command_line_setup { s/\@.*$//; } # remove whitespace - s/^ +//; - s/ +$//; + s/^\s+//; + s/\s+$//; # if nothing left, don't need to remember this line if ( $_ eq "" ) { next; From bba7b9ca0c96a1c140e725776b5e0382a4f62152 Mon Sep 17 00:00:00 2001 From: Sergey Glukhov Date: Fri, 15 Apr 2011 12:51:34 +0400 Subject: [PATCH 69/91] Bug#11765139 58069: LOAD DATA INFILE: VALGRIND REPORTS INVALID MEMORY READS AND WRITES WITH U Some multibyte sequences could be considered by my_mbcharlen() functions as multibyte character but more exact my_ismbchar() does not think so. In such a case this multibyte sequences is pushed into 'stack' buffer which is too small to accommodate the sequence. The fix is to allocate stack buffer in compliance with max character length. mysql-test/r/loaddata.result: test case mysql-test/t/loaddata.test: test case sql/sql_load.cc: allocate stack buffer in compliance with max character length. --- mysql-test/r/loaddata.result | 7 +++++++ mysql-test/t/loaddata.test | 13 +++++++++++++ sql/sql_load.cc | 2 +- 3 files changed, 21 insertions(+), 1 deletion(-) diff --git a/mysql-test/r/loaddata.result b/mysql-test/r/loaddata.result index 40c278380b1..3a421b3ea3f 100644 --- a/mysql-test/r/loaddata.result +++ b/mysql-test/r/loaddata.result @@ -532,4 +532,11 @@ a 0 1 DROP TABLE t1; +# +# Bug#11765139 58069: LOAD DATA INFILE: VALGRIND REPORTS INVALID MEMORY READS AND WRITES WITH U +# +CREATE TABLE t1(f1 INT); +SELECT 0xE1BB30 INTO OUTFILE 't1.dat'; +LOAD DATA INFILE 't1.dat' IGNORE INTO TABLE t1 CHARACTER SET utf8; +DROP TABLE t1; End of 5.1 tests diff --git a/mysql-test/t/loaddata.test b/mysql-test/t/loaddata.test index 821453777f5..e0764b67ec0 100644 --- a/mysql-test/t/loaddata.test +++ b/mysql-test/t/loaddata.test @@ -611,5 +611,18 @@ DROP TABLE t1; let $MYSQLD_DATADIR= `select @@datadir`; remove_file $MYSQLD_DATADIR/test/tmpp2.txt; +--echo # +--echo # Bug#11765139 58069: LOAD DATA INFILE: VALGRIND REPORTS INVALID MEMORY READS AND WRITES WITH U +--echo # + +CREATE TABLE t1(f1 INT); +EVAL SELECT 0xE1BB30 INTO OUTFILE 't1.dat'; +--disable_warnings +LOAD DATA INFILE 't1.dat' IGNORE INTO TABLE t1 CHARACTER SET utf8; +--enable_warnings + +DROP TABLE t1; +let $MYSQLD_DATADIR= `select @@datadir`; +remove_file $MYSQLD_DATADIR/test/t1.dat; --echo End of 5.1 tests diff --git a/sql/sql_load.cc b/sql/sql_load.cc index c227fe69b62..513cd62b510 100644 --- a/sql/sql_load.cc +++ b/sql/sql_load.cc @@ -1109,7 +1109,7 @@ READ_INFO::READ_INFO(File file_par, uint tot_length, CHARSET_INFO *cs, /* Set of a stack for unget if long terminators */ - uint length=max(field_term_length,line_term_length)+1; + uint length= max(cs->mbmaxlen, max(field_term_length, line_term_length)) + 1; set_if_bigger(length,line_start.length()); stack=stack_pos=(int*) sql_alloc(sizeof(int)*length); From 8dabe8aa92bb825d2bd2a78d2cb5ca30782576be Mon Sep 17 00:00:00 2001 From: Martin Hansson Date: Mon, 18 Apr 2011 10:44:41 +0200 Subject: [PATCH 70/91] Bug 11758558 - 50774: WRONG RESULTSET WHEN TIMESTAMP VALUES ARE APPENDED WITH .0 The bug was fixed by the patch for bug number BUG 11763109 - 55779: SELECT DOES NOT WORK PROPERLY IN MYSQL SERVER VERSION "5.1.42 SUSE MYSQL (Exact same fix as was proposed for this bug.) Since the motivation for the two bug reports was completely different, however, it still makes sense to push the test case. This patch contains only the test case. --- mysql-test/r/type_timestamp.result | 63 ++++++++++++++++++++++++++++++ mysql-test/t/type_timestamp.test | 47 ++++++++++++++++++++++ 2 files changed, 110 insertions(+) diff --git a/mysql-test/r/type_timestamp.result b/mysql-test/r/type_timestamp.result index e88d3462466..3176879343c 100644 --- a/mysql-test/r/type_timestamp.result +++ b/mysql-test/r/type_timestamp.result @@ -547,4 +547,67 @@ a 2000-01-01 00:00:01 2000-01-01 00:00:01 DROP TABLE t1; +# +# Bug#50774: failed to get the correct resultset when timestamp values +# are appended with .0 +# +CREATE TABLE t1 ( a TIMESTAMP, KEY ( a ) ); +INSERT INTO t1 VALUES( '2010-02-01 09:31:01' ); +INSERT INTO t1 VALUES( '2010-02-01 09:31:02' ); +INSERT INTO t1 VALUES( '2010-02-01 09:31:03' ); +INSERT INTO t1 VALUES( '2010-02-01 09:31:04' ); +SELECT * FROM t1 WHERE a >= '2010-02-01 09:31:02.0'; +a +2010-02-01 09:31:02 +2010-02-01 09:31:03 +2010-02-01 09:31:04 +SELECT * FROM t1 WHERE '2010-02-01 09:31:02.0' <= a; +a +2010-02-01 09:31:02 +2010-02-01 09:31:03 +2010-02-01 09:31:04 +SELECT * FROM t1 WHERE a <= '2010-02-01 09:31:02.0'; +a +2010-02-01 09:31:01 +2010-02-01 09:31:02 +SELECT * FROM t1 WHERE '2010-02-01 09:31:02.0' >= a; +a +2010-02-01 09:31:01 +2010-02-01 09:31:02 +EXPLAIN +SELECT * FROM t1 WHERE a >= '2010-02-01 09:31:02.0'; +id select_type table type possible_keys key key_len ref rows Extra +x x x range x x x x x x +SELECT * FROM t1 WHERE a >= '2010-02-01 09:31:02.0'; +a +2010-02-01 09:31:02 +2010-02-01 09:31:03 +2010-02-01 09:31:04 +CREATE TABLE t2 ( a TIMESTAMP, KEY ( a DESC ) ); +INSERT INTO t2 VALUES( '2010-02-01 09:31:01' ); +INSERT INTO t2 VALUES( '2010-02-01 09:31:02' ); +INSERT INTO t2 VALUES( '2010-02-01 09:31:03' ); +INSERT INTO t2 VALUES( '2010-02-01 09:31:04' ); +INSERT INTO t2 VALUES( '2010-02-01 09:31:05' ); +INSERT INTO t2 VALUES( '2010-02-01 09:31:06' ); +INSERT INTO t2 VALUES( '2010-02-01 09:31:07' ); +INSERT INTO t2 VALUES( '2010-02-01 09:31:08' ); +INSERT INTO t2 VALUES( '2010-02-01 09:31:09' ); +INSERT INTO t2 VALUES( '2010-02-01 09:31:10' ); +INSERT INTO t2 VALUES( '2010-02-01 09:31:11' ); +# The bug would cause the range optimizer's comparison to use an open +# interval here. This reveals itself only in the number of reads +# performed. +FLUSH STATUS; +EXPLAIN +SELECT * FROM t2 WHERE a < '2010-02-01 09:31:02.0'; +id select_type table type possible_keys key key_len ref rows Extra +x x x range x x x x x x +SELECT * FROM t2 WHERE a < '2010-02-01 09:31:02.0'; +a +2010-02-01 09:31:01 +SHOW STATUS LIKE 'Handler_read_next'; +Variable_name Value +Handler_read_next 1 +DROP TABLE t1, t2; End of 5.1 tests diff --git a/mysql-test/t/type_timestamp.test b/mysql-test/t/type_timestamp.test index 602f6f089c2..53b45fc6732 100644 --- a/mysql-test/t/type_timestamp.test +++ b/mysql-test/t/type_timestamp.test @@ -373,4 +373,51 @@ SELECT a FROM t1 WHERE a >= '20000101000000'; DROP TABLE t1; +--echo # +--echo # Bug#50774: failed to get the correct resultset when timestamp values +--echo # are appended with .0 +--echo # +CREATE TABLE t1 ( a TIMESTAMP, KEY ( a ) ); + +INSERT INTO t1 VALUES( '2010-02-01 09:31:01' ); +INSERT INTO t1 VALUES( '2010-02-01 09:31:02' ); +INSERT INTO t1 VALUES( '2010-02-01 09:31:03' ); +INSERT INTO t1 VALUES( '2010-02-01 09:31:04' ); + +SELECT * FROM t1 WHERE a >= '2010-02-01 09:31:02.0'; +SELECT * FROM t1 WHERE '2010-02-01 09:31:02.0' <= a; +SELECT * FROM t1 WHERE a <= '2010-02-01 09:31:02.0'; +SELECT * FROM t1 WHERE '2010-02-01 09:31:02.0' >= a; + +--replace_column 1 x 2 x 3 x 5 x 6 x 7 x 8 x 9 x 10 x +EXPLAIN +SELECT * FROM t1 WHERE a >= '2010-02-01 09:31:02.0'; +SELECT * FROM t1 WHERE a >= '2010-02-01 09:31:02.0'; + +CREATE TABLE t2 ( a TIMESTAMP, KEY ( a DESC ) ); + +INSERT INTO t2 VALUES( '2010-02-01 09:31:01' ); +INSERT INTO t2 VALUES( '2010-02-01 09:31:02' ); +INSERT INTO t2 VALUES( '2010-02-01 09:31:03' ); +INSERT INTO t2 VALUES( '2010-02-01 09:31:04' ); +INSERT INTO t2 VALUES( '2010-02-01 09:31:05' ); +INSERT INTO t2 VALUES( '2010-02-01 09:31:06' ); +INSERT INTO t2 VALUES( '2010-02-01 09:31:07' ); +INSERT INTO t2 VALUES( '2010-02-01 09:31:08' ); +INSERT INTO t2 VALUES( '2010-02-01 09:31:09' ); +INSERT INTO t2 VALUES( '2010-02-01 09:31:10' ); +INSERT INTO t2 VALUES( '2010-02-01 09:31:11' ); + +--echo # The bug would cause the range optimizer's comparison to use an open +--echo # interval here. This reveals itself only in the number of reads +--echo # performed. +FLUSH STATUS; +--replace_column 1 x 2 x 3 x 5 x 6 x 7 x 8 x 9 x 10 x +EXPLAIN +SELECT * FROM t2 WHERE a < '2010-02-01 09:31:02.0'; +SELECT * FROM t2 WHERE a < '2010-02-01 09:31:02.0'; +SHOW STATUS LIKE 'Handler_read_next'; + +DROP TABLE t1, t2; + --echo End of 5.1 tests From 7b1967ad4e4eff38e3f7119ff53db49b5bdc3fa8 Mon Sep 17 00:00:00 2001 From: Sven Sandberg Date: Mon, 18 Apr 2011 14:42:14 +0200 Subject: [PATCH 71/91] test fails on more platforms, removed @freebsd from default.experimental. --- mysql-test/collections/default.experimental | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) diff --git a/mysql-test/collections/default.experimental b/mysql-test/collections/default.experimental index 72e14135ef0..9e74fa9bc30 100644 --- a/mysql-test/collections/default.experimental +++ b/mysql-test/collections/default.experimental @@ -26,7 +26,7 @@ ndb.* # joro : NDB tests marked as experiment rpl.rpl_innodb_bug28430 @solaris # Bug#46029 rpl.rpl_row_sp011 @solaris # Joro : Bug #45445 -rpl.rpl_stop_slave @freebsd # Sven : BUG#12345981 +rpl.rpl_stop_slave # Sven : BUG#12345981 rpl.rpl_bug37426 # WL#5867: skozlov: test case moved from unused bugs suite From 060df92b2ff9afae08f0da9da807777e07d404c3 Mon Sep 17 00:00:00 2001 From: Bjorn Munch Date: Mon, 18 Apr 2011 15:35:14 +0200 Subject: [PATCH 72/91] Bug #12365486 MTR FAILS TO FIND WARNINGS IN SERVER LOG WITH --VALGRIND COMBINED WITH --DEBUG With this combination, outoput was directed to .trace but not all parts of MTR was aware of this. Replace .err with .trace at the earliest possible place --- mysql-test/lib/My/ConfigFactory.pm | 8 ++++++-- mysql-test/mysql-test-run.pl | 9 +-------- 2 files changed, 7 insertions(+), 10 deletions(-) diff --git a/mysql-test/lib/My/ConfigFactory.pm b/mysql-test/lib/My/ConfigFactory.pm index bb990a9f8d2..7688283fdc1 100644 --- a/mysql-test/lib/My/ConfigFactory.pm +++ b/mysql-test/lib/My/ConfigFactory.pm @@ -1,5 +1,5 @@ # -*- cperl -*- -# Copyright (c) 2008, 2010, Oracle and/or its affiliates. All rights reserved. +# Copyright (c) 2008, 2011, Oracle and/or its affiliates. All rights reserved. # # This program is free software; you can redistribute it and/or # modify it under the terms of the GNU Library General Public @@ -141,7 +141,11 @@ sub fix_tmpdir { sub fix_log_error { my ($self, $config, $group_name, $group)= @_; my $dir= $self->{ARGS}->{vardir}; - return "$dir/log/$group_name.err"; + if ( $::opt_valgrind and $::opt_debug ) { + return "$dir/log/$group_name.trace"; + } else { + return "$dir/log/$group_name.err"; + } } sub fix_log { diff --git a/mysql-test/mysql-test-run.pl b/mysql-test/mysql-test-run.pl index 2897ae3142a..1c7efccc69d 100755 --- a/mysql-test/mysql-test-run.pl +++ b/mysql-test/mysql-test-run.pl @@ -256,7 +256,7 @@ my $opt_strace_client; our $opt_user = "root"; -my $opt_valgrind= 0; +our $opt_valgrind= 0; my $opt_valgrind_mysqld= 0; my $opt_valgrind_mysqltest= 0; my @default_valgrind_args= ("--show-reachable=yes"); @@ -4544,13 +4544,6 @@ sub mysqld_start ($$) { unlink($mysqld->value('pid-file')); my $output= $mysqld->value('#log-error'); - if ( $opt_valgrind and $opt_debug ) - { - # When both --valgrind and --debug is selected, send - # all output to the trace file, making it possible to - # see the exact location where valgrind complains - $output= "$opt_vardir/log/".$mysqld->name().".trace"; - } # Remember this log file for valgrind error report search $mysqld_logs{$output}= 1 if $opt_valgrind; # Remember data dir for gmon.out files if using gprof From dba184237a2504c880ed08e34e91e40a76f738e7 Mon Sep 17 00:00:00 2001 From: Serge Kozlov Date: Mon, 18 Apr 2011 23:59:15 +0400 Subject: [PATCH 73/91] BUG#12371924 Update test case --- mysql-test/collections/default.experimental | 5 +---- mysql-test/suite/binlog/r/binlog_bug23533.result | 3 +++ mysql-test/suite/binlog/t/binlog_bug23533.test | 5 +++++ 3 files changed, 9 insertions(+), 4 deletions(-) diff --git a/mysql-test/collections/default.experimental b/mysql-test/collections/default.experimental index 9e74fa9bc30..fb8c6845a5f 100644 --- a/mysql-test/collections/default.experimental +++ b/mysql-test/collections/default.experimental @@ -2,8 +2,7 @@ # in alphabetical order. This also helps with merge conflict resolution. binlog.binlog_multi_engine # joro : NDB tests marked as experimental as agreed with bochklin -binlog.binlog_bug23533 # WL#5867: skozlov: test case moved from unused bugs suite -binlog.binlog_bug36391 # WL#5867: skozlov: test case moved from unused bugs suite +binlog.binlog_bug23533 # skozlov: BUG#12371924 funcs_1.charset_collation_1 # depends on compile-time decisions @@ -27,8 +26,6 @@ ndb.* # joro : NDB tests marked as experiment rpl.rpl_innodb_bug28430 @solaris # Bug#46029 rpl.rpl_row_sp011 @solaris # Joro : Bug #45445 rpl.rpl_stop_slave # Sven : BUG#12345981 -rpl.rpl_bug37426 # WL#5867: skozlov: test case moved from unused bugs suite - rpl_ndb.* # joro : NDB tests marked as experimental as agreed with bochklin rpl_ndb.rpl_ndb_log # Bug#38998 diff --git a/mysql-test/suite/binlog/r/binlog_bug23533.result b/mysql-test/suite/binlog/r/binlog_bug23533.result index 07b124793d1..02605839ab0 100644 --- a/mysql-test/suite/binlog/r/binlog_bug23533.result +++ b/mysql-test/suite/binlog/r/binlog_bug23533.result @@ -3,7 +3,9 @@ CREATE TABLE t1 (a INT NOT NULL AUTO_INCREMENT, b TEXT, PRIMARY KEY(a)) ENGINE=I SELECT COUNT(*) FROM t1; COUNT(*) 1000 +SET @saved_binlog_cache_size=@@binlog_cache_size; SET @saved_max_binlog_cache_size=@@max_binlog_cache_size; +SET GLOBAL binlog_cache_size=4096; SET GLOBAL max_binlog_cache_size=4096; START TRANSACTION; CREATE TABLE t2 SELECT * FROM t1; @@ -13,4 +15,5 @@ SHOW TABLES LIKE 't%'; Tables_in_test (t%) t1 SET GLOBAL max_binlog_cache_size=@saved_max_binlog_cache_size; +SET GLOBAL binlog_cache_size=@saved_binlog_cache_size; DROP TABLE t1; diff --git a/mysql-test/suite/binlog/t/binlog_bug23533.test b/mysql-test/suite/binlog/t/binlog_bug23533.test index fb2fc808b7b..05fe9fd9523 100644 --- a/mysql-test/suite/binlog/t/binlog_bug23533.test +++ b/mysql-test/suite/binlog/t/binlog_bug23533.test @@ -15,14 +15,18 @@ CREATE TABLE t1 (a INT NOT NULL AUTO_INCREMENT, b TEXT, PRIMARY KEY(a)) ENGINE=I let $i= 1000; while ($i) { + BEGIN; eval INSERT INTO t1 VALUES($i, REPEAT('x', 4096)); + COMMIT; dec $i; } --enable_query_log SELECT COUNT(*) FROM t1; # Set small value for max_binlog_cache_size +SET @saved_binlog_cache_size=@@binlog_cache_size; SET @saved_max_binlog_cache_size=@@max_binlog_cache_size; +SET GLOBAL binlog_cache_size=4096; SET GLOBAL max_binlog_cache_size=4096; # Copied data from t1 into t2 large than max_binlog_cache_size @@ -34,4 +38,5 @@ SHOW TABLES LIKE 't%'; # 5.1 End of Test SET GLOBAL max_binlog_cache_size=@saved_max_binlog_cache_size; +SET GLOBAL binlog_cache_size=@saved_binlog_cache_size; DROP TABLE t1; From 90bbf9d615a592c31464c1a689040a9758581fdd Mon Sep 17 00:00:00 2001 From: Sergey Glukhov Date: Wed, 20 Apr 2011 11:39:20 +0400 Subject: [PATCH 74/91] Bug#11765923 58937: MANY VALGRIND ERRORS AFTER GROUPING BY RESULT OF DECIMAL COLUMN FUNCTION Bug#11764671 57533: UNINITIALISED VALUES IN COPY_AND_CONVERT (SQL_STRING.CC) WITH CERTAIN CHA When ROUND evaluates decimal result it uses Item::decimal value as fraction value for the result. In some cases Item::decimal is greater than real result fraction value and uninitialised memory of result(decimal) buffer can be used in further calculations. Issue is introduced by Bug33143 fix. The fix is to remove erroneous assignment. mysql-test/r/func_math.result: test case mysql-test/t/func_math.test: test case sql/item_func.cc: remove erroneous assignment --- mysql-test/r/func_math.result | 22 ++++++++++++++++++++++ mysql-test/t/func_math.test | 16 ++++++++++++++++ sql/item_func.cc | 3 --- 3 files changed, 38 insertions(+), 3 deletions(-) diff --git a/mysql-test/r/func_math.result b/mysql-test/r/func_math.result index ad0b872145b..b9118feab1a 100644 --- a/mysql-test/r/func_math.result +++ b/mysql-test/r/func_math.result @@ -518,4 +518,26 @@ CREATE TABLE t1 SELECT CEIL(LINESTRINGFROMWKB(1) DIV NULL); DROP TABLE t1; CREATE TABLE t1 SELECT FLOOR(LINESTRINGFROMWKB(1) DIV NULL); DROP TABLE t1; +# +# Bug#11765923 58937: MANY VALGRIND ERRORS AFTER GROUPING BY RESULT OF DECIMAL COLUMN FUNCTION +# +CREATE TABLE t1(f1 DECIMAL(22,1)); +INSERT INTO t1 VALUES (0),(1); +SELECT ROUND(f1, f1) FROM t1; +ROUND(f1, f1) +0.0 +1.0 +SELECT ROUND(f1, f1) FROM t1 GROUP BY 1; +ROUND(f1, f1) +0.0 +1.0 +DROP TABLE t1; +# +# Bug#11764671 57533: UNINITIALISED VALUES IN COPY_AND_CONVERT (SQL_STRING.CC) WITH CERTAIN CHA +# +SELECT ROUND(LEAST(15, -4939092, 0.2704), STDDEV('a')); +ROUND(LEAST(15, -4939092, 0.2704), STDDEV('a')) +-4939092.0000 +Warnings: +Warning 1292 Truncated incorrect DOUBLE value: 'a' End of 5.1 tests diff --git a/mysql-test/t/func_math.test b/mysql-test/t/func_math.test index 64b6a3a4ea6..9d51a5c94f9 100644 --- a/mysql-test/t/func_math.test +++ b/mysql-test/t/func_math.test @@ -333,4 +333,20 @@ DROP TABLE t1; CREATE TABLE t1 SELECT FLOOR(LINESTRINGFROMWKB(1) DIV NULL); DROP TABLE t1; +--echo # +--echo # Bug#11765923 58937: MANY VALGRIND ERRORS AFTER GROUPING BY RESULT OF DECIMAL COLUMN FUNCTION +--echo # + +CREATE TABLE t1(f1 DECIMAL(22,1)); +INSERT INTO t1 VALUES (0),(1); +SELECT ROUND(f1, f1) FROM t1; +SELECT ROUND(f1, f1) FROM t1 GROUP BY 1; +DROP TABLE t1; + +--echo # +--echo # Bug#11764671 57533: UNINITIALISED VALUES IN COPY_AND_CONVERT (SQL_STRING.CC) WITH CERTAIN CHA +--echo # + +SELECT ROUND(LEAST(15, -4939092, 0.2704), STDDEV('a')); + --echo End of 5.1 tests diff --git a/sql/item_func.cc b/sql/item_func.cc index 595629b51be..6a9c47954b7 100644 --- a/sql/item_func.cc +++ b/sql/item_func.cc @@ -2122,10 +2122,7 @@ my_decimal *Item_func_round::decimal_op(my_decimal *decimal_value) if (!(null_value= (args[0]->null_value || args[1]->null_value || my_decimal_round(E_DEC_FATAL_ERROR, value, (int) dec, truncate, decimal_value) > 1))) - { - decimal_value->frac= decimals; return decimal_value; - } return 0; } From f3b024cafa4c316774c8122031a1bbbc08a83379 Mon Sep 17 00:00:00 2001 From: Jon Olav Hauglid Date: Wed, 20 Apr 2011 11:32:28 +0200 Subject: [PATCH 75/91] BUG#12377872 ASSERTION FAILED: !_ENTERED WHEN GETHOSTBYADDR_R FAILS ON SOLARIS This assertion was triggered if gethostbyaddr_r cannot do a reverse lookup on an ip address. The reason was a missing DBUG_RETURN macro. The problem affected only debug versions of the server. This patch fixes the problem by replacing return with DBUG_RETURN. No test case added. --- sql/hostname.cc | 4 ++-- 1 file changed, 2 insertions(+), 2 deletions(-) diff --git a/sql/hostname.cc b/sql/hostname.cc index c8cf46383a9..9796755e9fb 100644 --- a/sql/hostname.cc +++ b/sql/hostname.cc @@ -1,4 +1,4 @@ -/* Copyright (C) 2000-2006 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by @@ -183,7 +183,7 @@ char * ip_to_hostname(struct in_addr *in, uint *errors) &tmp_hostent,buff,sizeof(buff),&tmp_errno))) { DBUG_PRINT("error",("gethostbyaddr_r returned %d",tmp_errno)); - return 0; + DBUG_RETURN(0); } if (!(check=my_gethostbyname_r(hp->h_name,&tmp_hostent2,buff2,sizeof(buff2), &tmp_errno))) From 91eebaaef47e3e49b0c0666d5c42321419d709f1 Mon Sep 17 00:00:00 2001 From: Bjorn Munch Date: Wed, 20 Apr 2011 14:58:53 +0200 Subject: [PATCH 76/91] Bug #12379923 60907: MYSQL-TEST/LIB/MY/SAFEPROCESS/SAFE_PROCESS.PL USES HARDCODED SIGNAL NUMBE Replaced the hardcoded 9 with 'KILL' --- mysql-test/lib/My/SafeProcess/safe_process.pl | 4 ++-- 1 file changed, 2 insertions(+), 2 deletions(-) diff --git a/mysql-test/lib/My/SafeProcess/safe_process.pl b/mysql-test/lib/My/SafeProcess/safe_process.pl index e3114a749d3..54b0073f8df 100644 --- a/mysql-test/lib/My/SafeProcess/safe_process.pl +++ b/mysql-test/lib/My/SafeProcess/safe_process.pl @@ -94,7 +94,7 @@ eval { local $SIG{INT}= \&handle_signal; local $SIG{CHLD}= sub { message("Got signal @_"); - kill(9, -$child_pid); + kill('KILL', -$child_pid); my $ret= waitpid($child_pid, 0); if ($? & 127){ exit(65); # Killed by signal @@ -134,7 +134,7 @@ if ( $@ ) { # Use negative pid in order to kill the whole # process group # -my $ret= kill(9, -$child_pid); +my $ret= kill('KILL', -$child_pid); message("Killed child: $child_pid, ret: $ret"); if ($ret > 0) { message("Killed child: $child_pid"); From bd92ea43116b8ce606de5e6fc825e1a8b87a7740 Mon Sep 17 00:00:00 2001 From: Mattias Jonsson Date: Wed, 20 Apr 2011 17:52:33 +0200 Subject: [PATCH 77/91] Bug#11766249 bug#59316: PARTITIONING AND INDEX_MERGE MEMORY LEAK Update for previous patch according to reviewers comments. Updated the constructors for ha_partitions to use the common init_handler_variables functions Added use of defines for size and offset to get better readability for the code that reads and writes the .par file. Also refactored the get_from_handler_file function. --- sql/ha_partition.cc | 310 +++++++++++++++++++++++++------------------- sql/ha_partition.h | 17 ++- sql/handler.cc | 23 ++-- 3 files changed, 209 insertions(+), 141 deletions(-) diff --git a/sql/ha_partition.cc b/sql/ha_partition.cc index 946ecc652ef..7685b3a8384 100644 --- a/sql/ha_partition.cc +++ b/sql/ha_partition.cc @@ -166,11 +166,6 @@ ha_partition::ha_partition(handlerton *hton, TABLE_SHARE *share) :handler(hton, share) { DBUG_ENTER("ha_partition::ha_partition(table)"); - m_part_info= NULL; - m_create_handler= FALSE; - m_is_sub_partitioned= 0; - m_is_clone_of= NULL; - m_clone_mem_root= NULL; init_handler_variables(); DBUG_VOID_RETURN; } @@ -192,21 +187,21 @@ ha_partition::ha_partition(handlerton *hton, partition_info *part_info) { DBUG_ENTER("ha_partition::ha_partition(part_info)"); DBUG_ASSERT(part_info); + init_handler_variables(); m_part_info= part_info; m_create_handler= TRUE; m_is_sub_partitioned= m_part_info->is_sub_partitioned(); - init_handler_variables(); DBUG_VOID_RETURN; } /** ha_partition constructor method used by ha_partition::clone() - @param hton Handlerton (partition_hton) - @param share Table share object - @param part_info_arg partition_info to use - @param clone_arg ha_partition to clone - @param clme_mem_root_arg MEM_ROOT to use + @param hton Handlerton (partition_hton) + @param share Table share object + @param part_info_arg partition_info to use + @param clone_arg ha_partition to clone + @param clme_mem_root_arg MEM_ROOT to use @return New partition handler */ @@ -218,14 +213,12 @@ ha_partition::ha_partition(handlerton *hton, TABLE_SHARE *share, :handler(hton, share) { DBUG_ENTER("ha_partition::ha_partition(clone)"); + init_handler_variables(); m_part_info= part_info_arg; m_create_handler= TRUE; m_is_sub_partitioned= m_part_info->is_sub_partitioned(); m_is_clone_of= clone_arg; m_clone_mem_root= clone_mem_root_arg; - init_handler_variables(); - m_tot_parts= clone_arg->m_tot_parts; - DBUG_ASSERT(m_tot_parts); DBUG_VOID_RETURN; } @@ -286,6 +279,11 @@ void ha_partition::init_handler_variables() this allows blackhole to work properly */ m_no_locks= 0; + m_part_info= NULL; + m_create_handler= FALSE; + m_is_sub_partitioned= 0; + m_is_clone_of= NULL; + m_clone_mem_root= NULL; #ifdef DONT_HAVE_TO_BE_INITALIZED m_start_key.flag= 0; @@ -2099,18 +2097,16 @@ static uint name_add(char *dest, const char *first_name, const char *sec_name) } -/* +/** Create the special .par file - SYNOPSIS - create_handler_file() - name Full path of table name + @param name Full path of table name - RETURN VALUE - >0 Error code - 0 Success + @return Operation status + @retval FALSE Error code + @retval TRUE Success - DESCRIPTION + @note Method used to create handler file with names of partitions, their engine types and the number of partitions. */ @@ -2174,19 +2170,22 @@ bool ha_partition::create_handler_file(const char *name) Array of engine types n * 4 bytes where n = (m_tot_parts + 3)/4 Length of name part in bytes 4 bytes + (Names in filename format) Name part m * 4 bytes where m = ((length_name_part + 3)/4)*4 All padding bytes are zeroed */ - tot_partition_words= (tot_parts + 3) / 4; - tot_name_words= (tot_name_len + 3) / 4; + tot_partition_words= (tot_parts + PAR_WORD_SIZE - 1) / PAR_WORD_SIZE; + tot_name_words= (tot_name_len + PAR_WORD_SIZE - 1) / PAR_WORD_SIZE; + /* 4 static words (tot words, checksum, tot partitions, name length) */ tot_len_words= 4 + tot_partition_words + tot_name_words; - tot_len_byte= 4 * tot_len_words; + tot_len_byte= PAR_WORD_SIZE * tot_len_words; if (!(file_buffer= (uchar *) my_malloc(tot_len_byte, MYF(MY_ZEROFILL)))) DBUG_RETURN(TRUE); - engine_array= (file_buffer + 12); - name_buffer_ptr= (char*) (file_buffer + ((4 + tot_partition_words) * 4)); + engine_array= (file_buffer + PAR_ENGINES_OFFSET); + name_buffer_ptr= (char*) (engine_array + tot_partition_words * PAR_WORD_SIZE + + PAR_WORD_SIZE); part_it.rewind(); for (i= 0; i < no_parts; i++) { @@ -2224,13 +2223,15 @@ bool ha_partition::create_handler_file(const char *name) } chksum= 0; int4store(file_buffer, tot_len_words); - int4store(file_buffer + 8, tot_parts); - int4store(file_buffer + 12 + (tot_partition_words * 4), tot_name_len); + int4store(file_buffer + PAR_NUM_PARTS_OFFSET, tot_parts); + int4store(file_buffer + PAR_ENGINES_OFFSET + + (tot_partition_words * PAR_WORD_SIZE), + tot_name_len); for (i= 0; i < tot_len_words; i++) - chksum^= uint4korr(file_buffer + 4 * i); - int4store(file_buffer + 4, chksum); + chksum^= uint4korr(file_buffer + PAR_WORD_SIZE * i); + int4store(file_buffer + PAR_CHECKSUM_OFFSET, chksum); /* - Remove .frm extension and replace with .par + Add .par extension to the file name. Create and write and close file to be used at open, delete_table and rename_table */ @@ -2248,14 +2249,9 @@ bool ha_partition::create_handler_file(const char *name) DBUG_RETURN(result); } -/* + +/** Clear handler variables and free some memory - - SYNOPSIS - clear_handler_file() - - RETURN VALUE - NONE */ void ha_partition::clear_handler_file() @@ -2268,16 +2264,15 @@ void ha_partition::clear_handler_file() m_engine_array= NULL; } -/* + +/** Create underlying handler objects - SYNOPSIS - create_handlers() - mem_root Allocate memory through this + @para mem_root Allocate memory through this - RETURN VALUE - TRUE Error - FALSE Success + @return Operation status + @retval TRUE Error + @retval FALSE Success */ bool ha_partition::create_handlers(MEM_ROOT *mem_root) @@ -2315,6 +2310,7 @@ bool ha_partition::create_handlers(MEM_ROOT *mem_root) DBUG_RETURN(FALSE); } + /* Create underlying handler objects from partition info @@ -2386,108 +2382,164 @@ error_end: } -/* - Get info about partition engines and their names from the .par file +/** + Read the .par file to get the partitions engines and names - SYNOPSIS - get_from_handler_file() - name Full path of table name - mem_root Allocate memory through this + @param name Name of table file (without extention) - RETURN VALUE - TRUE Error - FALSE Success + @return Operation status + @retval true Failure + @retval false Success - DESCRIPTION - Open handler file to get partition names, engine types and number of - partitions. + @note On success, m_file_buffer is allocated and must be + freed by the caller. m_name_buffer_ptr and m_tot_parts is also set. */ -bool ha_partition::get_from_handler_file(const char *name, MEM_ROOT *mem_root, - bool clone) +bool ha_partition::read_par_file(const char *name) { - char buff[FN_REFLEN], *address_tot_name_len; + char buff[FN_REFLEN], *tot_name_len_offset; File file; - char *file_buffer, *name_buffer_ptr; - handlerton **engine_array; + char *file_buffer; uint i, len_bytes, len_words, tot_partition_words, tot_name_words, chksum; - DBUG_ENTER("ha_partition::get_from_handler_file"); + DBUG_ENTER("ha_partition::read_par_file"); DBUG_PRINT("enter", ("table name: '%s'", name)); if (m_file_buffer) - DBUG_RETURN(FALSE); + DBUG_RETURN(false); fn_format(buff, name, "", ha_par_ext, MY_APPEND_EXT); /* Following could be done with my_stat to read in whole file */ if ((file= my_open(buff, O_RDONLY | O_SHARE, MYF(0))) < 0) - DBUG_RETURN(TRUE); - if (my_read(file, (uchar *) & buff[0], 8, MYF(MY_NABP))) + DBUG_RETURN(true); + if (my_read(file, (uchar *) & buff[0], PAR_WORD_SIZE, MYF(MY_NABP))) goto err1; len_words= uint4korr(buff); - len_bytes= 4 * len_words; + len_bytes= PAR_WORD_SIZE * len_words; + if (my_seek(file, 0, MY_SEEK_SET, MYF(0)) == MY_FILEPOS_ERROR) + goto err1; if (!(file_buffer= (char*) my_malloc(len_bytes, MYF(0)))) goto err1; - VOID(my_seek(file, 0, MY_SEEK_SET, MYF(0))); if (my_read(file, (uchar *) file_buffer, len_bytes, MYF(MY_NABP))) goto err2; chksum= 0; for (i= 0; i < len_words; i++) - chksum ^= uint4korr((file_buffer) + 4 * i); + chksum ^= uint4korr((file_buffer) + PAR_WORD_SIZE * i); if (chksum) goto err2; - m_tot_parts= uint4korr((file_buffer) + 8); + m_tot_parts= uint4korr((file_buffer) + PAR_NUM_PARTS_OFFSET); DBUG_PRINT("info", ("No of parts = %u", m_tot_parts)); - tot_partition_words= (m_tot_parts + 3) / 4; - if (!clone) - { - engine_array= (handlerton **) my_alloca(m_tot_parts * sizeof(handlerton*)); - for (i= 0; i < m_tot_parts; i++) - { - engine_array[i]= ha_resolve_by_legacy_type(ha_thd(), - (enum legacy_db_type) - *(uchar *) ((file_buffer) + - 12 + i)); - if (!engine_array[i]) - goto err3; - } - } - address_tot_name_len= file_buffer + 12 + 4 * tot_partition_words; - tot_name_words= (uint4korr(address_tot_name_len) + 3) / 4; + tot_partition_words= (m_tot_parts + PAR_WORD_SIZE - 1) / PAR_WORD_SIZE; + + tot_name_len_offset= file_buffer + PAR_ENGINES_OFFSET + + PAR_WORD_SIZE * tot_partition_words; + tot_name_words= (uint4korr(tot_name_len_offset) + PAR_WORD_SIZE - 1) / + PAR_WORD_SIZE; + /* + Verify the total length = tot size word, checksum word, num parts word + + engines array + name length word + name array. + */ if (len_words != (tot_partition_words + tot_name_words + 4)) - goto err3; - name_buffer_ptr= file_buffer + 16 + 4 * tot_partition_words; + goto err2; VOID(my_close(file, MYF(0))); m_file_buffer= file_buffer; // Will be freed in clear_handler_file() - m_name_buffer_ptr= name_buffer_ptr; - - if (!clone) - { - if (!(m_engine_array= (plugin_ref*) - my_malloc(m_tot_parts * sizeof(plugin_ref), MYF(MY_WME)))) - goto err3; + m_name_buffer_ptr= tot_name_len_offset + PAR_WORD_SIZE; - for (i= 0; i < m_tot_parts; i++) - m_engine_array[i]= ha_lock_engine(NULL, engine_array[i]); + DBUG_RETURN(false); - my_afree((gptr) engine_array); - } - - if (!clone && !m_file && create_handlers(mem_root)) - { - clear_handler_file(); - DBUG_RETURN(TRUE); - } - DBUG_RETURN(FALSE); - -err3: - if (!clone) - my_afree((gptr) engine_array); err2: my_free(file_buffer, MYF(0)); err1: VOID(my_close(file, MYF(0))); - DBUG_RETURN(TRUE); + DBUG_RETURN(true); +} + + +/** + Setup m_engine_array + + @param mem_root MEM_ROOT to use for allocating new handlers + + @return Operation status + @retval false Success + @retval true Failure +*/ + +bool ha_partition::setup_engine_array(MEM_ROOT *mem_root) +{ + uint i; + uchar *buff; + handlerton **engine_array; + + DBUG_ASSERT(!m_file); + DBUG_ENTER("ha_partition::setup_engine_array"); + engine_array= (handlerton **) my_alloca(m_tot_parts * sizeof(handlerton*)); + if (!engine_array) + DBUG_RETURN(true); + + buff= (uchar *) (m_file_buffer + PAR_ENGINES_OFFSET); + for (i= 0; i < m_tot_parts; i++) + { + engine_array[i]= ha_resolve_by_legacy_type(ha_thd(), + (enum legacy_db_type) + *(buff + i)); + if (!engine_array[i]) + goto err; + } + if (!(m_engine_array= (plugin_ref*) + my_malloc(m_tot_parts * sizeof(plugin_ref), MYF(MY_WME)))) + goto err; + + for (i= 0; i < m_tot_parts; i++) + m_engine_array[i]= ha_lock_engine(NULL, engine_array[i]); + + my_afree((gptr) engine_array); + + if (create_handlers(mem_root)) + { + clear_handler_file(); + DBUG_RETURN(true); + } + + DBUG_RETURN(false); + +err: + my_afree((gptr) engine_array); + DBUG_RETURN(true); +} + + +/** + Get info about partition engines and their names from the .par file + + @param name Full path of table name + @param mem_root Allocate memory through this + @param is_clone If it is a clone, don't create new handlers + + @return Operation status + @retval true Error + @retval false Success + + @note Open handler file to get partition names, engine types and number of + partitions. +*/ + +bool ha_partition::get_from_handler_file(const char *name, MEM_ROOT *mem_root, + bool is_clone) +{ + DBUG_ENTER("ha_partition::get_from_handler_file"); + DBUG_PRINT("enter", ("table name: '%s'", name)); + + if (m_file_buffer) + DBUG_RETURN(false); + + if (read_par_file(name)) + DBUG_RETURN(true); + + if (!is_clone && setup_engine_array(mem_root)) + DBUG_RETURN(true); + + DBUG_RETURN(false); } @@ -2615,8 +2667,7 @@ int ha_partition::open(const char *name, int mode, uint test_if_locked) { create_partition_name(name_buff, name, name_buffer_ptr, NORMAL_PART_NAME, FALSE); - if (!(m_file[i]= file[i]->clone((const char*) name_buff, - m_clone_mem_root))) + if (!(m_file[i]= file[i]->clone(name_buff, m_clone_mem_root))) { error= HA_ERR_INITIALIZATION; file= &m_file[i]; @@ -2632,8 +2683,7 @@ int ha_partition::open(const char *name, int mode, uint test_if_locked) { create_partition_name(name_buff, name, name_buffer_ptr, NORMAL_PART_NAME, FALSE); - if ((error= (*file)->ha_open(table, (const char*) name_buff, mode, - test_if_locked))) + if ((error= (*file)->ha_open(table, name_buff, mode, test_if_locked))) goto err_handler; m_no_locks+= (*file)->lock_count(); name_buffer_ptr+= strlen(name_buffer_ptr) + 1; @@ -2645,8 +2695,7 @@ int ha_partition::open(const char *name, int mode, uint test_if_locked) check_table_flags= (((*file)->ha_table_flags() & ~(PARTITION_DISABLED_TABLE_FLAGS)) | (PARTITION_ENABLED_TABLE_FLAGS)); - file++; - do + while (*(++file)) { DBUG_ASSERT(ref_length >= (*file)->ref_length); set_if_bigger(ref_length, ((*file)->ref_length)); @@ -2663,7 +2712,7 @@ int ha_partition::open(const char *name, int mode, uint test_if_locked) file = &m_file[m_tot_parts - 1]; goto err_handler; } - } while (*(++file)); + } key_used_on_scan= m_file[0]->key_used_on_scan; implicit_emptied= m_file[0]->implicit_emptied; /* @@ -2742,7 +2791,7 @@ err_alloc: /** Clone the open and locked partitioning handler. - @param mem_root MEM_ROOT to use. + @param mem_root MEM_ROOT to use. @return Pointer to the successfully created clone or NULL @@ -2750,33 +2799,32 @@ err_alloc: This function creates a new ha_partition handler as a clone/copy. The original (this) must already be opened and locked. The clone will use the originals m_part_info. - It also allocates memory to ref + ref_dup. + It also allocates memory for ref + ref_dup. In ha_partition::open() it will clone its original handlers partitions - which will allocate then om the correct MEM_ROOT and also open them. + which will allocate then on the correct MEM_ROOT and also open them. */ handler *ha_partition::clone(const char *name, MEM_ROOT *mem_root) { ha_partition *new_handler; - + DBUG_ENTER("ha_partition::clone"); new_handler= new (mem_root) ha_partition(ht, table_share, m_part_info, this, mem_root); - if (!new_handler) - DBUG_RETURN(NULL); - /* Allocate new_handler->ref here because otherwise ha_open will allocate it on this->table->mem_root and we will not be able to reclaim that memory when the clone handler object is destroyed. */ - new_handler->ref= (uchar*) alloc_root(mem_root, ALIGN_SIZE(m_ref_length)*2); - if (!new_handler->ref) - DBUG_RETURN(NULL); + if (new_handler && + !(new_handler->ref= (uchar*) alloc_root(mem_root, + ALIGN_SIZE(m_ref_length)*2))) + new_handler= NULL; - if (new_handler->ha_open(table, name, + if (new_handler && + new_handler->ha_open(table, name, table->db_stat, HA_OPEN_IGNORE_IF_LOCKED)) - DBUG_RETURN(NULL); + new_handler= NULL; DBUG_RETURN((handler*) new_handler); } diff --git a/sql/ha_partition.h b/sql/ha_partition.h index a38d56af8ff..cd90c4cc1d5 100644 --- a/sql/ha_partition.h +++ b/sql/ha_partition.h @@ -55,6 +55,16 @@ typedef struct st_ha_data_partition HA_DUPLICATE_POS | \ HA_CAN_SQL_HANDLER | \ HA_CAN_INSERT_DELAYED) + +/* First 4 bytes in the .par file is the number of 32-bit words in the file */ +#define PAR_WORD_SIZE 4 +/* offset to the .par file checksum */ +#define PAR_CHECKSUM_OFFSET 4 +/* offset to the total number of partitions */ +#define PAR_NUM_PARTS_OFFSET 8 +/* offset to the engines array */ +#define PAR_ENGINES_OFFSET 12 + class ha_partition :public handler { private: @@ -71,7 +81,7 @@ private: /* Data for the partition handler */ int m_mode; // Open mode uint m_open_test_lock; // Open test_if_locked - char *m_file_buffer; // Buffer with names + char *m_file_buffer; // Content of the .par file char *m_name_buffer_ptr; // Pointer to first partition name plugin_ref *m_engine_array; // Array of types of the handlers handler **m_file; // Array of references to handler inst. @@ -281,7 +291,10 @@ private: And one method to read it in. */ bool create_handler_file(const char *name); - bool get_from_handler_file(const char *name, MEM_ROOT *mem_root, bool clone); + bool setup_engine_array(MEM_ROOT *mem_root); + bool read_par_file(const char *name); + bool get_from_handler_file(const char *name, MEM_ROOT *mem_root, + bool is_clone); bool new_handlers_from_part_info(MEM_ROOT *mem_root); bool create_handlers(MEM_ROOT *mem_root); void clear_handler_file(); diff --git a/sql/handler.cc b/sql/handler.cc index 8adb8e061a3..718529fa5fc 100644 --- a/sql/handler.cc +++ b/sql/handler.cc @@ -2045,14 +2045,21 @@ handler *handler::clone(const char *name, MEM_ROOT *mem_root) on this->table->mem_root and we will not be able to reclaim that memory when the clone handler object is destroyed. */ - if (!(new_handler->ref= (uchar*) alloc_root(mem_root, ALIGN_SIZE(ref_length)*2))) - return NULL; - if (new_handler && !new_handler->ha_open(table, - name, - table->db_stat, - HA_OPEN_IGNORE_IF_LOCKED)) - return new_handler; - return NULL; + if (new_handler && + !(new_handler->ref= (uchar*) alloc_root(mem_root, + ALIGN_SIZE(ref_length)*2))) + new_handler= NULL; + /* + TODO: Implement a more efficient way to have more than one index open for + the same table instance. The ha_open call is not cachable for clone. + */ + if (new_handler && new_handler->ha_open(table, + name, + table->db_stat, + HA_OPEN_IGNORE_IF_LOCKED)) + new_handler= NULL; + + return new_handler; } From a5e8d9029b1340762bc88226c0a9344f241a044c Mon Sep 17 00:00:00 2001 From: Sergey Glukhov Date: Fri, 22 Apr 2011 11:20:55 +0400 Subject: [PATCH 78/91] Bug#11756928 48916: SERVER INCORRECTLY PROCESSING HAVING CLAUSES WITH AN ORDER BY CLAUSE Before sorting HAVING condition is split into two parts, first part is a table related condition and the rest of is HAVING part. Extraction of HAVING part does not take into account the fact that some of conditions might be non-const but have 'used_tables' == 0 (independent subqueries) and because of that these conditions are cut off by make_cond_for_table() function. The fix is to use (table_map) 0 instead of used_tables in third argument for make_cond_for_table() function. It allows to extract elements which belong to sorted table and in addition elements which are independend subqueries. mysql-test/r/having.result: test case mysql-test/t/having.test: test case sql/sql_select.cc: The fix is to use (table_map) 0 instead of used_tables in third argument for make_cond_for_table() function. It allows to extract elements which belong to sorted table and in addition elements which are independend subqueries. --- mysql-test/r/having.result | 22 ++++++++++++++++++++++ mysql-test/t/having.test | 26 ++++++++++++++++++++++++++ sql/sql_select.cc | 38 +++++++++++++++++++++++++++++++++++++- 3 files changed, 85 insertions(+), 1 deletion(-) diff --git a/mysql-test/r/having.result b/mysql-test/r/having.result index cd1b4ae0218..4253ac7e5c3 100644 --- a/mysql-test/r/having.result +++ b/mysql-test/r/having.result @@ -545,4 +545,26 @@ FROM t1 JOIN t2 ON t2.f2 LIKE 'x' HAVING field1 < 7; field1 DROP TABLE t1,t2; +# +# Bug#48916 Server incorrectly processing HAVING clauses with an ORDER BY clause +# +CREATE TABLE t1 (f1 INT, f2 INT); +INSERT INTO t1 VALUES (1, 0), (2, 1), (3, 2); +CREATE TABLE t2 (f1 INT, f2 INT); +SELECT t1.f1 +FROM t1 +HAVING (3, 2) IN (SELECT f1, f2 FROM t2) AND t1.f1 >= 0 +ORDER BY t1.f1; +f1 +SELECT t1.f1 +FROM t1 +HAVING (3, 2) IN (SELECT 4, 2) AND t1.f1 >= 0 +ORDER BY t1.f1; +f1 +SELECT t1.f1 +FROM t1 +HAVING 2 IN (SELECT f2 FROM t2) AND t1.f1 >= 0 +ORDER BY t1.f1; +f1 +DROP TABLE t1,t2; End of 5.1 tests diff --git a/mysql-test/t/having.test b/mysql-test/t/having.test index c808e747523..2ed8b40b858 100644 --- a/mysql-test/t/having.test +++ b/mysql-test/t/having.test @@ -564,4 +564,30 @@ HAVING field1 < 7; DROP TABLE t1,t2; +--echo # +--echo # Bug#48916 Server incorrectly processing HAVING clauses with an ORDER BY clause +--echo # + +CREATE TABLE t1 (f1 INT, f2 INT); +INSERT INTO t1 VALUES (1, 0), (2, 1), (3, 2); +CREATE TABLE t2 (f1 INT, f2 INT); + +SELECT t1.f1 +FROM t1 +HAVING (3, 2) IN (SELECT f1, f2 FROM t2) AND t1.f1 >= 0 +ORDER BY t1.f1; + +SELECT t1.f1 +FROM t1 +HAVING (3, 2) IN (SELECT 4, 2) AND t1.f1 >= 0 +ORDER BY t1.f1; + +SELECT t1.f1 +FROM t1 +HAVING 2 IN (SELECT f2 FROM t2) AND t1.f1 >= 0 +ORDER BY t1.f1; + +DROP TABLE t1,t2; + + --echo End of 5.1 tests diff --git a/sql/sql_select.cc b/sql/sql_select.cc index ab287e57aa1..46e9ad242b3 100644 --- a/sql/sql_select.cc +++ b/sql/sql_select.cc @@ -2215,7 +2215,7 @@ JOIN::exec() Item* sort_table_cond= make_cond_for_table(curr_join->tmp_having, used_tables, - used_tables); + (table_map) 0); if (sort_table_cond) { if (!curr_table->select) @@ -12852,6 +12852,42 @@ static bool test_if_ref(Item_field *left_item,Item *right_item) return 0; // keep test } +/** + Extract a condition that can be checked after reading given table + + @param cond Condition to analyze + @param tables Tables for which "current field values" are available + @param used_table Table that we're extracting the condition for (may + also include PSEUDO_TABLE_BITS, and may be zero) + @param exclude_expensive_cond Do not push expensive conditions + + @retval <>NULL Generated condition + @retval =NULL Already checked, OR error + + @details + Extract the condition that can be checked after reading the table + specified in 'used_table', given that current-field values for tables + specified in 'tables' bitmap are available. + If 'used_table' is 0 + - extract conditions for all tables in 'tables'. + - extract conditions are unrelated to any tables + in the same query block/level(i.e. conditions + which have used_tables == 0). + + The function assumes that + - Constant parts of the condition has already been checked. + - Condition that could be checked for tables in 'tables' has already + been checked. + + The function takes into account that some parts of the condition are + guaranteed to be true by employed 'ref' access methods (the code that + does this is located at the end, search down for "EQ_FUNC"). + + @note + Make sure to keep the implementations of make_cond_for_table() and + make_cond_after_sjm() synchronized. + make_cond_for_info_schema() uses similar algorithm as well. +*/ static COND * make_cond_for_table(COND *cond, table_map tables, table_map used_table) From c68a034e8382c03118f8c6708dd029a89aae30a7 Mon Sep 17 00:00:00 2001 From: Serge Kozlov Date: Mon, 25 Apr 2011 23:49:56 +0400 Subject: [PATCH 79/91] BUG#12371924. Fxi test case --- mysql-test/suite/binlog/r/binlog_bug23533.result | 4 ---- mysql-test/suite/binlog/t/binlog_bug23533.test | 16 ++++++++++++---- 2 files changed, 12 insertions(+), 8 deletions(-) diff --git a/mysql-test/suite/binlog/r/binlog_bug23533.result b/mysql-test/suite/binlog/r/binlog_bug23533.result index 02605839ab0..d5cd93284a2 100644 --- a/mysql-test/suite/binlog/r/binlog_bug23533.result +++ b/mysql-test/suite/binlog/r/binlog_bug23533.result @@ -3,8 +3,6 @@ CREATE TABLE t1 (a INT NOT NULL AUTO_INCREMENT, b TEXT, PRIMARY KEY(a)) ENGINE=I SELECT COUNT(*) FROM t1; COUNT(*) 1000 -SET @saved_binlog_cache_size=@@binlog_cache_size; -SET @saved_max_binlog_cache_size=@@max_binlog_cache_size; SET GLOBAL binlog_cache_size=4096; SET GLOBAL max_binlog_cache_size=4096; START TRANSACTION; @@ -14,6 +12,4 @@ COMMIT; SHOW TABLES LIKE 't%'; Tables_in_test (t%) t1 -SET GLOBAL max_binlog_cache_size=@saved_max_binlog_cache_size; -SET GLOBAL binlog_cache_size=@saved_binlog_cache_size; DROP TABLE t1; diff --git a/mysql-test/suite/binlog/t/binlog_bug23533.test b/mysql-test/suite/binlog/t/binlog_bug23533.test index 05fe9fd9523..c05abe788c6 100644 --- a/mysql-test/suite/binlog/t/binlog_bug23533.test +++ b/mysql-test/suite/binlog/t/binlog_bug23533.test @@ -24,11 +24,15 @@ while ($i) SELECT COUNT(*) FROM t1; # Set small value for max_binlog_cache_size -SET @saved_binlog_cache_size=@@binlog_cache_size; -SET @saved_max_binlog_cache_size=@@max_binlog_cache_size; +let $saved_binlog_cache_size= query_get_value(SELECT @@binlog_cache_size AS Value, Value, 1); +let $saved_max_binlog_cache_size= query_get_value(SELECT @@max_binlog_cache_size AS Value, Value, 1); SET GLOBAL binlog_cache_size=4096; SET GLOBAL max_binlog_cache_size=4096; +# New value of max_binlog_cache_size will apply to new session +disconnect default; +connect(default,localhost,root,,test); + # Copied data from t1 into t2 large than max_binlog_cache_size START TRANSACTION; --error 1197 @@ -37,6 +41,10 @@ COMMIT; SHOW TABLES LIKE 't%'; # 5.1 End of Test -SET GLOBAL max_binlog_cache_size=@saved_max_binlog_cache_size; -SET GLOBAL binlog_cache_size=@saved_binlog_cache_size; +--disable_query_log +eval SET GLOBAL max_binlog_cache_size=$saved_max_binlog_cache_size; +eval SET GLOBAL binlog_cache_size=$saved_binlog_cache_size; +--enable_query_log DROP TABLE t1; +disconnect default; +connect(default,localhost,root,,test); From bdaaee5d0495ad66e95bcb42e06866855cf417b8 Mon Sep 17 00:00:00 2001 From: Mattias Jonsson Date: Tue, 26 Apr 2011 10:21:09 +0200 Subject: [PATCH 80/91] post fix for werror build for bug#11766249. --- sql/ha_partition.cc | 10 +++++----- 1 file changed, 5 insertions(+), 5 deletions(-) diff --git a/sql/ha_partition.cc b/sql/ha_partition.cc index a0f346f7a64..460d5826a91 100644 --- a/sql/ha_partition.cc +++ b/sql/ha_partition.cc @@ -2587,7 +2587,7 @@ void ha_data_partition_destroy(void *ha_data) int ha_partition::open(const char *name, int mode, uint test_if_locked) { char *name_buffer_ptr; - int error; + int error= HA_ERR_INITIALIZATION; uint alloc_len; handler **file; char name_buff[FN_REFLEN]; @@ -2601,7 +2601,7 @@ int ha_partition::open(const char *name, int mode, uint test_if_locked) m_open_test_lock= test_if_locked; m_part_field_array= m_part_info->full_part_field_array; if (get_from_handler_file(name, &table->mem_root, test(m_is_clone_of))) - DBUG_RETURN(1); + DBUG_RETURN(error); name_buffer_ptr= m_name_buffer_ptr; m_start_key.length= 0; m_rec0= table->record[0]; @@ -2612,7 +2612,7 @@ int ha_partition::open(const char *name, int mode, uint test_if_locked) { if (!(m_ordered_rec_buffer= (uchar*)my_malloc(alloc_len, MYF(MY_WME)))) { - DBUG_RETURN(1); + DBUG_RETURN(error); } { /* @@ -2635,7 +2635,7 @@ int ha_partition::open(const char *name, int mode, uint test_if_locked) /* Initialize the bitmap we use to minimize ha_start_bulk_insert calls */ if (bitmap_init(&m_bulk_insert_started, NULL, m_tot_parts + 1, FALSE)) - DBUG_RETURN(1); + DBUG_RETURN(error); bitmap_clear_all(&m_bulk_insert_started); /* Initialize the bitmap we use to determine what partitions are used */ if (!m_is_clone_of) @@ -2644,7 +2644,7 @@ int ha_partition::open(const char *name, int mode, uint test_if_locked) if (bitmap_init(&(m_part_info->used_partitions), NULL, m_tot_parts, TRUE)) { bitmap_free(&m_bulk_insert_started); - DBUG_RETURN(1); + DBUG_RETURN(error); } bitmap_set_all(&(m_part_info->used_partitions)); } From a60c39a2ffc7ec0c0b4ae8bbadf733773ec7557f Mon Sep 17 00:00:00 2001 From: Sergey Glukhov Date: Wed, 27 Apr 2011 11:35:57 +0400 Subject: [PATCH 81/91] Bug#11889186 60503: CRASH IN MAKE_DATE_TIME WITH DATE_FORMAT / STR_TO_DATE COMBINATION calc_daynr() function returns negative result if malformed date with zero year and month is used. Attempt to calculate week day on negative value leads to crash. The fix is return NULL for 'W', 'a', 'w' specifiers if zero year and month is used. Additional fix for calc_daynr(): --added assertion that result can not be negative --return 0 if zero year and month is used mysql-test/r/func_time.result: test case mysql-test/t/func_time.test: test case sql-common/my_time.c: --added assertion that result can not be negative --return 0 if zero year and month is used sql/item_timefunc.cc: eturn NULL for 'W', 'a', 'w' specifiers if zero year and month is used. --- mysql-test/r/func_time.result | 12 ++++++++++++ mysql-test/t/func_time.test | 8 ++++++++ sql-common/my_time.c | 3 ++- sql/item_timefunc.cc | 6 +++--- 4 files changed, 25 insertions(+), 4 deletions(-) diff --git a/mysql-test/r/func_time.result b/mysql-test/r/func_time.result index f67171af99f..1e05443d8ac 100644 --- a/mysql-test/r/func_time.result +++ b/mysql-test/r/func_time.result @@ -1405,4 +1405,16 @@ NULL SELECT ADDDATE(MONTH(FROM_UNIXTIME(NULL)),INTERVAL 1 HOUR); ADDDATE(MONTH(FROM_UNIXTIME(NULL)),INTERVAL 1 HOUR) NULL +# +# Bug#11889186 60503: CRASH IN MAKE_DATE_TIME WITH DATE_FORMAT / STR_TO_DATE COMBINATION +# +SELECT DATE_FORMAT('0000-00-11', '%W'); +DATE_FORMAT('0000-00-11', '%W') +NULL +SELECT DATE_FORMAT('0000-00-11', '%a'); +DATE_FORMAT('0000-00-11', '%a') +NULL +SELECT DATE_FORMAT('0000-00-11', '%w'); +DATE_FORMAT('0000-00-11', '%w') +NULL End of 5.1 tests diff --git a/mysql-test/t/func_time.test b/mysql-test/t/func_time.test index 938359f8c11..2000d81f80d 100644 --- a/mysql-test/t/func_time.test +++ b/mysql-test/t/func_time.test @@ -913,4 +913,12 @@ SELECT CAST((MONTH(FROM_UNIXTIME(@@GLOBAL.SQL_MODE))) AS BINARY(1025)); SELECT ADDDATE(MONTH(FROM_UNIXTIME(NULL)),INTERVAL 1 HOUR); +--echo # +--echo # Bug#11889186 60503: CRASH IN MAKE_DATE_TIME WITH DATE_FORMAT / STR_TO_DATE COMBINATION +--echo # + +SELECT DATE_FORMAT('0000-00-11', '%W'); +SELECT DATE_FORMAT('0000-00-11', '%a'); +SELECT DATE_FORMAT('0000-00-11', '%w'); + --echo End of 5.1 tests diff --git a/sql-common/my_time.c b/sql-common/my_time.c index ca11c54a999..80a7e0daa2c 100644 --- a/sql-common/my_time.c +++ b/sql-common/my_time.c @@ -772,7 +772,7 @@ long calc_daynr(uint year,uint month,uint day) int y= year; /* may be < 0 temporarily */ DBUG_ENTER("calc_daynr"); - if (y == 0 && month == 0 && day == 0) + if (y == 0 && month == 0) DBUG_RETURN(0); /* Skip errors */ /* Cast to int to be able to handle month == 0 */ delsum= (long) (365 * y + 31 *((int) month - 1) + (int) day); @@ -783,6 +783,7 @@ long calc_daynr(uint year,uint month,uint day) temp=(int) ((y/100+1)*3)/4; DBUG_PRINT("exit",("year: %d month: %d day: %d -> daynr: %ld", y+(month <= 2),month,day,delsum+y/4-temp)); + DBUG_ASSERT(delsum+(int) y/4-temp > 0); DBUG_RETURN(delsum+(int) y/4-temp); } /* calc_daynr */ diff --git a/sql/item_timefunc.cc b/sql/item_timefunc.cc index ecf790cc061..1044b4682ef 100644 --- a/sql/item_timefunc.cc +++ b/sql/item_timefunc.cc @@ -648,7 +648,7 @@ bool make_date_time(DATE_TIME_FORMAT *format, MYSQL_TIME *l_time, system_charset_info); break; case 'W': - if (type == MYSQL_TIMESTAMP_TIME) + if (type == MYSQL_TIMESTAMP_TIME || !(l_time->month || l_time->year)) return 1; weekday= calc_weekday(calc_daynr(l_time->year,l_time->month, l_time->day),0); @@ -657,7 +657,7 @@ bool make_date_time(DATE_TIME_FORMAT *format, MYSQL_TIME *l_time, system_charset_info); break; case 'a': - if (type == MYSQL_TIMESTAMP_TIME) + if (type == MYSQL_TIMESTAMP_TIME || !(l_time->month || l_time->year)) return 1; weekday=calc_weekday(calc_daynr(l_time->year,l_time->month, l_time->day),0); @@ -816,7 +816,7 @@ bool make_date_time(DATE_TIME_FORMAT *format, MYSQL_TIME *l_time, } break; case 'w': - if (type == MYSQL_TIMESTAMP_TIME) + if (type == MYSQL_TIMESTAMP_TIME || !(l_time->month || l_time->year)) return 1; weekday=calc_weekday(calc_daynr(l_time->year,l_time->month, l_time->day),1); From a1f7ceb281f9d87c9baea125ebab26f99a0370f8 Mon Sep 17 00:00:00 2001 From: Nirbhay Choubey Date: Wed, 27 Apr 2011 17:24:10 +0530 Subject: [PATCH 82/91] BUG#12329909 - BUILDING MYSQL WITH DEBUG SUPPORT FAILS WITH LIBEDIT Fixed by checking the return value of the write() function calls and handling the open files and fd appropriately. cmd-line-utils/libedit/vi.c: BUG#12329909 - BUILDING MYSQL WITH DEBUG SUPPORT FAILS WITH LIBEDIT Added a check on the return value of the write() function calls. --- cmd-line-utils/libedit/vi.c | 12 ++++++++++-- 1 file changed, 10 insertions(+), 2 deletions(-) diff --git a/cmd-line-utils/libedit/vi.c b/cmd-line-utils/libedit/vi.c index d628f076a1d..beffc7b40b5 100644 --- a/cmd-line-utils/libedit/vi.c +++ b/cmd-line-utils/libedit/vi.c @@ -1012,8 +1012,10 @@ vi_histedit(EditLine *el, int c __attribute__((__unused__))) if (fd < 0) return CC_ERROR; cp = el->el_line.buffer; - write(fd, cp, el->el_line.lastchar - cp +0u); - write(fd, "\n", 1); + if (write(fd, cp, el->el_line.lastchar - cp +0u) == -1) + goto error; + if (write(fd, "\n", 1) == -1) + goto error; pid = fork(); switch (pid) { case -1: @@ -1041,6 +1043,12 @@ vi_histedit(EditLine *el, int c __attribute__((__unused__))) unlink(tempfile); /* return CC_REFRESH; */ return ed_newline(el, 0); + +/* XXXMYSQL: Avoid compiler warnings. */ +error: + close(fd); + unlink(tempfile); + return CC_ERROR; } /* vi_history_word(): From 401941c25898300462b1adbd9886c8d55e92f7f2 Mon Sep 17 00:00:00 2001 From: Mattias Jonsson Date: Wed, 27 Apr 2011 17:51:06 +0200 Subject: [PATCH 83/91] Post push fix for bug#11766249 bug#59316 Partitions can have different ref_length (position data length). Removed DBUG_ASSERT which crashed debug builds when using MAX_ROWS on some partitions. --- ...on_not_embedded.result => partition_myisam.result} | 9 +++++++++ ...tition_not_embedded.test => partition_myisam.test} | 11 ++++++++++- sql/ha_partition.cc | 9 ++++++--- 3 files changed, 25 insertions(+), 4 deletions(-) rename mysql-test/r/{partition_not_embedded.result => partition_myisam.result} (87%) rename mysql-test/t/{partition_not_embedded.test => partition_myisam.test} (85%) diff --git a/mysql-test/r/partition_not_embedded.result b/mysql-test/r/partition_myisam.result similarity index 87% rename from mysql-test/r/partition_not_embedded.result rename to mysql-test/r/partition_myisam.result index c942189a956..1995c87eff2 100644 --- a/mysql-test/r/partition_not_embedded.result +++ b/mysql-test/r/partition_myisam.result @@ -79,3 +79,12 @@ a DROP TABLE t1; # Should not be any files left here # End of bug#30102 test. +# Test of post-push fix for bug#11766249/59316 +CREATE TABLE t1 (a INT, b VARCHAR(255), PRIMARY KEY (a)) +ENGINE = MyISAM +PARTITION BY RANGE (a) +(PARTITION p0 VALUES LESS THAN (0) MAX_ROWS=100, +PARTITION p1 VALUES LESS THAN (100) MAX_ROWS=100, +PARTITION pMax VALUES LESS THAN MAXVALUE); +INSERT INTO t1 VALUES (1, "Partition p1, first row"); +DROP TABLE t1; diff --git a/mysql-test/t/partition_not_embedded.test b/mysql-test/t/partition_myisam.test similarity index 85% rename from mysql-test/t/partition_not_embedded.test rename to mysql-test/t/partition_myisam.test index 5c512085a9e..51f46aa71be 100644 --- a/mysql-test/t/partition_not_embedded.test +++ b/mysql-test/t/partition_myisam.test @@ -1,5 +1,4 @@ -- source include/have_partition.inc --- source include/not_embedded.inc --disable_warnings DROP TABLE IF EXISTS t1, t2; --enable_warnings @@ -51,3 +50,13 @@ DROP TABLE t1; --list_files $MYSQLD_DATADIR/test t1* --list_files $MYSQLD_DATADIR/test t2* --echo # End of bug#30102 test. + +--echo # Test of post-push fix for bug#11766249/59316 +CREATE TABLE t1 (a INT, b VARCHAR(255), PRIMARY KEY (a)) +ENGINE = MyISAM +PARTITION BY RANGE (a) +(PARTITION p0 VALUES LESS THAN (0) MAX_ROWS=100, + PARTITION p1 VALUES LESS THAN (100) MAX_ROWS=100, + PARTITION pMax VALUES LESS THAN MAXVALUE); +INSERT INTO t1 VALUES (1, "Partition p1, first row"); +DROP TABLE t1; diff --git a/sql/ha_partition.cc b/sql/ha_partition.cc index 460d5826a91..4883e0a0571 100644 --- a/sql/ha_partition.cc +++ b/sql/ha_partition.cc @@ -2697,7 +2697,7 @@ int ha_partition::open(const char *name, int mode, uint test_if_locked) (PARTITION_ENABLED_TABLE_FLAGS)); while (*(++file)) { - DBUG_ASSERT(ref_length >= (*file)->ref_length); + /* MyISAM can have smaller ref_length for partitions with MAX_ROWS set */ set_if_bigger(ref_length, ((*file)->ref_length)); /* Verify that all partitions have the same set of table flags. @@ -3957,12 +3957,15 @@ end_dont_reset_start_part: void ha_partition::position(const uchar *record) { handler *file= m_file[m_last_part]; + uint pad_length; DBUG_ENTER("ha_partition::position"); file->position(record); int2store(ref, m_last_part); - memcpy((ref + PARTITION_BYTES_IN_POS), file->ref, - (ref_length - PARTITION_BYTES_IN_POS)); + memcpy((ref + PARTITION_BYTES_IN_POS), file->ref, file->ref_length); + pad_length= m_ref_length - PARTITION_BYTES_IN_POS - file->ref_length; + if (pad_length) + memset((ref + PARTITION_BYTES_IN_POS + file->ref_length), 0, pad_length); #ifdef SUPPORTING_PARTITION_OVER_DIFFERENT_ENGINES #ifdef HAVE_purify From 54c1da00ee2e6603366d87667c45eda784ba216f Mon Sep 17 00:00:00 2001 From: Mattias Jonsson Date: Fri, 29 Apr 2011 09:48:26 +0200 Subject: [PATCH 84/91] removed dead obsolete code --- sql/ha_partition.cc | 6 ------ 1 file changed, 6 deletions(-) diff --git a/sql/ha_partition.cc b/sql/ha_partition.cc index 4883e0a0571..d09181822ee 100644 --- a/sql/ha_partition.cc +++ b/sql/ha_partition.cc @@ -3967,12 +3967,6 @@ void ha_partition::position(const uchar *record) if (pad_length) memset((ref + PARTITION_BYTES_IN_POS + file->ref_length), 0, pad_length); -#ifdef SUPPORTING_PARTITION_OVER_DIFFERENT_ENGINES -#ifdef HAVE_purify - bzero(ref + PARTITION_BYTES_IN_POS + ref_length, - max_ref_length-ref_length); -#endif /* HAVE_purify */ -#endif DBUG_VOID_RETURN; } From 6f7d0f182d06fcebbae4af09cad030a5ea7331ed Mon Sep 17 00:00:00 2001 From: Vasil Dimov Date: Fri, 29 Apr 2011 14:04:28 +0300 Subject: [PATCH 85/91] Sync 5.1 .inc file with 5.5 due to a missing changeset Add extra codes to wait_until_disconnected.inc that are present in 5.5, but not in 5.1. The missing codes cause innodb_bug59641 to fail in 5.1 on Windows PB2 runs. The addition of those codes in 5.5 was done in luis.soares@sun.com-20090930233215-aup3kxy4j6ltvjfp --- mysql-test/include/wait_until_disconnected.inc | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) diff --git a/mysql-test/include/wait_until_disconnected.inc b/mysql-test/include/wait_until_disconnected.inc index a4362e52d01..8a989becc18 100644 --- a/mysql-test/include/wait_until_disconnected.inc +++ b/mysql-test/include/wait_until_disconnected.inc @@ -7,7 +7,7 @@ let $counter= 500; let $mysql_errno= 0; while (!$mysql_errno) { - --error 0,1053,2002,2006,2013 + --error 0,1040,1053,2002,2003,2006,2013 show status; dec $counter; From 8843aea78a6ddb99598ad77818e5f71fd993ed54 Mon Sep 17 00:00:00 2001 From: Nirbhay Choubey Date: Fri, 29 Apr 2011 18:52:46 +0530 Subject: [PATCH 86/91] Bug#11757855 - 49967: built-in libedit doesn't read .editrc on linux. MySQL client when build with libedit support ignores .editrc at startup. The reason for this regression was the incluison of a safety check, issetugid(), which is not available on some linux platforms. Fixed by adding an equivalent check for platforms which have get[e][u|g]id() set of functions. cmd-line-utils/libedit/el.c: Bug#11757855 - 49967: built-in libedit doesn't read .editrc on linux. Added function calls to check user/group IDs on linux systems which does not have issetugid() function. configure.in: Bug#11757855 - 49967: built-in libedit doesn't read .editrc on linux. Added check for getuid, geteuid, getgid, getegid functions. --- cmd-line-utils/libedit/el.c | 21 ++++++++++++++++----- configure.in | 2 +- 2 files changed, 17 insertions(+), 6 deletions(-) diff --git a/cmd-line-utils/libedit/el.c b/cmd-line-utils/libedit/el.c index d99946eb68f..c7f8386773d 100644 --- a/cmd-line-utils/libedit/el.c +++ b/cmd-line-utils/libedit/el.c @@ -478,7 +478,13 @@ el_source(EditLine *el, const char *fname) fp = NULL; if (fname == NULL) { -#ifdef HAVE_ISSETUGID +/* XXXMYSQL: Bug#49967 */ +#if defined(HAVE_GETUID) && defined(HAVE_GETEUID) && \ + defined(HAVE_GETGID) && defined(HAVE_GETEGID) +#define HAVE_IDENTITY_FUNCS 1 +#endif + +#if (defined(HAVE_ISSETUGID) || defined(HAVE_IDENTITY_FUNCS)) static const char elpath[] = "/.editrc"; /* XXXMYSQL: Portability fix (for which platforms?) */ #ifdef MAXPATHLEN @@ -486,9 +492,13 @@ el_source(EditLine *el, const char *fname) #else char path[4096]; #endif - +#ifdef HAVE_ISSETUGID if (issetugid()) return (-1); +#elif defined(HAVE_IDENTITY_FUNCS) + if (getuid() != geteuid() || getgid() != getegid()) + return (-1); +#endif if ((ptr = getenv("HOME")) == NULL) return (-1); if (strlcpy(path, ptr, sizeof(path)) >= sizeof(path)) @@ -498,9 +508,10 @@ el_source(EditLine *el, const char *fname) fname = path; #else /* - * If issetugid() is missing, always return an error, in order - * to keep from inadvertently opening up the user to a security - * hole. + * If issetugid() or the above mentioned get[e][u|g]id() + * functions are missing, always return an error, in order + * to keep from inadvertently opening up the user to a + * security hole. */ return (-1); #endif diff --git a/configure.in b/configure.in index 5bd823ab879..8ba208b1ef5 100644 --- a/configure.in +++ b/configure.in @@ -1963,7 +1963,7 @@ AC_CHECK_HEADER(vis.h, [AC_DEFINE([HAVE_VIS_H], [1],[Found vis.h and the strvis() function])])]) AC_CHECK_FUNCS(strlcat strlcpy) -AC_CHECK_FUNCS(issetugid) +AC_CHECK_FUNCS(issetugid getuid geteuid getgid getegid) AC_CHECK_FUNCS(fgetln) AC_CHECK_FUNCS(getline flockfile) From f9abd1ab314d3f36ad6d2fe708e6a0ba6a7cb058 Mon Sep 17 00:00:00 2001 From: Kent Boortz Date: Tue, 3 May 2011 16:02:31 +0200 Subject: [PATCH 87/91] Remove soft links in the build directory, not the source directory (Bug#43312) --- client/Makefile.am | 4 ++-- 1 file changed, 2 insertions(+), 2 deletions(-) diff --git a/client/Makefile.am b/client/Makefile.am index ccd0d8aada0..b455a34a58b 100644 --- a/client/Makefile.am +++ b/client/Makefile.am @@ -116,10 +116,10 @@ link_sources: @LN_CP_F@ $(top_srcdir)/sql/$$f $$f; \ done; \ for f in $(strings_src) ; do \ - rm -f $(srcdir)/$$f; \ + rm -f $$f; \ @LN_CP_F@ $(top_srcdir)/strings/$$f $$f; \ done; \ - rm -f $(srcdir)/my_user.c; \ + rm -f my_user.c; \ @LN_CP_F@ $(top_srcdir)/sql-common/my_user.c my_user.c; echo timestamp > link_sources; From 16f26d2aaf65c2d69e24b7d644cc48a628a55862 Mon Sep 17 00:00:00 2001 From: Alexander Nozdrin Date: Wed, 4 May 2011 16:59:24 +0400 Subject: [PATCH 88/91] Patch for Bug#12394306: the sever may crash if mysql.event is corrupted. The problem was that wrong structure of mysql.event was not detected and the server continued to use wrongly-structured data. The fix is to check the structure of mysql.event after opening before any use. That makes operations with events more strict -- some operations that might work before throw errors now. That seems to be Ok. Another side-effect of the patch is that if mysql.event is corrupted, unrelated DROP DATABASE statements issue an SQL warning about inability to open mysql.event table. --- mysql-test/r/events_1.result | 106 ++++++++++++++++++++-------- mysql-test/r/events_restart.result | 3 + mysql-test/t/events_1.test | 109 ++++++++++++++++++++++------- mysql-test/t/events_restart.test | 2 + sql/event_db_repository.cc | 8 +++ 5 files changed, 172 insertions(+), 56 deletions(-) diff --git a/mysql-test/r/events_1.result b/mysql-test/r/events_1.result index e7b645f5556..e0c137ea877 100644 --- a/mysql-test/r/events_1.result +++ b/mysql-test/r/events_1.result @@ -1,3 +1,4 @@ +call mtr.add_suppression("Column count of mysql.event is wrong. Expected .*, found .*\. The table is probably corrupted"); drop database if exists events_test; drop database if exists db_x; drop database if exists mysqltest_db2; @@ -259,33 +260,36 @@ events_test intact_check root@localhost SYSTEM RECURRING NULL 10 # # NULL ENABLE Try to alter mysql.event: the server should fail to load event information after mysql.event was tampered with. -First, let's add a column to the end and make sure everything -works as before +First, let's add a column to the end and check the error is emitted. ALTER TABLE mysql.event ADD dummy INT; SHOW EVENTS; -Db Name Definer Time zone Type Execute at Interval value Interval field Starts Ends Status Originator character_set_client collation_connection Database Collation -events_test intact_check root@localhost SYSTEM RECURRING NULL 10 # # NULL ENABLED 1 latin1 latin1_swedish_ci latin1_swedish_ci +ERROR HY000: Failed to open mysql.event SELECT event_name FROM INFORMATION_SCHEMA.events; -event_name -intact_check +ERROR HY000: Failed to open mysql.event SHOW CREATE EVENT intact_check; -Event sql_mode time_zone Create Event character_set_client collation_connection Database Collation -intact_check SYSTEM CREATE EVENT `intact_check` ON SCHEDULE EVERY 10 HOUR STARTS '#' ON COMPLETION NOT PRESERVE ENABLE DO SELECT "nothing" latin1 latin1_swedish_ci latin1_swedish_ci +ERROR HY000: Failed to open mysql.event DROP EVENT no_such_event; -ERROR HY000: Unknown event 'no_such_event' +ERROR HY000: Failed to open mysql.event CREATE EVENT intact_check_1 ON SCHEDULE EVERY 5 HOUR DO SELECT 5; +ERROR HY000: Failed to open mysql.event ALTER EVENT intact_check_1 ON SCHEDULE EVERY 8 HOUR DO SELECT 8; +ERROR HY000: Failed to open mysql.event ALTER EVENT intact_check_1 RENAME TO intact_check_2; +ERROR HY000: Failed to open mysql.event DROP EVENT intact_check_1; -ERROR HY000: Unknown event 'intact_check_1' +ERROR HY000: Failed to open mysql.event DROP EVENT intact_check_2; +ERROR HY000: Failed to open mysql.event DROP EVENT intact_check; +ERROR HY000: Failed to open mysql.event DROP DATABASE IF EXISTS mysqltest_no_such_database; Warnings: Note 1008 Can't drop database 'mysqltest_no_such_database'; database doesn't exist CREATE DATABASE mysqltest_db2; DROP DATABASE mysqltest_db2; +Warnings: +Error 1545 Failed to open mysql.event SELECT @@event_scheduler; @@event_scheduler OFF @@ -294,6 +298,7 @@ Variable_name Value event_scheduler OFF SET GLOBAL event_scheduler=OFF; ALTER TABLE mysql.event DROP dummy; +DROP EVENT intact_check; CREATE EVENT intact_check ON SCHEDULE EVERY 10 HOUR DO SELECT "nothing"; Now let's add a column to the first position: the server @@ -301,30 +306,32 @@ expects to see event schema name there ALTER TABLE mysql.event ADD dummy INT FIRST; SHOW EVENTS; -ERROR HY000: Cannot load from mysql.event. The table is probably corrupted +ERROR HY000: Failed to open mysql.event SELECT event_name FROM INFORMATION_SCHEMA.events; -ERROR HY000: Cannot load from mysql.event. The table is probably corrupted +ERROR HY000: Failed to open mysql.event SHOW CREATE EVENT intact_check; -ERROR HY000: Unknown event 'intact_check' +ERROR HY000: Failed to open mysql.event DROP EVENT no_such_event; -ERROR HY000: Unknown event 'no_such_event' +ERROR HY000: Failed to open mysql.event CREATE EVENT intact_check_1 ON SCHEDULE EVERY 5 HOUR DO SELECT 5; -ERROR HY000: Failed to store event name. Error code 2 from storage engine. +ERROR HY000: Failed to open mysql.event ALTER EVENT intact_check_1 ON SCHEDULE EVERY 8 HOUR DO SELECT 8; -ERROR HY000: Unknown event 'intact_check_1' +ERROR HY000: Failed to open mysql.event ALTER EVENT intact_check_1 RENAME TO intact_check_2; -ERROR HY000: Unknown event 'intact_check_1' +ERROR HY000: Failed to open mysql.event DROP EVENT intact_check_1; -ERROR HY000: Unknown event 'intact_check_1' +ERROR HY000: Failed to open mysql.event DROP EVENT intact_check_2; -ERROR HY000: Unknown event 'intact_check_2' +ERROR HY000: Failed to open mysql.event DROP EVENT intact_check; -ERROR HY000: Unknown event 'intact_check' +ERROR HY000: Failed to open mysql.event DROP DATABASE IF EXISTS mysqltest_no_such_database; Warnings: Note 1008 Can't drop database 'mysqltest_no_such_database'; database doesn't exist CREATE DATABASE mysqltest_db2; DROP DATABASE mysqltest_db2; +Warnings: +Error 1545 Failed to open mysql.event SELECT @@event_scheduler; @@event_scheduler OFF @@ -345,29 +352,32 @@ Drop some columns and try more checks. ALTER TABLE mysql.event DROP comment, DROP starts; SHOW EVENTS; -ERROR HY000: Cannot load from mysql.event. The table is probably corrupted +ERROR HY000: Failed to open mysql.event SELECT event_name FROM INFORMATION_SCHEMA.EVENTS; -ERROR HY000: Cannot load from mysql.event. The table is probably corrupted +ERROR HY000: Failed to open mysql.event SHOW CREATE EVENT intact_check; -ERROR HY000: Cannot load from mysql.event. The table is probably corrupted +ERROR HY000: Failed to open mysql.event DROP EVENT no_such_event; -ERROR HY000: Unknown event 'no_such_event' +ERROR HY000: Failed to open mysql.event CREATE EVENT intact_check_1 ON SCHEDULE EVERY 5 HOUR DO SELECT 5; -ERROR HY000: Column count of mysql.event is wrong. Expected 22, found 20. The table is probably corrupted +ERROR HY000: Failed to open mysql.event ALTER EVENT intact_check_1 ON SCHEDULE EVERY 8 HOUR DO SELECT 8; -ERROR HY000: Unknown event 'intact_check_1' +ERROR HY000: Failed to open mysql.event ALTER EVENT intact_check_1 RENAME TO intact_check_2; -ERROR HY000: Unknown event 'intact_check_1' +ERROR HY000: Failed to open mysql.event DROP EVENT intact_check_1; -ERROR HY000: Unknown event 'intact_check_1' +ERROR HY000: Failed to open mysql.event DROP EVENT intact_check_2; -ERROR HY000: Unknown event 'intact_check_2' +ERROR HY000: Failed to open mysql.event DROP EVENT intact_check; +ERROR HY000: Failed to open mysql.event DROP DATABASE IF EXISTS mysqltest_no_such_database; Warnings: Note 1008 Can't drop database 'mysqltest_no_such_database'; database doesn't exist CREATE DATABASE mysqltest_db2; DROP DATABASE mysqltest_db2; +Warnings: +Error 1545 Failed to open mysql.event SELECT @@event_scheduler; @@event_scheduler OFF @@ -425,4 +435,42 @@ CREATE TABLE mysql.event like event_like; DROP TABLE event_like; SHOW EVENTS; Db Name Definer Time zone Type Execute at Interval value Interval field Starts Ends Status Originator character_set_client collation_connection Database Collation + +# +# Bug#12394306: the sever may crash if mysql.event is corrupted +# + +CREATE EVENT ev1 ON SCHEDULE EVERY 5 HOUR DO SELECT 5; +ALTER EVENT ev1 ON SCHEDULE EVERY 8 HOUR DO SELECT 8; + +CREATE TABLE event_original LIKE mysql.event; +INSERT INTO event_original SELECT * FROM mysql.event; + +ALTER TABLE mysql.event MODIFY modified CHAR(1); +Warnings: +Warning 1265 Data truncated for column 'modified' at row 1 + +SHOW EVENTS; +ERROR HY000: Failed to open mysql.event + +SELECT event_name, created, last_altered FROM information_schema.events; +ERROR HY000: Failed to open mysql.event + +CREATE EVENT ev2 ON SCHEDULE EVERY 5 HOUR DO SELECT 5; +ERROR HY000: Failed to open mysql.event + +ALTER EVENT ev1 ON SCHEDULE EVERY 9 HOUR DO SELECT 9; +ERROR HY000: Failed to open mysql.event + +DROP TABLE mysql.event; +RENAME TABLE event_original TO mysql.event; + +DROP EVENT ev1; + +SHOW EVENTS; +Db Name Definer Time zone Type Execute at Interval value Interval field Starts Ends Status Originator character_set_client collation_connection Database Collation + +# +# End of tests +# drop database events_test; diff --git a/mysql-test/r/events_restart.result b/mysql-test/r/events_restart.result index 4db61d357ce..6a751fa29f8 100644 --- a/mysql-test/r/events_restart.result +++ b/mysql-test/r/events_restart.result @@ -1,3 +1,4 @@ +call mtr.add_suppression("Column count of mysql.event is wrong. Expected .*, found .*\. The table is probably corrupted"); set global event_scheduler=off; drop database if exists events_test; create database events_test; @@ -52,6 +53,8 @@ Warnings: Note 1008 Can't drop database 'mysqltest_database_not_exists'; database doesn't exist create database mysqltest_db1; drop database mysqltest_db1; +Warnings: +Error 1545 Failed to open mysql.event Restore the original mysql.event table drop table mysql.event; rename table event_like to mysql.event; diff --git a/mysql-test/t/events_1.test b/mysql-test/t/events_1.test index ccdeb70d291..7f31e3fc881 100644 --- a/mysql-test/t/events_1.test +++ b/mysql-test/t/events_1.test @@ -4,6 +4,8 @@ # Can't test with embedded server that doesn't support grants -- source include/not_embedded.inc +call mtr.add_suppression("Column count of mysql.event is wrong. Expected .*, found .*\. The table is probably corrupted"); + --disable_warnings drop database if exists events_test; drop database if exists db_x; @@ -270,23 +272,28 @@ SHOW EVENTS; --echo Try to alter mysql.event: the server should fail to load --echo event information after mysql.event was tampered with. --echo ---echo First, let's add a column to the end and make sure everything ---echo works as before +--echo First, let's add a column to the end and check the error is emitted. --echo ALTER TABLE mysql.event ADD dummy INT; ---replace_column 8 # 9 # +--error ER_EVENT_OPEN_TABLE_FAILED SHOW EVENTS; +--error ER_EVENT_OPEN_TABLE_FAILED SELECT event_name FROM INFORMATION_SCHEMA.events; ---replace_regex /STARTS '[^']+'/STARTS '#'/ +--error ER_EVENT_OPEN_TABLE_FAILED SHOW CREATE EVENT intact_check; ---error ER_EVENT_DOES_NOT_EXIST +--error ER_EVENT_OPEN_TABLE_FAILED DROP EVENT no_such_event; +--error ER_EVENT_OPEN_TABLE_FAILED CREATE EVENT intact_check_1 ON SCHEDULE EVERY 5 HOUR DO SELECT 5; +--error ER_EVENT_OPEN_TABLE_FAILED ALTER EVENT intact_check_1 ON SCHEDULE EVERY 8 HOUR DO SELECT 8; +--error ER_EVENT_OPEN_TABLE_FAILED ALTER EVENT intact_check_1 RENAME TO intact_check_2; ---error ER_EVENT_DOES_NOT_EXIST +--error ER_EVENT_OPEN_TABLE_FAILED DROP EVENT intact_check_1; +--error ER_EVENT_OPEN_TABLE_FAILED DROP EVENT intact_check_2; +--error ER_EVENT_OPEN_TABLE_FAILED DROP EVENT intact_check; DROP DATABASE IF EXISTS mysqltest_no_such_database; CREATE DATABASE mysqltest_db2; @@ -296,6 +303,7 @@ SHOW VARIABLES LIKE 'event_scheduler'; SET GLOBAL event_scheduler=OFF; # Clean up ALTER TABLE mysql.event DROP dummy; +DROP EVENT intact_check; CREATE EVENT intact_check ON SCHEDULE EVERY 10 HOUR DO SELECT "nothing"; --echo --echo Now let's add a column to the first position: the server @@ -303,24 +311,26 @@ CREATE EVENT intact_check ON SCHEDULE EVERY 10 HOUR DO SELECT "nothing"; --echo ALTER TABLE mysql.event ADD dummy INT FIRST; --error ER_CANNOT_LOAD_FROM_TABLE +--error ER_EVENT_OPEN_TABLE_FAILED SHOW EVENTS; --error ER_CANNOT_LOAD_FROM_TABLE +--error ER_EVENT_OPEN_TABLE_FAILED SELECT event_name FROM INFORMATION_SCHEMA.events; ---error ER_EVENT_DOES_NOT_EXIST +--error ER_EVENT_OPEN_TABLE_FAILED SHOW CREATE EVENT intact_check; ---error ER_EVENT_DOES_NOT_EXIST +--error ER_EVENT_OPEN_TABLE_FAILED DROP EVENT no_such_event; ---error ER_EVENT_STORE_FAILED +--error ER_EVENT_OPEN_TABLE_FAILED CREATE EVENT intact_check_1 ON SCHEDULE EVERY 5 HOUR DO SELECT 5; ---error ER_EVENT_DOES_NOT_EXIST +--error ER_EVENT_OPEN_TABLE_FAILED ALTER EVENT intact_check_1 ON SCHEDULE EVERY 8 HOUR DO SELECT 8; ---error ER_EVENT_DOES_NOT_EXIST +--error ER_EVENT_OPEN_TABLE_FAILED ALTER EVENT intact_check_1 RENAME TO intact_check_2; ---error ER_EVENT_DOES_NOT_EXIST +--error ER_EVENT_OPEN_TABLE_FAILED DROP EVENT intact_check_1; ---error ER_EVENT_DOES_NOT_EXIST +--error ER_EVENT_OPEN_TABLE_FAILED DROP EVENT intact_check_2; ---error ER_EVENT_DOES_NOT_EXIST +--error ER_EVENT_OPEN_TABLE_FAILED DROP EVENT intact_check; # Should work OK DROP DATABASE IF EXISTS mysqltest_no_such_database; @@ -341,25 +351,25 @@ INSERT INTO event_like SELECT * FROM mysql.event; --echo --echo ALTER TABLE mysql.event DROP comment, DROP starts; ---error ER_CANNOT_LOAD_FROM_TABLE +--error ER_EVENT_OPEN_TABLE_FAILED SHOW EVENTS; ---error ER_CANNOT_LOAD_FROM_TABLE +--error ER_EVENT_OPEN_TABLE_FAILED SELECT event_name FROM INFORMATION_SCHEMA.EVENTS; ---error ER_CANNOT_LOAD_FROM_TABLE +--error ER_EVENT_OPEN_TABLE_FAILED SHOW CREATE EVENT intact_check; ---error ER_EVENT_DOES_NOT_EXIST +--error ER_EVENT_OPEN_TABLE_FAILED DROP EVENT no_such_event; ---error ER_COL_COUNT_DOESNT_MATCH_CORRUPTED +--error ER_EVENT_OPEN_TABLE_FAILED CREATE EVENT intact_check_1 ON SCHEDULE EVERY 5 HOUR DO SELECT 5; ---error ER_EVENT_DOES_NOT_EXIST +--error ER_EVENT_OPEN_TABLE_FAILED ALTER EVENT intact_check_1 ON SCHEDULE EVERY 8 HOUR DO SELECT 8; ---error ER_EVENT_DOES_NOT_EXIST +--error ER_EVENT_OPEN_TABLE_FAILED ALTER EVENT intact_check_1 RENAME TO intact_check_2; ---error ER_EVENT_DOES_NOT_EXIST +--error ER_EVENT_OPEN_TABLE_FAILED DROP EVENT intact_check_1; ---error ER_EVENT_DOES_NOT_EXIST +--error ER_EVENT_OPEN_TABLE_FAILED DROP EVENT intact_check_2; -# Should succeed +--error ER_EVENT_OPEN_TABLE_FAILED DROP EVENT intact_check; DROP DATABASE IF EXISTS mysqltest_no_such_database; CREATE DATABASE mysqltest_db2; @@ -407,9 +417,54 @@ CREATE TABLE mysql.event like event_like; DROP TABLE event_like; --replace_column 8 # 9 # SHOW EVENTS; -# -# End of tests -# + +--echo +--echo # +--echo # Bug#12394306: the sever may crash if mysql.event is corrupted +--echo # + +--echo +CREATE EVENT ev1 ON SCHEDULE EVERY 5 HOUR DO SELECT 5; +ALTER EVENT ev1 ON SCHEDULE EVERY 8 HOUR DO SELECT 8; + +--echo +CREATE TABLE event_original LIKE mysql.event; +INSERT INTO event_original SELECT * FROM mysql.event; + +--echo +ALTER TABLE mysql.event MODIFY modified CHAR(1); + +--echo +--error ER_EVENT_OPEN_TABLE_FAILED +SHOW EVENTS; + +--echo +--error ER_EVENT_OPEN_TABLE_FAILED +SELECT event_name, created, last_altered FROM information_schema.events; + +--echo +--error ER_EVENT_OPEN_TABLE_FAILED +CREATE EVENT ev2 ON SCHEDULE EVERY 5 HOUR DO SELECT 5; + +--echo +--error ER_EVENT_OPEN_TABLE_FAILED +ALTER EVENT ev1 ON SCHEDULE EVERY 9 HOUR DO SELECT 9; + +--echo +DROP TABLE mysql.event; +RENAME TABLE event_original TO mysql.event; + +--echo +DROP EVENT ev1; + +--echo +SHOW EVENTS; + + +--echo +--echo # +--echo # End of tests +--echo # let $wait_condition= select count(*) = 0 from information_schema.processlist diff --git a/mysql-test/t/events_restart.test b/mysql-test/t/events_restart.test index e155fe2ea16..facf2912087 100644 --- a/mysql-test/t/events_restart.test +++ b/mysql-test/t/events_restart.test @@ -1,6 +1,8 @@ # Can't test with embedded server that doesn't support grants -- source include/not_embedded.inc +call mtr.add_suppression("Column count of mysql.event is wrong. Expected .*, found .*\. The table is probably corrupted"); + # # Test that when the server is restarted, it checks mysql.event table, # and disables the scheduler if it's not up to date. diff --git a/sql/event_db_repository.cc b/sql/event_db_repository.cc index 7473cf47188..a0765dc6d15 100644 --- a/sql/event_db_repository.cc +++ b/sql/event_db_repository.cc @@ -582,6 +582,14 @@ Event_db_repository::open_event_table(THD *thd, enum thr_lock_type lock_type, *table= tables.table; tables.table->use_all_columns(); + + if (table_intact.check(*table, &event_table_def)) + { + close_thread_tables(thd); + my_error(ER_EVENT_OPEN_TABLE_FAILED, MYF(0)); + DBUG_RETURN(TRUE); + } + DBUG_RETURN(FALSE); } From 0efb452e5e3c201274755731d1867b309a34ae37 Mon Sep 17 00:00:00 2001 From: Luis Soares Date: Thu, 5 May 2011 23:48:15 +0100 Subject: [PATCH 89/91] BUG#12354268: MYSQLBINLOG --BASE64-OUTPUT=DECODE-ROWS DOES NOT WORK WITH --START-POSITION If setting --start-position to start after the FD event, mysqlbinlog will output an error stating that it has not found an FD event. However, its not that mysqlbinlog does not find it but rather that it does not processes it in the regular way (i.e., it does not print it). Given that one is using --base64-output=DECODE-ROWS then not printing it is actually fine. To fix this, we make mysqlbinlog not to complain when it has not printed the FD event, is outputing in base64, but is decoding the rows. --- client/mysqlbinlog.cc | 3 ++- mysql-test/r/mysqlbinlog_base64.result | 10 +++++++++ mysql-test/t/mysqlbinlog_base64.test | 29 ++++++++++++++++++++++++++ 3 files changed, 41 insertions(+), 1 deletion(-) diff --git a/client/mysqlbinlog.cc b/client/mysqlbinlog.cc index 30a8bddc17c..f451e28de86 100644 --- a/client/mysqlbinlog.cc +++ b/client/mysqlbinlog.cc @@ -951,7 +951,8 @@ Exit_status process_event(PRINT_EVENT_INFO *print_event_info, Log_event *ev, passed --short-form, because --short-form disables printing row events. */ - if (!print_event_info->printed_fd_event && !short_form) + if (!print_event_info->printed_fd_event && !short_form && + opt_base64_output_mode != BASE64_OUTPUT_DECODE_ROWS) { const char* type_str= ev->get_type_str(); if (opt_base64_output_mode == BASE64_OUTPUT_NEVER) diff --git a/mysql-test/r/mysqlbinlog_base64.result b/mysql-test/r/mysqlbinlog_base64.result index c5e1e2f8ca1..72d49c16cc8 100644 --- a/mysql-test/r/mysqlbinlog_base64.result +++ b/mysql-test/r/mysqlbinlog_base64.result @@ -109,3 +109,13 @@ count(*) 35840 drop table t1; drop table t2; +RESET MASTER; +USE test; +SET @old_binlog_format= @@binlog_format; +SET SESSION binlog_format=ROW; +CREATE TABLE t1(c1 INT); +INSERT INTO t1 VALUES (1); +FLUSH LOGS; +DROP TABLE t1; +SET SESSION binlog_format= @old_binlog_format; +RESET MASTER; diff --git a/mysql-test/t/mysqlbinlog_base64.test b/mysql-test/t/mysqlbinlog_base64.test index fb21e28fdcb..3d3444cea1c 100644 --- a/mysql-test/t/mysqlbinlog_base64.test +++ b/mysql-test/t/mysqlbinlog_base64.test @@ -71,3 +71,32 @@ select count(*) from t2; --remove_file $MYSQLTEST_VARDIR/tmp/mysqlbinlog_base64.sql drop table t1; drop table t2; + +# +# BUG#12354268 +# +# This test verifies that using --start-position with DECODE-ROWS +# does not make mysqlbinlog to output an error stating that it +# does not contain any FD event. +# + +RESET MASTER; +USE test; +SET @old_binlog_format= @@binlog_format; +SET SESSION binlog_format=ROW; +CREATE TABLE t1(c1 INT); +--let $master_binlog= query_get_value(SHOW MASTER STATUS, File, 1) +--let $master_pos= query_get_value(SHOW MASTER STATUS, Position, 1) +--let $MYSQLD_DATADIR= `SELECT @@datadir` + +INSERT INTO t1 VALUES (1); + +FLUSH LOGS; + +--disable_result_log +--exec $MYSQL_BINLOG --base64-output=DECODE-ROWS --start-position=$master_pos -v $MYSQLD_DATADIR/$master_binlog +--enable_result_log + +DROP TABLE t1; +SET SESSION binlog_format= @old_binlog_format; +RESET MASTER; From 8a08fd43411725545a61f16c5c78994d845f9352 Mon Sep 17 00:00:00 2001 From: Luis Soares Date: Fri, 6 May 2011 00:46:53 +0100 Subject: [PATCH 90/91] BUG#11762616: BUG#55229: 'POSTION' Fix for all "postion" in Oracle files (s/postion/position). Updated the copyright notices where needed. --- client/mysqltest.cc | 4 +-- extra/replace.c | 18 ++++++------ mysql-test/suite/rpl/r/rpl_server_id2.result | 2 +- mysql-test/suite/rpl/t/rpl_row_until.test | 10 +++---- mysql-test/suite/rpl/t/rpl_server_id2.test | 2 +- sql/handler.h | 17 +++++------ sql/slave.cc | 6 ++-- storage/archive/ha_archive.cc | 26 +++++++++-------- storage/ndb/src/kernel/blocks/lgman.cpp | 16 ++++++----- vio/viosocket.c | 30 +++++++++++--------- 10 files changed, 70 insertions(+), 61 deletions(-) diff --git a/client/mysqltest.cc b/client/mysqltest.cc index a1813838a24..c2410b14c19 100644 --- a/client/mysqltest.cc +++ b/client/mysqltest.cc @@ -9739,7 +9739,7 @@ int find_set(REP_SETS *sets,REP_SET *find) return i; } } - return i; /* return new postion */ + return i; /* return new position */ } /* find if there is a found_set with same table_offset & found_offset @@ -9759,7 +9759,7 @@ int find_found(FOUND_SET *found_set,uint table_offset, int found_offset) found_set[i].table_offset=table_offset; found_set[i].found_offset=found_offset; found_sets++; - return -i-2; /* return new postion */ + return -i-2; /* return new position */ } /* Return 1 if regexp starts with \b or ends with \b*/ diff --git a/extra/replace.c b/extra/replace.c index fd2d860c212..2df8a58e16a 100644 --- a/extra/replace.c +++ b/extra/replace.c @@ -1,17 +1,19 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. - This program is free software; you can redistribute it and/or modify - it under the terms of the GNU General Public License as published by - the Free Software Foundation; version 2 of the License. + This program is free software; you can redistribute it and/or + modify it under the terms of the GNU General Public License + as published by the Free Software Foundation; version 2 of + the License. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software - Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA */ + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA + 02110-1301 USA */ /* Replace strings in textfile @@ -819,7 +821,7 @@ static short find_set(REP_SETS *sets,REP_SET *find) return (short) i; } } - return (short) i; /* return new postion */ + return (short) i; /* return new position */ } @@ -842,7 +844,7 @@ static short find_found(FOUND_SET *found_set,uint table_offset, found_set[i].table_offset=table_offset; found_set[i].found_offset=found_offset; found_sets++; - return (short) (-i-2); /* return new postion */ + return (short) (-i-2); /* return new position */ } /* Return 1 if regexp starts with \b or ends with \b*/ diff --git a/mysql-test/suite/rpl/r/rpl_server_id2.result b/mysql-test/suite/rpl/r/rpl_server_id2.result index dacb69bc7cb..4f299a1b23b 100644 --- a/mysql-test/suite/rpl/r/rpl_server_id2.result +++ b/mysql-test/suite/rpl/r/rpl_server_id2.result @@ -19,7 +19,7 @@ change master to master_port=MASTER_PORT; start slave until master_log_file='master-bin.000001', master_log_pos=UNTIL_POS; include/wait_for_slave_io_to_start.inc include/wait_for_slave_sql_to_stop.inc -*** checking until postion execution: must be only t1 in the list *** +*** checking until position execution: must be only t1 in the list *** show tables; Tables_in_test t1 diff --git a/mysql-test/suite/rpl/t/rpl_row_until.test b/mysql-test/suite/rpl/t/rpl_row_until.test index afd964ca81a..bf38bd487ea 100644 --- a/mysql-test/suite/rpl/t/rpl_row_until.test +++ b/mysql-test/suite/rpl/t/rpl_row_until.test @@ -9,29 +9,29 @@ connection master; CREATE TABLE t1(n INT NOT NULL AUTO_INCREMENT PRIMARY KEY); INSERT INTO t1 VALUES (1),(2),(3),(4); DROP TABLE t1; -# Save master log postion for query DROP TABLE t1 +# Save master log position for query DROP TABLE t1 save_master_pos; let $master_pos_drop_t1= query_get_value(SHOW BINLOG EVENTS, Pos, 7); let $master_log_file= query_get_value(SHOW BINLOG EVENTS, Log_name, 7); CREATE TABLE t2(n INT NOT NULL AUTO_INCREMENT PRIMARY KEY); -# Save master log postion for query CREATE TABLE t2 +# Save master log position for query CREATE TABLE t2 save_master_pos; let $master_pos_create_t2= query_get_value(SHOW BINLOG EVENTS, Pos, 8); INSERT INTO t2 VALUES (1),(2); save_master_pos; -# Save master log postion for query INSERT INTO t2 VALUES (1),(2); +# Save master log position for query INSERT INTO t2 VALUES (1),(2); let $master_pos_insert1_t2= query_get_value(SHOW BINLOG EVENTS, End_log_pos, 12); sync_slave_with_master; -# Save relay log postion for query INSERT INTO t2 VALUES (1),(2); +# Save relay log position for query INSERT INTO t2 VALUES (1),(2); let $relay_pos_insert1_t2= query_get_value(show slave status, Relay_Log_Pos, 1); connection master; INSERT INTO t2 VALUES (3),(4); DROP TABLE t2; -# Save master log postion for query INSERT INTO t2 VALUES (1),(2); +# Save master log position for query INSERT INTO t2 VALUES (1),(2); let $master_pos_drop_t2= query_get_value(SHOW BINLOG EVENTS, End_log_pos, 17); sync_slave_with_master; diff --git a/mysql-test/suite/rpl/t/rpl_server_id2.test b/mysql-test/suite/rpl/t/rpl_server_id2.test index 32d5e1ec8f2..aeb7292ed17 100644 --- a/mysql-test/suite/rpl/t/rpl_server_id2.test +++ b/mysql-test/suite/rpl/t/rpl_server_id2.test @@ -47,7 +47,7 @@ eval start slave until master_log_file='master-bin.000001', master_log_pos=$unti --source include/wait_for_slave_io_to_start.inc --source include/wait_for_slave_sql_to_stop.inc ---echo *** checking until postion execution: must be only t1 in the list *** +--echo *** checking until position execution: must be only t1 in the list *** show tables; # cleanup diff --git a/sql/handler.h b/sql/handler.h index 9acdac700cd..03b0555ae86 100644 --- a/sql/handler.h +++ b/sql/handler.h @@ -1,18 +1,19 @@ -/* Copyright 2000-2008 MySQL AB, 2008 Sun Microsystems, Inc. +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. - This program is free software; you can redistribute it and/or modify - it under the terms of the GNU General Public License as published by - the Free Software Foundation; version 2 of the License. + This program is free software; you can redistribute it and/or + modify it under the terms of the GNU General Public License + as published by the Free Software Foundation; version 2 of + the License. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software - Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA */ - + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA + 02110-1301 USA */ /* Definitions for parameters to do with handler-routines */ @@ -56,7 +57,7 @@ a table with rnd_next() - We will see all rows (including deleted ones) - Row positions are 'table->s->db_record_offset' apart - If this flag is not set, filesort will do a postion() call for each matched + If this flag is not set, filesort will do a position() call for each matched row to be able to find the row later. */ #define HA_REC_NOT_IN_SEQ (1 << 3) diff --git a/sql/slave.cc b/sql/slave.cc index 6d266245460..dd578064f24 100644 --- a/sql/slave.cc +++ b/sql/slave.cc @@ -97,7 +97,7 @@ static const char *reconnect_messages[SLAVE_RECON_ACT_MAX][SLAVE_RECON_MSG_MAX]= registration on master", "Reconnecting after a failed registration on master", "failed registering on master, reconnecting to try again, \ -log '%s' at postion %s", +log '%s' at position %s", "COM_REGISTER_SLAVE", "Slave I/O thread killed during or after reconnect" }, @@ -105,7 +105,7 @@ log '%s' at postion %s", "Waiting to reconnect after a failed binlog dump request", "Slave I/O thread killed while retrying master dump", "Reconnecting after a failed binlog dump request", - "failed dump request, reconnecting to try again, log '%s' at postion %s", + "failed dump request, reconnecting to try again, log '%s' at position %s", "COM_BINLOG_DUMP", "Slave I/O thread killed during or after reconnect" }, @@ -114,7 +114,7 @@ log '%s' at postion %s", "Slave I/O thread killed while waiting to reconnect after a failed read", "Reconnecting after a failed master event read", "Slave I/O thread: Failed reading log event, reconnecting to retry, \ -log '%s' at postion %s", +log '%s' at position %s", "", "Slave I/O thread killed during or after a reconnect done to recover from \ failed read" diff --git a/storage/archive/ha_archive.cc b/storage/archive/ha_archive.cc index 988337ec50e..764ed16e931 100644 --- a/storage/archive/ha_archive.cc +++ b/storage/archive/ha_archive.cc @@ -1,17 +1,19 @@ -/* Copyright (C) 2003 MySQL AB +/* Copyright (c) 2003, 2011, Oracle and/or its affiliates. All rights reserved. - This program is free software; you can redistribute it and/or modify - it under the terms of the GNU General Public License as published by - the Free Software Foundation; version 2 of the License. + This program is free software; you can redistribute it and/or + modify it under the terms of the GNU General Public License + as published by the Free Software Foundation; version 2 of + the License. - This program is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the - GNU General Public License for more details. + This program is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the + GNU General Public License for more details. - You should have received a copy of the GNU General Public License - along with this program; if not, write to the Free Software - Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA */ + You should have received a copy of the GNU General Public License + along with this program; if not, write to the Free Software + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA + 02110-1301 USA */ #ifdef USE_PRAGMA_IMPLEMENTATION #pragma implementation // gcc: Class implementation @@ -864,7 +866,7 @@ int ha_archive::write_row(uchar *buf) */ azflush(&(share->archive_write), Z_SYNC_FLUSH); /* - Set the position of the local read thread to the beginning postion. + Set the position of the local read thread to the beginning position. */ if (read_data_header(&archive)) { diff --git a/storage/ndb/src/kernel/blocks/lgman.cpp b/storage/ndb/src/kernel/blocks/lgman.cpp index 53cb1e113e1..7dc71e7399a 100644 --- a/storage/ndb/src/kernel/blocks/lgman.cpp +++ b/storage/ndb/src/kernel/blocks/lgman.cpp @@ -1,17 +1,19 @@ -/* Copyright (C) 2003 MySQL AB +/* Copyright (c) 2003, 2011, Oracle and/or its affiliates. All rights reserved. - This program is free software; you can redistribute it and/or modify - it under the terms of the GNU General Public License as published by - the Free Software Foundation; version 2 of the License. + This program is free software; you can redistribute it and/or + modify it under the terms of the GNU General Public License + as published by the Free Software Foundation; version 2 of + the License. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software - Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA */ + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA + 02110-1301 USA */ #include "lgman.hpp" #include "diskpage.hpp" @@ -2501,7 +2503,7 @@ Lgman::init_run_undo_log(Signal* signal) sendSignal(reference(), GSN_CONTINUEB, signal, 2, JBB); /** - * Insert in correct postion in list of logfile_group's + * Insert in correct position in list of logfile_group's */ Ptr pos; for(tmp.first(pos); !pos.isNull(); tmp.next(pos)) diff --git a/vio/viosocket.c b/vio/viosocket.c index f73b890c697..15942fb3e31 100644 --- a/vio/viosocket.c +++ b/vio/viosocket.c @@ -1,17 +1,19 @@ -/* Copyright (C) 2000 MySQL AB +/* Copyright (c) 2000, 2011, Oracle and/or its affiliates. All rights reserved. - This program is free software; you can redistribute it and/or modify - it under the terms of the GNU General Public License as published by - the Free Software Foundation; version 2 of the License. + This program is free software; you can redistribute it and/or + modify it under the terms of the GNU General Public License + as published by the Free Software Foundation; version 2 of + the License. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software - Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA */ + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA + 02110-1301 USA */ /* Note that we can't have assertion on file descriptors; The reason for @@ -548,7 +550,7 @@ size_t vio_read_shared_memory(Vio * vio, uchar* buf, size_t size) { size_t length; size_t remain_local; - char *current_postion; + char *current_position; HANDLE events[2]; DBUG_ENTER("vio_read_shared_memory"); @@ -556,7 +558,7 @@ size_t vio_read_shared_memory(Vio * vio, uchar* buf, size_t size) size)); remain_local = size; - current_postion=buf; + current_position=buf; events[0]= vio->event_server_wrote; events[1]= vio->event_conn_closed; @@ -590,11 +592,11 @@ size_t vio_read_shared_memory(Vio * vio, uchar* buf, size_t size) if (length > remain_local) length = remain_local; - memcpy(current_postion,vio->shared_memory_pos,length); + memcpy(current_position,vio->shared_memory_pos,length); vio->shared_memory_remain-=length; vio->shared_memory_pos+=length; - current_postion+=length; + current_position+=length; remain_local-=length; if (!vio->shared_memory_remain) @@ -614,7 +616,7 @@ size_t vio_write_shared_memory(Vio * vio, const uchar* buf, size_t size) { size_t length, remain, sz; HANDLE pos; - const uchar *current_postion; + const uchar *current_position; HANDLE events[2]; DBUG_ENTER("vio_write_shared_memory"); @@ -622,7 +624,7 @@ size_t vio_write_shared_memory(Vio * vio, const uchar* buf, size_t size) size)); remain = size; - current_postion = buf; + current_position = buf; events[0]= vio->event_server_read; events[1]= vio->event_conn_closed; @@ -640,9 +642,9 @@ size_t vio_write_shared_memory(Vio * vio, const uchar* buf, size_t size) int4store(vio->handle_map,sz); pos = vio->handle_map + 4; - memcpy(pos,current_postion,sz); + memcpy(pos,current_position,sz); remain-=sz; - current_postion+=sz; + current_position+=sz; if (!SetEvent(vio->event_client_wrote)) DBUG_RETURN((size_t) -1); } From 79e4b561b721aa78b6d0840ef76529cf4cf31d1c Mon Sep 17 00:00:00 2001 From: Serge Kozlov Date: Mon, 9 May 2011 23:14:24 +0400 Subject: [PATCH 91/91] WL#5867 Replaced the error code by error name --- mysql-test/suite/binlog/t/binlog_bug23533.test | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) diff --git a/mysql-test/suite/binlog/t/binlog_bug23533.test b/mysql-test/suite/binlog/t/binlog_bug23533.test index c05abe788c6..ca610e399e4 100644 --- a/mysql-test/suite/binlog/t/binlog_bug23533.test +++ b/mysql-test/suite/binlog/t/binlog_bug23533.test @@ -35,7 +35,7 @@ connect(default,localhost,root,,test); # Copied data from t1 into t2 large than max_binlog_cache_size START TRANSACTION; ---error 1197 +--error ER_TRANS_CACHE_FULL CREATE TABLE t2 SELECT * FROM t1; COMMIT; SHOW TABLES LIKE 't%';